F423229

General Info

Members Datasets Scaffolds Average Seq Length
364 184 728 205

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100062750|Ga0070708_1000627502
Length 224
Sequence VTDIVTNVDGRPLSKRGLDTRRRLLDAAERVFGELGYHDASVVKVAEAAGVATGTFYLYFDTKKAVFDELVRDLNRRVRHAMKEASSRGATRLESERLGFDAYFRFTAEHPALYRIIRQAEFVSPEMLRYHYDRLSEGYIEALRAASEAGEIGELDAEVAAFALMGMGELIGMRWILWGEGTPLPARVSEELGRIIGRILGADRRRLDGGGEAEGPASPAPEQR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.58
Rhizosphere 82.42
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100062750 3300005445 Bacteria 3324
2 Ga0070658_10038996 3300005327 Bacteria 3832
3 Ga0070658_10200278 3300005327 Bacteria 1684
4 Ga0070683_100001420 3300005329 Bacteria 18387
5 Ga0070683_100066588 3300005329 Bacteria 3355
6 Ga0070683_100203376 3300005329 Bacteria 1881
7 Ga0070683_100531421 3300005329 Bacteria 1124
8 Ga0070680_100020254 3300005336 Bacteria 5279
9 Ga0070680_100054771 3300005336 Bacteria 3258
10 Ga0070680_100124448 3300005336 Bacteria 2154
11 Ga0070680_100669223 3300005336 Bacteria 893
12 Ga0070682_100660834 3300005337 Bacteria 833
13 Ga0068868_100540379 3300005338 Bacteria 1026
14 Ga0070660_100004183 3300005339 Bacteria 9964
15 Ga0070660_100015805 3300005339 Bacteria 5460
16 Ga0070660_100862512 3300005339 Bacteria 763
17 Ga0070661_100094994 3300005344 Bacteria 2210
18 Ga0070671_100647052 3300005355 Bacteria 915
19 Ga0070671_100800160 3300005355 Bacteria 821
20 Ga0070667_100011901 3300005367 Bacteria 7197
21 Ga0070713_100237972 3300005436 Bacteria 1657
22 Ga0070694_100304518 3300005444 Bacteria 1222
23 Ga0070708_100627687 3300005445 Bacteria 1013
24 Ga0070663_100775321 3300005455 Bacteria 820
25 Ga0070681_10062231 3300005458 Bacteria 3706
26 Ga0070681_10073165 3300005458 Bacteria 3389
27 Ga0070681_10141160 3300005458 Bacteria 2339
28 Ga0070707_100945515 3300005468 Bacteria 827
29 Ga0070698_100079907 3300005471 Bacteria 3266
30 Ga0070679_100022211 3300005530 Bacteria 6201
31 Ga0070679_100061458 3300005530 Bacteria 3744
32 Ga0070679_100365189 3300005530 Bacteria 1391
33 Ga0070684_100004961 3300005535 Bacteria 10158
34 Ga0070684_100011883 3300005535 Bacteria 6951
35 Ga0070684_100272752 3300005535 Bacteria 1549
36 Ga0070684_100768914 3300005535 Bacteria 900
37 Ga0068855_100044735 3300005563 Bacteria 5239
38 Ga0068855_100221496 3300005563 Bacteria 2121
39 Ga0068855_100233172 3300005563 Bacteria 2060
40 Ga0068855_101535418 3300005563 Bacteria 683
41 Ga0068857_100911761 3300005577 Bacteria 843
42 Ga0068856_100008437 3300005614 Bacteria 10032
43 Ga0068856_100533620 3300005614 Bacteria 1195
44 Ga0068858_100182080 3300005842 Bacteria 1984
45 Ga0070717_10659605 3300006028 Bacteria 950
46 Ga0097621_100166328 3300006237 Bacteria 1899
47 Ga0097621_100555576 3300006237 Bacteria 1045
48 Ga0068871_100233858 3300006358 Bacteria 1596
49 Ga0075434_100026375 3300006871 Bacteria 5692
50 Ga0068865_100553865 3300006881 Bacteria 966
51 Ga0075436_100545695 3300006914 Bacteria 851
52 Ga0105240_10049547 3300009093 Bacteria 5300
53 Ga0105240_10185674 3300009093 Bacteria 2449
54 Ga0105240_10961429 3300009093 Bacteria 916
55 Ga0105245_10447336 3300009098 Bacteria 1300
56 Ga0105245_10749737 3300009098 Bacteria 1012
57 Ga0114129_10060119 3300009147 Bacteria 5313
58 Ga0105241_10383610 3300009174 Bacteria 1228
59 Ga0105242_10548322 3300009176 Bacteria 1108
60 Ga0157370_10002564 3300013104 Bacteria 21809
61 Ga0157370_10007194 3300013104 Bacteria 12146
62 Ga0157369_10012690 3300013105 Bacteria 9555
63 Ga0157369_10888245 3300013105 Bacteria 914
64 Ga0157374_10554213 3300013296 Bacteria 1157
65 Ga0157378_10455618 3300013297 Bacteria 1270
66 Ga0157372_10507329 3300013307 Bacteria 1406
67 Ga0157372_10574907 3300013307 Bacteria 1313
68 Ga0157375_10691194 3300013308 Bacteria 1174
69 Ga0157375_11966038 3300013308 Unclassified 695
70 Ga0163163_10890870 3300014325 Bacteria 953
71 Ga0182008_10004564 3300014497 Bacteria 8064
72 Ga0157376_10194740 3300014969 Bacteria 1861
73 Ga0157376_10271737 3300014969 Bacteria 1593
74 Ga0157376_11034798 3300014969 Bacteria 845
75 Ga0182007_10058732 3300015262 Bacteria 1262
76 Ga0206356_11563673 3300020070 Bacteria 1719
77 Ga0206354_11309091 3300020081 Bacteria 1738
78 Ga0207692_10138104 3300025898 Bacteria 1384
79 Ga0207705_10071779 3300025909 Bacteria 2510
80 Ga0207705_10072294 3300025909 Bacteria 2501
81 Ga0207707_10134153 3300025912 Bacteria 2165
82 Ga0207707_10214246 3300025912 Bacteria 1677
83 Ga0207707_10459350 3300025912 Bacteria 1089
84 Ga0207695_10196022 3300025913 Bacteria 1936
85 Ga0207693_10142935 3300025915 Bacteria 1881
86 Ga0207660_10056231 3300025917 Bacteria 2815
87 Ga0207660_10065955 3300025917 Bacteria 2618
88 Ga0207660_10610136 3300025917 Bacteria 889
89 Ga0207657_10006706 3300025919 Bacteria 11897
90 Ga0207657_10009537 3300025919 Bacteria 9746
91 Ga0207657_10115538 3300025919 Bacteria 2212
92 Ga0207657_10120164 3300025919 Bacteria 2162
93 Ga0207657_10296194 3300025919 Bacteria 1282
94 Ga0207657_10547703 3300025919 Bacteria 905
95 Ga0207649_10060611 3300025920 Bacteria 2379
96 Ga0207652_10039781 3300025921 Bacteria 3991
97 Ga0207652_10196977 3300025921 Bacteria 1812
98 Ga0207652_10475230 3300025921 Bacteria 1126
99 Ga0207646_10080952 3300025922 Bacteria 2904
100 Ga0207646_10835955 3300025922 Bacteria 819
101 Ga0207687_10314717 3300025927 Bacteria 1265
102 Ga0207687_10323296 3300025927 Bacteria 1249
103 Ga0207700_10187377 3300025928 Bacteria 1737
104 Ga0207664_10349169 3300025929 Bacteria 1309
105 Ga0207664_10538538 3300025929 Bacteria 1047
106 Ga0207644_10121944 3300025931 Bacteria 1985
107 Ga0207661_10028786 3300025944 Bacteria 4259
108 Ga0207661_10051783 3300025944 Bacteria 3277
109 Ga0207661_10162939 3300025944 Bacteria 1936
110 Ga0207661_10564710 3300025944 Bacteria 1043
111 Ga0207667_10104773 3300025949 Bacteria 2918
112 Ga0207667_10195120 3300025949 Bacteria 2077
113 Ga0207667_11092271 3300025949 Bacteria 781
114 Ga0207658_10005359 3300025986 Bacteria 8809
115 Ga0207639_10440687 3300026041 Bacteria 1181
116 Ga0207678_10423306 3300026067 Bacteria 1155
117 Ga0207702_10011095 3300026078 Bacteria 7521
118 Ga0207674_10030971 3300026116 Bacteria 5623
119 Ga0207675_101176005 3300026118 Bacteria 787
120 Ga0207428_10018363 3300027907 Bacteria 5976
121 Ga0265318_10036096 3300028577 Bacteria 1898
122 Ga0265322_10002799 3300028654 Bacteria 5327
123 Ga0265336_10043817 3300028666 Bacteria 1363
124 Ga0265338_10021568 3300028800 Bacteria 6711
125 Ga0265330_10033450 3300031235 Bacteria 2299
126 Ga0265332_10258405 3300031238 Bacteria 720
127 Ga0265328_10037291 3300031239 Bacteria 1796
128 Ga0265325_10019349 3300031241 Bacteria 3765
129 Ga0265329_10035475 3300031242 Bacteria 1609
130 Ga0265331_10071403 3300031250 Bacteria 1624
131 Ga0265327_10007086 3300031251 Bacteria 8768
132 Ga0265316_10005420 3300031344 Bacteria 12395
133 Ga0265313_10003506 3300031595 Bacteria 12645
134 Ga0265314_10015176 3300031711 Bacteria 6122
135 Ga0307409_100241138 3300031995 Bacteria 1646
136 Ga0307416_100137861 3300032002 Bacteria 2211
137 Ga0373926_0069841 3300035083 Bacteria 1289
138 Ga0373943_0004206 3300035170 Bacteria 6526
139 Ga0373943_0006212 3300035170 Bacteria 5363
140 Ga0373924_0248386 3300035410 Bacteria 788
141 Ga0373947_0002451 3300035725 Bacteria 11168
142 Ga0373947_0008302 3300035725 Bacteria 5983
143 Ga0373947_0317109 3300035725 Bacteria 1042
144 Ga0373925_0021802 3300037068 Bacteria 4670
145 Ga0373925_0166309 3300037068 Bacteria 1739
146 Ga0395899_0015252 3300037312 Bacteria 5857
147 Ga0395899_0024795 3300037312 Bacteria 4532
148 Ga0395899_0137390 3300037312 Bacteria 1742
149 Ga0395899_0211930 3300037312 Bacteria 1346
150 Ga0395899_0498657 3300037312 Bacteria 790
151 Ga0395900_0004481 3300037418 Bacteria 14789
152 Ga0395900_0014370 3300037418 Bacteria 8082
153 Ga0395900_0036636 3300037418 Bacteria 5057
154 Ga0395900_0181965 3300037418 Bacteria 2135
155 Ga0395900_0419365 3300037418 Bacteria 1299
156 Ga0395900_0431019 3300037418 Bacteria 1278
157 Ga0395900_0443057 3300037418 Bacteria 1256
158 Ga0395900_0448187 3300037418 Bacteria 1247
159 Ga0395900_0454812 3300037418 Bacteria 1236
160 Ga0395900_0507209 3300037418 Bacteria 1156
161 Ga0395900_0743562 3300037418 Bacteria 911
162 Ga0395898_0003829 3300037466 Bacteria 16666
163 Ga0395898_0036216 3300037466 Bacteria 4901
164 Ga0395898_0068556 3300037466 Bacteria 3433
165 Ga0395898_0074205 3300037466 Bacteria 3286
166 Ga0395898_0090223 3300037466 Bacteria 2949
167 Ga0395898_0103241 3300037466 Bacteria 2736
168 Ga0395898_0256776 3300037466 Bacteria 1667
169 Ga0395898_0437924 3300037466 Bacteria 1245
170 Ga0395898_0880801 3300037466 Unclassified 834
171 Ga0395905_0005928 3300037471 Bacteria 12387
172 Ga0395905_0006272 3300037471 Bacteria 12002
173 Ga0395905_0010135 3300037471 Bacteria 9186
174 Ga0395905_0055096 3300037471 Bacteria 3722
175 Ga0395905_0342909 3300037471 Bacteria 1385
176 Ga0395901_0000391 3300038443 Bacteria 52295
177 Ga0395901_0005693 3300038443 Bacteria 12609
178 Ga0395901_0035681 3300038443 Bacteria 5138
179 Ga0395901_0054320 3300038443 Bacteria 4163
180 Ga0395901_0864869 3300038443 Bacteria 888
181 Ga0466966_0035469 3300044684 Bacteria 3221
182 Ga0466966_0380632 3300044684 Bacteria 848
183 Ga0466961_0007890 3300044693 Bacteria 6780
184 Ga0466961_0296088 3300044693 Bacteria 989
185 Ga0466961_0343069 3300044693 Bacteria 910
186 Ga0466963_0029973 3300044694 Bacteria 3506
187 Ga0466963_0031851 3300044694 Bacteria 3410
188 Ga0466963_0041692 3300044694 Bacteria 3011
189 Ga0466963_0234848 3300044694 Bacteria 1285
190 Ga0466964_0033570 3300044706 Bacteria 2045
191 Ga0466964_0040332 3300044706 Bacteria 1885
192 Ga0466971_0074405 3300044719 Bacteria 1544
193 Ga0466971_0081347 3300044719 Bacteria 1477
194 Ga0466971_0107253 3300044719 Bacteria 1287
195 Ga0466971_0250817 3300044719 Bacteria 843
196 Ga0466968_0117477 3300044735 Bacteria 1201
197 Ga0466968_0336441 3300044735 Bacteria 731
198 Ga0466970_0036960 3300044765 Bacteria 2587
199 Ga0466970_0249271 3300044765 Bacteria 995
200 Ga0466957_0015170 3300044842 Bacteria 4498
201 Ga0466957_0063830 3300044842 Bacteria 2265
202 Ga0466957_0140485 3300044842 Bacteria 1555
203 Ga0466960_0039604 3300044901 Bacteria 2224
204 Ga0466959_0037561 3300045049 Bacteria 3579
205 Ga0466959_0361854 3300045049 Bacteria 988
206 Ga0466958_0006728 3300045836 Bacteria 6275
207 Ga0466958_0051218 3300045836 Bacteria 2499
208 Ga0466958_0071439 3300045836 Bacteria 2125
209 Ga0466958_0167411 3300045836 Bacteria 1391
210 Ga0466967_0022528 3300045976 Bacteria 5142
211 Ga0466967_0055702 3300045976 Bacteria 3483
212 Ga0466967_0058041 3300045976 Bacteria 3419
213 Ga0466967_0131154 3300045976 Bacteria 2327
214 Ga0466967_0312517 3300045976 Bacteria 1514
215 Ga0466967_0406399 3300045976 Bacteria 1325
216 Ga0466967_0653902 3300045976 Bacteria 1039
217 Ga0495592_0100014 3300046454 Bacteria 2068
218 Ga0495603_0081089 3300046455 Bacteria 1901
219 Ga0495603_0097127 3300046455 Bacteria 1721
220 Ga0495603_0379056 3300046455 Bacteria 811
221 Ga0495629_0050042 3300046459 Bacteria 2928
222 Ga0495629_0324015 3300046459 Bacteria 1053
223 Ga0495651_0077002 3300046462 Bacteria 2525
224 Ga0495653_0069432 3300046463 Bacteria 2640
225 Ga0495580_0226175 3300046472 Bacteria 1285
226 Ga0495664_0213785 3300046477 Bacteria 1168
227 Ga0495608_0209309 3300046511 Bacteria 1227
228 Ga0495618_0181433 3300046514 Bacteria 1337
229 Ga0495628_0013443 3300046516 Bacteria 6887
230 Ga0495630_0003438 3300046517 Bacteria 11011
231 Ga0495630_0576789 3300046517 Bacteria 862
232 Ga0495652_0231834 3300046529 Bacteria 1380
233 Ga0495587_0055749 3300046536 Bacteria 2327
234 Ga0495645_0145604 3300046543 Bacteria 1650
235 Ga0495667_0507074 3300046559 Bacteria 756
236 Ga0495634_0017829 3300046642 Bacteria 5063
237 Ga0495635_0038954 3300046663 Bacteria 3291
238 Ga0495657_0011471 3300046675 Bacteria 6625
239 Ga0495657_0049615 3300046675 Bacteria 2826
240 Ga0495599_0204929 3300046678 Bacteria 1211
241 Ga0495613_0111844 3300046689 Bacteria 1967
242 Ga0495613_0442916 3300046689 Bacteria 881
243 Ga0495624_0126485 3300046690 Bacteria 1568
244 Ga0495624_0136414 3300046690 Bacteria 1504
245 Ga0495600_0143557 3300046809 Bacteria 1548
246 Ga0495604_0158877 3300047317 Bacteria 1599
247 Ga0495674_0001328 3300047319 Bacteria 24089
248 Ga0495676_0087845 3300047321 Bacteria 2334
249 Ga0495676_0154848 3300047321 Bacteria 1627
250 Ga0495676_0204396 3300047321 Bacteria 1371
251 Ga0495680_0008724 3300047322 Bacteria 9186
252 Ga0495680_0121455 3300047322 Bacteria 1928
253 Ga0495680_0397709 3300047322 Bacteria 952
254 Ga0495593_0046714 3300047673 Bacteria 2306
255 Ga0496100_0001726 3300048903 Bacteria 10886
256 Ga0496100_0010611 3300048903 Bacteria 5219
257 Ga0496100_0013640 3300048903 Bacteria 4694
258 Ga0496100_0356826 3300048903 Bacteria 1105
259 Ga0496101_0001346 3300048904 Bacteria 14721
260 Ga0496101_0038157 3300048904 Bacteria 3411
261 Ga0496101_0079976 3300048904 Bacteria 2414
262 Ga0496101_0224721 3300048904 Bacteria 1458
263 Ga0496101_0327894 3300048904 Bacteria 1201
264 Ga0496101_0357928 3300048904 Bacteria 1147
265 Ga0496102_0001563 3300048905 Bacteria 20213
266 Ga0496102_0015892 3300048905 Bacteria 6566
267 Ga0496102_0055100 3300048905 Bacteria 3626
268 Ga0496102_0064576 3300048905 Bacteria 3353
269 Ga0496102_0466184 3300048905 Bacteria 1184
270 Ga0496103_0035686 3300048906 Bacteria 3044
271 Ga0496103_0071419 3300048906 Bacteria 2172
272 Ga0496103_0318859 3300048906 Bacteria 1000
273 Ga0496104_0001433 3300048907 Bacteria 20613
274 Ga0496104_0001713 3300048907 Bacteria 18934
275 Ga0496104_0018162 3300048907 Bacteria 6414
276 Ga0496104_0316314 3300048907 Bacteria 1474
277 Ga0496104_0352343 3300048907 Bacteria 1385
278 Ga0496105_0000475 3300048908 Bacteria 26269
279 Ga0496105_0001022 3300048908 Bacteria 19328
280 Ga0496105_0019834 3300048908 Bacteria 5425
281 Ga0496105_0041184 3300048908 Bacteria 3807
282 Ga0496106_0020556 3300048909 Bacteria 4901
283 Ga0496106_0044809 3300048909 Bacteria 3322
284 Ga0496106_0096945 3300048909 Bacteria 2283
285 Ga0496106_0647314 3300048909 Bacteria 844
286 Ga0496107_0000803 3300048910 Bacteria 18222
287 Ga0496107_0100501 3300048910 Bacteria 2120
288 Ga0496107_0232748 3300048910 Bacteria 1371
289 Ga0496107_0310554 3300048910 Bacteria 1173
290 Ga0496108_0000549 3300048911 Bacteria 29334
291 Ga0496108_0002244 3300048911 Bacteria 15465
292 Ga0496109_0000479 3300048912 Bacteria 34013
293 Ga0496109_0000687 3300048912 Bacteria 28217
294 Ga0496109_0427357 3300048912 Bacteria 1251
295 Ga0496110_0000929 3300048913 Bacteria 20551
296 Ga0496110_0083223 3300048913 Bacteria 2854
297 Ga0496110_0162843 3300048913 Bacteria 2022
298 Ga0496110_0258721 3300048913 Bacteria 1584
299 Ga0496111_0000417 3300048914 Bacteria 21445
300 Ga0496111_0009062 3300048914 Bacteria 6624
301 Ga0496111_0388012 3300048914 Bacteria 1032
302 Ga0496112_0004422 3300048915 Bacteria 11903
303 Ga0496112_0021837 3300048915 Bacteria 6090
304 Ga0496112_0055234 3300048915 Bacteria 3904
305 Ga0496112_0145047 3300048915 Bacteria 2342
306 Ga0496112_0156301 3300048915 Bacteria 2247
307 Ga0496112_0387950 3300048915 Bacteria 1337
308 Ga0496113_0068250 3300048916 Bacteria 2698
309 Ga0496113_0254928 3300048916 Bacteria 1401
310 Ga0496114_0001039 3300048917 Bacteria 20885
311 Ga0496114_0007054 3300048917 Bacteria 8866
312 Ga0496114_0054852 3300048917 Bacteria 3323
313 Ga0496114_0075877 3300048917 Bacteria 2832
314 Ga0496114_0111590 3300048917 Bacteria 2343
315 Ga0496114_0195953 3300048917 Bacteria 1768
316 Ga0496115_0006833 3300048918 Bacteria 8374
317 Ga0496115_0117369 3300048918 Bacteria 2189
318 Ga0496115_0400818 3300048918 Bacteria 1113
319 Ga0501031_0002745 3300049568 Bacteria 11219
320 Ga0501034_0190590 3300049571 Bacteria 2013
321 Ga0501036_0069721 3300049572 Bacteria 2973
322 Ga0501038_0037636 3300049574 Bacteria 4241
323 Ga0501039_0004850 3300049575 Bacteria 10183
324 Ga0501040_0001159 3300049576 Bacteria 16781
325 Ga0501041_0000380 3300049577 Bacteria 22277
326 Ga0501043_0121993 3300049579 Bacteria 2044
327 Ga0501046_0628406 3300049580 Bacteria 760
328 Ga0501047_0073069 3300049581 Bacteria 3302
329 Ga0501048_0014895 3300049582 Bacteria 5750
330 Ga0501067_0041870 3300049583 Bacteria 2544
331 Ga0501067_0185204 3300049583 Bacteria 1159
332 Ga0501069_0124656 3300049585 Bacteria 1473
333 Ga0501069_0305285 3300049585 Bacteria 934
334 Ga0501070_0048084 3300049586 Bacteria 3544
335 Ga0501070_0332127 3300049586 Bacteria 1235
336 Ga0501071_0016370 3300049587 Bacteria 5097
337 Ga0501072_0001800 3300049588 Bacteria 15961
338 Ga0501074_0025689 3300049590 Bacteria 4274
339 Ga0501074_0098391 3300049590 Bacteria 2094
340 Ga0501075_0042727 3300049591 Bacteria 3399
341 Ga0501076_0003454 3300049592 Bacteria 11085
342 Ga0501079_0054656 3300049741 Bacteria 3079
343 Ga0501080_0279087 3300049742 Bacteria 1519
344 Ga0501080_0347390 3300049742 Bacteria 1340
345 Ga0501081_0001279 3300049743 Bacteria 15291
346 Ga0501035_0026904 3300049822 Bacteria 5259
347 Ga0501044_0226291 3300049823 Bacteria 1820
348 Ga0501044_0262559 3300049823 Bacteria 1665
349 Ga0501044_0673443 3300049823 Bacteria 922
350 nmdc:mga05p37_76455_c1 3300050507 Bacteria 4122
351 nmdc:mga08y16_29744_c1 3300050511 Bacteria 5751
352 nmdc:mga0n895_80420_c1 3300050512 Bacteria 3247
353 nmdc:mga08x19_108711_c1 3300050514 Bacteria 1847
354 nmdc:mga08x19_413460_c1 3300050514 Bacteria 947
355 Ga0495601_0298468 3300053077 Bacteria 1050
356 Ga0495601_0538398 3300053077 Bacteria 752
357 Ga0495655_0002707 3300053083 Bacteria 2844
358 Ga0495595_0071866 3300053084 Bacteria 1637
359 Ga0495595_0200497 3300053084 Bacteria 993
360 Ga0495619_0053658 3300053085 Bacteria 2667
361 Ga0501084_0002635 3300054114 Bacteria 14457
362 Ga0501082_0101877 3300060353 Bacteria 2484
363 Ga0466962_0063135 3300061719 Bacteria 1768
364 Ga0466962_0099480 3300061719 Bacteria 1396
365 Ga0070708_100062750
366 Ga0070658_10038996
367 Ga0070658_10200278
368 Ga0070683_100001420
369 Ga0070683_100066588
370 Ga0070683_100203376
371 Ga0070683_100531421
372 Ga0070680_100020254
373 Ga0070680_100054771
374 Ga0070680_100124448
375 Ga0070680_100669223
376 Ga0070682_100660834
377 Ga0068868_100540379
378 Ga0070660_100004183
379 Ga0070660_100015805
380 Ga0070660_100862512
381 Ga0070661_100094994
382 Ga0070671_100647052
383 Ga0070671_100800160
384 Ga0070667_100011901
385 Ga0070713_100237972
386 Ga0070694_100304518
387 Ga0070708_100627687
388 Ga0070663_100775321
389 Ga0070681_10062231
390 Ga0070681_10073165
391 Ga0070681_10141160
392 Ga0070707_100945515
393 Ga0070698_100079907
394 Ga0070679_100022211
395 Ga0070679_100061458
396 Ga0070679_100365189
397 Ga0070684_100004961
398 Ga0070684_100011883
399 Ga0070684_100272752
400 Ga0070684_100768914
401 Ga0068855_100044735
402 Ga0068855_100221496
403 Ga0068855_100233172
404 Ga0068855_101535418
405 Ga0068857_100911761
406 Ga0068856_100008437
407 Ga0068856_100533620
408 Ga0068858_100182080
409 Ga0070717_10659605
410 Ga0097621_100166328
411 Ga0097621_100555576
412 Ga0068871_100233858
413 Ga0075434_100026375
414 Ga0068865_100553865
415 Ga0075436_100545695
416 Ga0105240_10049547
417 Ga0105240_10185674
418 Ga0105240_10961429
419 Ga0105245_10447336
420 Ga0105245_10749737
421 Ga0114129_10060119
422 Ga0105241_10383610
423 Ga0105242_10548322
424 Ga0157370_10002564
425 Ga0157370_10007194
426 Ga0157369_10012690
427 Ga0157369_10888245
428 Ga0157374_10554213
429 Ga0157378_10455618
430 Ga0157372_10507329
431 Ga0157372_10574907
432 Ga0157375_10691194
433 Ga0157375_11966038
434 Ga0163163_10890870
435 Ga0182008_10004564
436 Ga0157376_10194740
437 Ga0157376_10271737
438 Ga0157376_11034798
439 Ga0182007_10058732
440 Ga0206356_11563673
441 Ga0206354_11309091
442 Ga0207692_10138104
443 Ga0207705_10071779
444 Ga0207705_10072294
445 Ga0207707_10134153
446 Ga0207707_10214246
447 Ga0207707_10459350
448 Ga0207695_10196022
449 Ga0207693_10142935
450 Ga0207660_10056231
451 Ga0207660_10065955
452 Ga0207660_10610136
453 Ga0207657_10006706
454 Ga0207657_10009537
455 Ga0207657_10115538
456 Ga0207657_10120164
457 Ga0207657_10296194
458 Ga0207657_10547703
459 Ga0207649_10060611
460 Ga0207652_10039781
461 Ga0207652_10196977
462 Ga0207652_10475230
463 Ga0207646_10080952
464 Ga0207646_10835955
465 Ga0207687_10314717
466 Ga0207687_10323296
467 Ga0207700_10187377
468 Ga0207664_10349169
469 Ga0207664_10538538
470 Ga0207644_10121944
471 Ga0207661_10028786
472 Ga0207661_10051783
473 Ga0207661_10162939
474 Ga0207661_10564710
475 Ga0207667_10104773
476 Ga0207667_10195120
477 Ga0207667_11092271
478 Ga0207658_10005359
479 Ga0207639_10440687
480 Ga0207678_10423306
481 Ga0207702_10011095
482 Ga0207674_10030971
483 Ga0207675_101176005
484 Ga0207428_10018363
485 Ga0265318_10036096
486 Ga0265322_10002799
487 Ga0265336_10043817
488 Ga0265338_10021568
489 Ga0265330_10033450
490 Ga0265332_10258405
491 Ga0265328_10037291
492 Ga0265325_10019349
493 Ga0265329_10035475
494 Ga0265331_10071403
495 Ga0265327_10007086
496 Ga0265316_10005420
497 Ga0265313_10003506
498 Ga0265314_10015176
499 Ga0307409_100241138
500 Ga0307416_100137861
501 Ga0373926_0069841
502 Ga0373943_0004206
503 Ga0373943_0006212
504 Ga0373924_0248386
505 Ga0373947_0002451
506 Ga0373947_0008302
507 Ga0373947_0317109
508 Ga0373925_0021802
509 Ga0373925_0166309
510 Ga0395899_0015252
511 Ga0395899_0024795
512 Ga0395899_0137390
513 Ga0395899_0211930
514 Ga0395899_0498657
515 Ga0395900_0004481
516 Ga0395900_0014370
517 Ga0395900_0036636
518 Ga0395900_0181965
519 Ga0395900_0419365
520 Ga0395900_0431019
521 Ga0395900_0443057
522 Ga0395900_0448187
523 Ga0395900_0454812
524 Ga0395900_0507209
525 Ga0395900_0743562
526 Ga0395898_0003829
527 Ga0395898_0036216
528 Ga0395898_0068556
529 Ga0395898_0074205
530 Ga0395898_0090223
531 Ga0395898_0103241
532 Ga0395898_0256776
533 Ga0395898_0437924
534 Ga0395898_0880801
535 Ga0395905_0005928
536 Ga0395905_0006272
537 Ga0395905_0010135
538 Ga0395905_0055096
539 Ga0395905_0342909
540 Ga0395901_0000391
541 Ga0395901_0005693
542 Ga0395901_0035681
543 Ga0395901_0054320
544 Ga0395901_0864869
545 Ga0466966_0035469
546 Ga0466966_0380632
547 Ga0466961_0007890
548 Ga0466961_0296088
549 Ga0466961_0343069
550 Ga0466963_0029973
551 Ga0466963_0031851
552 Ga0466963_0041692
553 Ga0466963_0234848
554 Ga0466964_0033570
555 Ga0466964_0040332
556 Ga0466971_0074405
557 Ga0466971_0081347
558 Ga0466971_0107253
559 Ga0466971_0250817
560 Ga0466968_0117477
561 Ga0466968_0336441
562 Ga0466970_0036960
563 Ga0466970_0249271
564 Ga0466957_0015170
565 Ga0466957_0063830
566 Ga0466957_0140485
567 Ga0466960_0039604
568 Ga0466959_0037561
569 Ga0466959_0361854
570 Ga0466958_0006728
571 Ga0466958_0051218
572 Ga0466958_0071439
573 Ga0466958_0167411
574 Ga0466967_0022528
575 Ga0466967_0055702
576 Ga0466967_0058041
577 Ga0466967_0131154
578 Ga0466967_0312517
579 Ga0466967_0406399
580 Ga0466967_0653902
581 Ga0495592_0100014
582 Ga0495603_0081089
583 Ga0495603_0097127
584 Ga0495603_0379056
585 Ga0495629_0050042
586 Ga0495629_0324015
587 Ga0495651_0077002
588 Ga0495653_0069432
589 Ga0495580_0226175
590 Ga0495664_0213785
591 Ga0495608_0209309
592 Ga0495618_0181433
593 Ga0495628_0013443
594 Ga0495630_0003438
595 Ga0495630_0576789
596 Ga0495652_0231834
597 Ga0495587_0055749
598 Ga0495645_0145604
599 Ga0495667_0507074
600 Ga0495634_0017829
601 Ga0495635_0038954
602 Ga0495657_0011471
603 Ga0495657_0049615
604 Ga0495599_0204929
605 Ga0495613_0111844
606 Ga0495613_0442916
607 Ga0495624_0126485
608 Ga0495624_0136414
609 Ga0495600_0143557
610 Ga0495604_0158877
611 Ga0495674_0001328
612 Ga0495676_0087845
613 Ga0495676_0154848
614 Ga0495676_0204396
615 Ga0495680_0008724
616 Ga0495680_0121455
617 Ga0495680_0397709
618 Ga0495593_0046714
619 Ga0496100_0001726
620 Ga0496100_0010611
621 Ga0496100_0013640
622 Ga0496100_0356826
623 Ga0496101_0001346
624 Ga0496101_0038157
625 Ga0496101_0079976
626 Ga0496101_0224721
627 Ga0496101_0327894
628 Ga0496101_0357928
629 Ga0496102_0001563
630 Ga0496102_0015892
631 Ga0496102_0055100
632 Ga0496102_0064576
633 Ga0496102_0466184
634 Ga0496103_0035686
635 Ga0496103_0071419
636 Ga0496103_0318859
637 Ga0496104_0001433
638 Ga0496104_0001713
639 Ga0496104_0018162
640 Ga0496104_0316314
641 Ga0496104_0352343
642 Ga0496105_0000475
643 Ga0496105_0001022
644 Ga0496105_0019834
645 Ga0496105_0041184
646 Ga0496106_0020556
647 Ga0496106_0044809
648 Ga0496106_0096945
649 Ga0496106_0647314
650 Ga0496107_0000803
651 Ga0496107_0100501
652 Ga0496107_0232748
653 Ga0496107_0310554
654 Ga0496108_0000549
655 Ga0496108_0002244
656 Ga0496109_0000479
657 Ga0496109_0000687
658 Ga0496109_0427357
659 Ga0496110_0000929
660 Ga0496110_0083223
661 Ga0496110_0162843
662 Ga0496110_0258721
663 Ga0496111_0000417
664 Ga0496111_0009062
665 Ga0496111_0388012
666 Ga0496112_0004422
667 Ga0496112_0021837
668 Ga0496112_0055234
669 Ga0496112_0145047
670 Ga0496112_0156301
671 Ga0496112_0387950
672 Ga0496113_0068250
673 Ga0496113_0254928
674 Ga0496114_0001039
675 Ga0496114_0007054
676 Ga0496114_0054852
677 Ga0496114_0075877
678 Ga0496114_0111590
679 Ga0496114_0195953
680 Ga0496115_0006833
681 Ga0496115_0117369
682 Ga0496115_0400818
683 Ga0501031_0002745
684 Ga0501034_0190590
685 Ga0501036_0069721
686 Ga0501038_0037636
687 Ga0501039_0004850
688 Ga0501040_0001159
689 Ga0501041_0000380
690 Ga0501043_0121993
691 Ga0501046_0628406
692 Ga0501047_0073069
693 Ga0501048_0014895
694 Ga0501067_0041870
695 Ga0501067_0185204
696 Ga0501069_0124656
697 Ga0501069_0305285
698 Ga0501070_0048084
699 Ga0501070_0332127
700 Ga0501071_0016370
701 Ga0501072_0001800
702 Ga0501074_0025689
703 Ga0501074_0098391
704 Ga0501075_0042727
705 Ga0501076_0003454
706 Ga0501079_0054656
707 Ga0501080_0279087
708 Ga0501080_0347390
709 Ga0501081_0001279
710 Ga0501035_0026904
711 Ga0501044_0226291
712 Ga0501044_0262559
713 Ga0501044_0673443
714 nmdc:mga05p37_76455_c1
715 nmdc:mga08y16_29744_c1
716 nmdc:mga0n895_80420_c1
717 nmdc:mga08x19_108711_c1
718 nmdc:mga08x19_413460_c1
719 Ga0495601_0298468
720 Ga0495601_0538398
721 Ga0495655_0002707
722 Ga0495595_0071866
723 Ga0495595_0200497
724 Ga0495619_0053658
725 Ga0501084_0002635
726 Ga0501082_0101877
727 Ga0466962_0063135
728 Ga0466962_0099480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

24

70

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6en8-assembly1.cif.gz_C safadr in complex with dsdna 0.9523 14 202
6en8-assembly1.cif.gz_B safadr in complex with dsdna 0.9339 21 202
6en8-assembly1.cif.gz_C safadr in complex with dsdna 0.9332 14 202
6el2-assembly1.cif.gz_B safadr_lauroyl_coa complex 0.9306 22 202
6en8-assembly1.cif.gz_E safadr in complex with dsdna 0.9202 14 202
ID Description Score Start End Superfamily
3whcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9998 22 64 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9945 22 64 1.10.10.60
4i76B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9936 22 64 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9919 22 64 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9915 24 64 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A0J1I512-F1-model_v4 Putative HTH-type transcriptional regulator YvdT 0.9705 16 200 GO:0003677
AF-A0A285VUL5-F1-model_v4 Transcriptional regulator, TetR family 0.9701 14 206 GO:0000976
GO:0003700
AF-A0A2V3W7J2-F1-model_v4 TetR family transcriptional regulator 0.9697 15 203 GO:0003677
AF-A0A261QJ47-F1-model_v4 TetR family transcriptional regulator 0.9686 22 203 GO:0003677
AF-A0A7V6Q5V0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9679 13 200 GO:0003677

Map