F423223

General Info

Members Datasets Scaffolds Average Seq Length
364 233 728 347

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100020146|Ga0070714_1000201465
Length 384
Sequence MTGYRVVQWATGNIGTRALRAVIEHPGLSLAGVYVHSPAKAGKDAGDLCGLPGTGVTATGDIGEILALGADCVLYMPAACDVDEVCRLLASGANVVTTRGEFHRPAGMKPDVRERVEAACEQGGSSVHSTGSSPGFITEALPLVLTSIQRRLDGLAISEFADLSQRNSPDLLFNVMGFGRPAADFDQRRLSYGKVSFGPSLELVADALSIPLDWVEAGGEVAVARNRVRIAAGTLEAGTVAAQRMMVSGIRNGQPVLRFCATWYCTADLDLSWDVRATGWHILVEGDAPLDIDIRFPVPLERMGATSPAYTANRAVNAVPYVCAASPGIRTSVDLPRSSPPSSWVLGGHTLHANKAAAGNGVPPGTSASQAPAGQHHSRMVVAT

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
35 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
77 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
78 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
96 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
203 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
204 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
209 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
210 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
211 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
212 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2508501039 Frankia saprophytica CN3 Isolate Nodule
218 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
219 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
220 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
221 2671180195 Frankia sp. CcI49 Isolate Nodule
222 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
223 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
224 2687453737 Frankia sp. BMG5.36 Isolate Nodule
225 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
226 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
227 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
228 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
229 2773857922 Frankia sp. CcI49 Isolate Nodule
230 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
231 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
232 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
233 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.23
Metatranscriptomes 0.27
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.44
Nodule 3.02
Rhizoplane 0.55
Rhizosphere 76.37
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100020146 3300005435 Bacteria 5443
2 JGI25165J46597_1000156 3300003214 Bacteria 109696
3 rootH2_10138886 3300003320 Bacteria 6184
4 Ga0068869_100129154 3300005334 Bacteria 1941
5 Ga0070714_100250988 3300005435 Bacteria 1636
6 Ga0070713_100042165 3300005436 Bacteria 3723
7 Ga0070713_100137112 3300005436 Bacteria 2163
8 Ga0070701_10171407 3300005438 Unclassified 1264
9 Ga0070711_100263973 3300005439 Bacteria 1356
10 Ga0070706_100205271 3300005467 Bacteria 1841
11 Ga0070706_100267373 3300005467 Bacteria 1596
12 Ga0070707_100112689 3300005468 Bacteria 2638
13 Ga0070698_100001547 3300005471 Bacteria 25515
14 Ga0070697_100157178 3300005536 Bacteria 1920
15 Ga0081455_10003382 3300005937 Bacteria 18380
16 Ga0081455_10005865 3300005937 Bacteria 13353
17 Ga0081455_10036134 3300005937 Bacteria 4403
18 Ga0081538_10000383 3300005981 Bacteria 50305
19 Ga0075368_10003920 3300006042 Bacteria 5009
20 Ga0075363_100017866 3300006048 Bacteria 3525
21 Ga0075364_10013667 3300006051 Bacteria 5000
22 Ga0070715_10060742 3300006163 Bacteria 1658
23 Ga0070712_100193170 3300006175 Bacteria 1594
24 Ga0075367_10000169 3300006178 Bacteria 20876
25 Ga0075367_10031076 3300006178 Bacteria 3066
26 Ga0075370_10058148 3300006353 Unclassified 2199
27 Ga0075370_10100259 3300006353 Bacteria 1676
28 Ga0075428_100035925 3300006844 Bacteria 5461
29 Ga0075428_100320494 3300006844 Bacteria 1666
30 Ga0075428_100367241 3300006844 Bacteria 1543
31 Ga0075430_100006467 3300006846 Bacteria 9872
32 Ga0075430_100036663 3300006846 Bacteria 4158
33 Ga0075430_100070476 3300006846 Bacteria 2932
34 Ga0075430_100150183 3300006846 Unclassified 1940
35 Ga0075430_100298104 3300006846 Bacteria 1333
36 Ga0075431_100005669 3300006847 Bacteria 12344
37 Ga0075431_100061270 3300006847 Bacteria 3882
38 Ga0075433_10308308 3300006852 Bacteria 1401
39 Ga0075429_100001060 3300006880 Bacteria 21986
40 Ga0075429_100253078 3300006880 Bacteria 1542
41 Ga0079104_1008834 3300006946 Bacteria 3469
42 Ga0111539_10004723 3300009094 Bacteria 17802
43 Ga0111539_10074640 3300009094 Bacteria 3996
44 Ga0114129_10185561 3300009147 Bacteria 2827
45 Ga0114129_10323052 3300009147 Bacteria 2051
46 Ga0114129_10520555 3300009147 Unclassified 1551
47 Ga0105243_10126769 3300009148 Bacteria 2161
48 Ga0105237_10001939 3300009545 Bacteria 26362
49 Ga0105239_10041383 3300010375 Bacteria 5051
50 Ga0213876_10001480 3300021384 Bacteria 14632
51 Ga0209437_103004 3300025233 Bacteria 3124
52 Ga0209233_1000213 3300025261 Bacteria 109881
53 Ga0207642_10027832 3300025899 Bacteria 2319
54 Ga0207699_10010486 3300025906 Bacteria 4653
55 Ga0207684_10078883 3300025910 Bacteria 2801
56 Ga0207671_10003876 3300025914 Bacteria 14612
57 Ga0207693_10024940 3300025915 Bacteria 4742
58 Ga0207646_10019829 3300025922 Bacteria 6242
59 Ga0207664_10008784 3300025929 Bacteria 7068
60 Ga0207664_10440348 3300025929 Bacteria 1162
61 Ga0207709_10103401 3300025935 Bacteria 1888
62 Ga0207665_10005046 3300025939 Bacteria 8809
63 Ga0207665_10033826 3300025939 Bacteria 3390
64 Ga0207678_10047625 3300026067 Bacteria 3706
65 Ga0207708_10181238 3300026075 Unclassified 1672
66 Ga0207702_10285486 3300026078 Bacteria 1562
67 Ga0207683_10179278 3300026121 Bacteria 1921
68 Ga0209813_10000010 3300027866 Bacteria 97592
69 Ga0265337_1000261 3300028556 Bacteria 28562
70 Ga0265326_10003334 3300028558 Bacteria 5293
71 Ga0265319_1003442 3300028563 Bacteria 8238
72 Ga0265334_10000014 3300028573 Bacteria 154345
73 Ga0265334_10000068 3300028573 Bacteria 76150
74 Ga0265334_10007705 3300028573 Bacteria 4612
75 Ga0265322_10010922 3300028654 Bacteria 2634
76 Ga0265336_10003312 3300028666 Bacteria 6341
77 Ga0307517_10013226 3300028786 Bacteria 11234
78 Ga0307515_10013676 3300028794 Bacteria 15125
79 Ga0307515_10052449 3300028794 Bacteria 6048
80 Ga0265338_10000144 3300028800 Bacteria 131848
81 Ga0265338_10001512 3300028800 Bacteria 37550
82 Ga0265338_10007886 3300028800 Bacteria 13062
83 Ga0265324_10004100 3300029957 Bacteria 6676
84 Ga0307511_10007996 3300030521 Bacteria 10607
85 Ga0307511_10029375 3300030521 Plasmid 4965
86 Ga0307511_10041132 3300030521 Bacteria 3909
87 Ga0307512_10004927 3300030522 Bacteria 14250
88 Ga0307512_10056072 3300030522 Bacteria 3099
89 Ga0265332_10013536 3300031238 Bacteria 3614
90 Ga0265320_10006476 3300031240 Bacteria 7382
91 Ga0265339_10035871 3300031249 Bacteria 2778
92 Ga0265327_10000121 3300031251 Bacteria 170192
93 Ga0265316_10009248 3300031344 Bacteria 9073
94 Ga0307513_10021672 3300031456 Bacteria 7578
95 Ga0307513_10056096 3300031456 Bacteria 4209
96 Ga0307509_10004735 3300031507 Bacteria 19407
97 Ga0307509_10005654 3300031507 Bacteria 17270
98 Ga0307509_10126921 3300031507 Bacteria 2515
99 Ga0307509_10153912 3300031507 Bacteria 2209
100 Ga0265313_10070761 3300031595 Bacteria 1606
101 Ga0307508_10000103 3300031616 Bacteria 100310
102 Ga0265314_10063717 3300031711 Bacteria 2499
103 Ga0265342_10045091 3300031712 Bacteria 2655
104 Ga0307516_10000023 3300031730 Bacteria 190971
105 Ga0307516_10034522 3300031730 Bacteria 5080
106 Ga0307516_10048694 3300031730 Bacteria 4170
107 Ga0307516_10321687 3300031730 Bacteria 1218
108 Ga0307518_10040199 3300031838 Bacteria 3402
109 Ga0307518_10041655 3300031838 Bacteria 3343
110 Ga0307518_10115170 3300031838 Bacteria 1910
111 Ga0307507_10016087 3300033179 Bacteria 8737
112 Ga0307507_10203310 3300033179 Bacteria 1366
113 Ga0307510_10083274 3300033180 Bacteria 3089
114 Ga0373948_0009389 3300034817 Bacteria 1685
115 Ga0373926_0000462 3300035083 Bacteria 10656
116 Ga0373944_0000209 3300035089 Bacteria 12582
117 Ga0373936_0000618 3300035113 Bacteria 12251
118 Ga0373936_0000711 3300035113 Bacteria 11615
119 Ga0373936_0004994 3300035113 Bacteria 4996
120 Ga0373945_0000317 3300035116 Bacteria 13720
121 Ga0373943_0002461 3300035170 Bacteria 8419
122 Ga0373946_0000302 3300035171 Bacteria 15925
123 Ga0373962_0002873 3300035242 Bacteria 4126
124 Ga0316574_0107649 3300035398 Unclassified 1786
125 Ga0373935_0008779 3300035692 Bacteria 6053
126 Ga0373927_0010131 3300035695 Bacteria 6305
127 Ga0373933_0019022 3300035724 Bacteria 3871
128 Ga0373933_0076336 3300035724 Bacteria 2047
129 Ga0373947_0001227 3300035725 Bacteria 15803
130 Ga0372808_005045 3300036459 Bacteria 1721
131 Ga0373925_0000101 3300037068 Bacteria 92997
132 Ga0373925_0003521 3300037068 Bacteria 12085
133 Ga0436365_0270466 3300039437 Bacteria 14848
134 Ga0436365_0645420 3300039437 Bacteria 2722
135 Ga0451849_1143166 3300041505 Bacteria 2127
136 Ga0439448_0048949 3300042005 Bacteria 1381
137 Ga0439463_009354 3300042016 Bacteria 2412
138 Ga0439444_0023575 3300042437 Bacteria 1106
139 Ga0439440_0000291 3300042993 Bacteria 8180
140 Ga0466963_0026548 3300044694 Bacteria 3705
141 Ga0466964_0047689 3300044706 Bacteria 1749
142 Ga0495592_0001646 3300046454 Bacteria 15655
143 Ga0495603_0065772 3300046455 Bacteria 2136
144 Ga0495603_0109740 3300046455 Bacteria 1610
145 Ga0495629_0016694 3300046459 Bacteria 5268
146 Ga0495629_0038020 3300046459 Bacteria 3391
147 Ga0495629_0104341 3300046459 Bacteria 1977
148 Ga0495629_0154150 3300046459 Bacteria 1597
149 Ga0495629_0251039 3300046459 Bacteria 1217
150 Ga0495638_0000079 3300046460 Bacteria 157488
151 Ga0495638_0000191 3300046460 Bacteria 91364
152 Ga0495638_0006821 3300046460 Bacteria 8244
153 Ga0495638_0021409 3300046460 Bacteria 4262
154 Ga0495638_0092333 3300046460 Bacteria 1822
155 Ga0495641_0022220 3300046461 Bacteria 3177
156 Ga0495651_0006555 3300046462 Bacteria 8890
157 Ga0495651_0030560 3300046462 Bacteria 4200
158 Ga0495651_0089906 3300046462 Bacteria 2304
159 Ga0495651_0141773 3300046462 Bacteria 1742
160 Ga0495653_0009630 3300046463 Bacteria 7900
161 Ga0495653_0012456 3300046463 Bacteria 6944
162 Ga0495582_0092983 3300046473 Bacteria 1683
163 Ga0495639_0020812 3300046475 Bacteria 2868
164 Ga0495639_0027999 3300046475 Bacteria 2496
165 Ga0495662_0000299 3300046476 Bacteria 21544
166 Ga0495662_0002821 3300046476 Bacteria 8789
167 Ga0495662_0031777 3300046476 Bacteria 2550
168 Ga0495664_0002926 3300046477 Bacteria 9216
169 Ga0495664_0026413 3300046477 Bacteria 3381
170 Ga0495594_0042328 3300046499 Bacteria 2494
171 Ga0495594_0051100 3300046499 Bacteria 2274
172 Ga0495594_0069836 3300046499 Bacteria 1951
173 Ga0495607_0013199 3300046501 Bacteria 5424
174 Ga0495583_0000586 3300046506 Bacteria 49924
175 Ga0495583_0025789 3300046506 Bacteria 2930
176 Ga0495606_0017647 3300046507 Bacteria 5385
177 Ga0495608_0025191 3300046511 Bacteria 4060
178 Ga0495608_0040545 3300046511 Bacteria 3119
179 Ga0495616_0016585 3300046513 Bacteria 4074
180 Ga0495618_0008789 3300046514 Bacteria 6099
181 Ga0495618_0044689 3300046514 Bacteria 2794
182 Ga0495620_0009196 3300046515 Bacteria 5267
183 Ga0495620_0022730 3300046515 Bacteria 3013
184 Ga0495628_0044330 3300046516 Bacteria 3539
185 Ga0495628_0100562 3300046516 Bacteria 2232
186 Ga0495630_0006345 3300046517 Bacteria 8403
187 Ga0495630_0032649 3300046517 Bacteria 3880
188 Ga0495630_0112708 3300046517 Bacteria 2060
189 Ga0495630_0206433 3300046517 Bacteria 1499
190 Ga0495632_0004334 3300046519 Bacteria 9674
191 Ga0495643_0005022 3300046522 Bacteria 9063
192 Ga0495648_0000124 3300046524 Bacteria 91364
193 Ga0495666_0000305 3300046526 Bacteria 21370
194 Ga0495665_0005081 3300046531 Bacteria 7095
195 Ga0495640_0029597 3300046533 Bacteria 3930
196 Ga0495640_0084837 3300046533 Bacteria 2100
197 Ga0495587_0002727 3300046536 Bacteria 11784
198 Ga0495609_0050031 3300046538 Bacteria 1864
199 Ga0495645_0045937 3300046543 Bacteria 3185
200 Ga0495645_0110193 3300046543 Bacteria 1948
201 Ga0495633_0008915 3300046558 Bacteria 5592
202 Ga0495667_0003631 3300046559 Bacteria 10376
203 Ga0495667_0194832 3300046559 Bacteria 1298
204 Ga0495668_0073460 3300046616 Bacteria 1878
205 Ga0495634_0002985 3300046642 Bacteria 13793
206 Ga0495634_0074920 3300046642 Bacteria 2223
207 Ga0495611_0052943 3300046648 Bacteria 1831
208 Ga0495625_0000011 3300046660 Bacteria 377120
209 Ga0495635_0000692 3300046663 Bacteria 21712
210 Ga0495635_0001772 3300046663 Bacteria 14576
211 Ga0495635_0004427 3300046663 Bacteria 9731
212 Ga0495635_0083364 3300046663 Bacteria 2187
213 Ga0495588_0012972 3300046674 Bacteria 3957
214 Ga0495657_0000085 3300046675 Bacteria 82569
215 Ga0495657_0035688 3300046675 Bacteria 3443
216 Ga0495657_0071341 3300046675 Bacteria 2267
217 Ga0495657_0114502 3300046675 Bacteria 1704
218 Ga0495646_0010345 3300046680 Bacteria 5933
219 Ga0495647_0092503 3300046681 Bacteria 1242
220 Ga0495658_0064462 3300046683 Bacteria 2111
221 Ga0495613_0000365 3300046689 Bacteria 39454
222 Ga0495613_0000645 3300046689 Bacteria 27674
223 Ga0495613_0017383 3300046689 Bacteria 5358
224 Ga0495624_0034822 3300046690 Bacteria 3254
225 Ga0495624_0101163 3300046690 Bacteria 1774
226 Ga0495670_0006269 3300046691 Bacteria 5836
227 Ga0495671_0000082 3300046692 Bacteria 91540
228 Ga0495589_0013285 3300046794 Bacteria 4250
229 Ga0495600_0118637 3300046809 Bacteria 1721
230 Ga0495660_0065760 3300046810 Bacteria 1934
231 Ga0495581_0000467 3300047315 Bacteria 20658
232 Ga0495581_0009881 3300047315 Bacteria 5520
233 Ga0495604_0002377 3300047317 Bacteria 15090
234 Ga0495674_0002764 3300047319 Bacteria 17024
235 Ga0495676_0000632 3300047321 Bacteria 29176
236 Ga0495676_0006802 3300047321 Bacteria 10511
237 Ga0495676_0015207 3300047321 Bacteria 6861
238 Ga0495676_0056014 3300047321 Bacteria 3120
239 Ga0495680_0007179 3300047322 Bacteria 10260
240 Ga0495680_0007475 3300047322 Bacteria 10008
241 Ga0495687_001483 3300047443 Bacteria 21445
242 Ga0495687_047952 3300047443 Bacteria 1835
243 Ga0495685_015065 3300047447 Bacteria 2633
244 Ga0495685_016895 3300047447 Bacteria 2494
245 Ga0495673_0000412 3300047469 Bacteria 49945
246 Ga0495681_0073018 3300047470 Bacteria 1550
247 Ga0495684_0007612 3300047471 Bacteria 8379
248 Ga0495684_0051914 3300047471 Bacteria 3128
249 Ga0495686_0048681 3300047472 Bacteria 2671
250 Ga0495593_0000589 3300047673 Bacteria 20695
251 Ga0495593_0023108 3300047673 Bacteria 3459
252 Ga0495593_0057496 3300047673 Bacteria 2042
253 Ga0495602_0078900 3300048088 Bacteria 2779
254 Ga0495602_0082192 3300048088 Bacteria 2704
255 Ga0495614_0001203 3300048089 Bacteria 11126
256 Ga0495614_0035062 3300048089 Bacteria 2156
257 Ga0495614_0076995 3300048089 Bacteria 1442
258 Ga0496104_0206379 3300048907 Bacteria 1877
259 Ga0496112_0155852 3300048915 Bacteria 2251
260 Ga0495678_044163 3300049459 Bacteria 1765
261 Ga0501031_0009049 3300049568 Bacteria 6480
262 Ga0501033_0009543 3300049570 Bacteria 7468
263 Ga0501036_0012001 3300049572 Bacteria 7182
264 Ga0501039_0019619 3300049575 Bacteria 5184
265 Ga0501039_0196051 3300049575 Bacteria 1588
266 Ga0501040_0002395 3300049576 Bacteria 12061
267 Ga0501042_0049131 3300049578 Bacteria 3009
268 Ga0501043_0029115 3300049579 Bacteria 4338
269 Ga0501046_0105473 3300049580 Bacteria 2158
270 Ga0501047_0009622 3300049581 Bacteria 9139
271 Ga0501047_0031488 3300049581 Bacteria 5115
272 Ga0501047_0053175 3300049581 Bacteria 3915
273 Ga0501047_0182295 3300049581 Unclassified 1966
274 Ga0501048_0017121 3300049582 Bacteria 5342
275 Ga0501067_0021456 3300049583 Bacteria 3574
276 Ga0501070_0315088 3300049586 Unclassified 1273
277 Ga0501071_0014789 3300049587 Bacteria 5344
278 Ga0501072_0015399 3300049588 Bacteria 5862
279 Ga0501072_0016240 3300049588 Bacteria 5711
280 Ga0501073_0217053 3300049589 Bacteria 1322
281 Ga0501074_0024619 3300049590 Bacteria 4374
282 Ga0501076_0063080 3300049592 Bacteria 2952
283 Ga0501076_0081588 3300049592 Bacteria 2596
284 Ga0501077_0026778 3300049593 Bacteria 3660
285 Ga0501079_0019344 3300049741 Bacteria 5200
286 Ga0501080_0036544 3300049742 Bacteria 4585
287 Ga0501080_0077186 3300049742 Bacteria 3098
288 Ga0501080_0174994 3300049742 Bacteria 1978
289 Ga0501081_0068856 3300049743 Bacteria 2464
290 Ga0501083_0033466 3300049744 Bacteria 3519
291 Ga0501035_0049579 3300049822 Bacteria 3762
292 Ga0501035_0124209 3300049822 Bacteria 2254
293 Ga0501035_0150181 3300049822 Bacteria 2022
294 Ga0501044_0045906 3300049823 Bacteria 4525
295 nmdc:mga0yw44_45303_c1 3300050492 Bacteria 2636
296 nmdc:mga06z11_20311_c1 3300050494 Bacteria 3069
297 nmdc:mga06z11_68_c1 3300050494 Bacteria 42759
298 nmdc:mga06z11_79125_c1 3300050494 Bacteria 1759
299 nmdc:mga04h51_36_c1 3300050495 Bacteria 45993
300 nmdc:mga04h51_55318_c1 3300050495 Bacteria 1344
301 nmdc:mga07m45_13445_c1 3300050496 Bacteria 4344
302 nmdc:mga07m45_95355_c1 3300050496 Unclassified 1706
303 nmdc:mga05p37_232090_c1 3300050507 Bacteria 2223
304 nmdc:mga05p37_29862_c1 3300050507 Bacteria 6652
305 nmdc:mga05p37_505193_c1 3300050507 Bacteria 1386
306 nmdc:mga05p37_90338_c1 3300050507 Bacteria 3775
307 nmdc:mga09592_124517_c1 3300050508 Bacteria 2215
308 nmdc:mga09592_257045_c1 3300050508 Bacteria 1514
309 nmdc:mga09592_320118_c1 3300050508 Bacteria 1344
310 nmdc:mga0qj67_283_c1 3300050509 Bacteria 35322
311 nmdc:mga0qj67_32950_c1 3300050509 Bacteria 4042
312 nmdc:mga0qj67_44611_c1 3300050509 Bacteria 3495
313 nmdc:mga06r32_12552_c1 3300050510 Bacteria 7649
314 nmdc:mga06r32_181764_c1 3300050510 Bacteria 2089
315 nmdc:mga06r32_576509_c1 3300050510 Bacteria 1098
316 nmdc:mga06r32_855_c1 3300050510 Bacteria 27030
317 nmdc:mga06r32_90849_c1 3300050510 Bacteria 2984
318 nmdc:mga08y16_5095_c1 3300050511 Bacteria 13734
319 Ga0495619_0017582 3300053085 Bacteria 4529
320 Ga0495619_0063127 3300053085 Bacteria 2467
321 Ga0500578_0025859 3300053086 Bacteria 3765
322 Ga0500583_0032686 3300053092 Bacteria 2297
323 Ga0500583_0131006 3300053092 Bacteria 1244
324 Ga0500566_0005501 3300053094 Bacteria 7537
325 Ga0500640_000534 3300053095 Bacteria 9621
326 Ga0500560_001944 3300053107 Bacteria 3793
327 Ga0500572_073754 3300053111 Bacteria 1059
328 Ga0500595_014143 3300053119 Unclassified 3035
329 Ga0500652_004597 3300053131 Bacteria 4283
330 Ga0500652_119089 3300053131 Bacteria 1103
331 Ga0500658_0034769 3300053134 Bacteria 1991
332 Ga0500559_0009834 3300053136 Bacteria 4122
333 Ga0500559_0017908 3300053136 Bacteria 2994
334 Ga0500573_0003012 3300053140 Bacteria 8617
335 Ga0500573_0051745 3300053140 Bacteria 2362
336 Ga0500579_109599 3300053143 Bacteria 1396
337 Ga0500624_000127 3300053157 Bacteria 33962
338 Ga0500633_0030289 3300053160 Bacteria 1738
339 Ga0500634_0075748 3300053161 Bacteria 1748
340 Ga0501084_0042752 3300054114 Bacteria 3791
341 Ga0501084_0260134 3300054114 Bacteria 1465
342 Ga0501082_0019844 3300060353 Bacteria 5796
343 Ga0501082_0254936 3300060353 Unclassified 1526
344 Ga0530510_0020395 3300061734 Bacteria 4712
345 2508676573 2508501039 Bacteria 9978592
346 2512641774 2512564014 Bacteria 4639632
347 2585313767 2582581314 Bacteria 11452267
348 2616697741 2616644814 Bacteria 11555299
349 2671836178 2671180195 Bacteria 9757215
350 2676200519 2675902999 Bacteria 9438463
351 2686534244 2684623035 Bacteria 8032739
352 2686539998 2684623035 Bacteria 8032739
353 2689956991 2687453737 Bacteria 11203906
354 2689963584 2687453737 Bacteria 11203906
355 2689993976 2687453743 Bacteria 8361025
356 2689994272 2687453743 Bacteria 8361025
357 2738890823 2738541308 Bacteria 7020677
358 2744955434 2744054611 Bacteria 5611514
359 2774845097 2773857921 Bacteria 9435764
360 2774854334 2773857922 Bacteria 9757215
361 2895888816 2895880812 Bacteria 11255272
362 2919710257 2919709256 Bacteria 4318106
363 3003006634 3002998708 Bacteria 11715108
364 8002775655 8002775197 Bacteria 10728764
365 Ga0070714_100020146
366 JGI25165J46597_1000156
367 rootH2_10138886
368 Ga0068869_100129154
369 Ga0070714_100250988
370 Ga0070713_100042165
371 Ga0070713_100137112
372 Ga0070701_10171407
373 Ga0070711_100263973
374 Ga0070706_100205271
375 Ga0070706_100267373
376 Ga0070707_100112689
377 Ga0070698_100001547
378 Ga0070697_100157178
379 Ga0081455_10003382
380 Ga0081455_10005865
381 Ga0081455_10036134
382 Ga0081538_10000383
383 Ga0075368_10003920
384 Ga0075363_100017866
385 Ga0075364_10013667
386 Ga0070715_10060742
387 Ga0070712_100193170
388 Ga0075367_10000169
389 Ga0075367_10031076
390 Ga0075370_10058148
391 Ga0075370_10100259
392 Ga0075428_100035925
393 Ga0075428_100320494
394 Ga0075428_100367241
395 Ga0075430_100006467
396 Ga0075430_100036663
397 Ga0075430_100070476
398 Ga0075430_100150183
399 Ga0075430_100298104
400 Ga0075431_100005669
401 Ga0075431_100061270
402 Ga0075433_10308308
403 Ga0075429_100001060
404 Ga0075429_100253078
405 Ga0079104_1008834
406 Ga0111539_10004723
407 Ga0111539_10074640
408 Ga0114129_10185561
409 Ga0114129_10323052
410 Ga0114129_10520555
411 Ga0105243_10126769
412 Ga0105237_10001939
413 Ga0105239_10041383
414 Ga0213876_10001480
415 Ga0209437_103004
416 Ga0209233_1000213
417 Ga0207642_10027832
418 Ga0207699_10010486
419 Ga0207684_10078883
420 Ga0207671_10003876
421 Ga0207693_10024940
422 Ga0207646_10019829
423 Ga0207664_10008784
424 Ga0207664_10440348
425 Ga0207709_10103401
426 Ga0207665_10005046
427 Ga0207665_10033826
428 Ga0207678_10047625
429 Ga0207708_10181238
430 Ga0207702_10285486
431 Ga0207683_10179278
432 Ga0209813_10000010
433 Ga0265337_1000261
434 Ga0265326_10003334
435 Ga0265319_1003442
436 Ga0265334_10000014
437 Ga0265334_10000068
438 Ga0265334_10007705
439 Ga0265322_10010922
440 Ga0265336_10003312
441 Ga0307517_10013226
442 Ga0307515_10013676
443 Ga0307515_10052449
444 Ga0265338_10000144
445 Ga0265338_10001512
446 Ga0265338_10007886
447 Ga0265324_10004100
448 Ga0307511_10007996
449 Ga0307511_10029375
450 Ga0307511_10041132
451 Ga0307512_10004927
452 Ga0307512_10056072
453 Ga0265332_10013536
454 Ga0265320_10006476
455 Ga0265339_10035871
456 Ga0265327_10000121
457 Ga0265316_10009248
458 Ga0307513_10021672
459 Ga0307513_10056096
460 Ga0307509_10004735
461 Ga0307509_10005654
462 Ga0307509_10126921
463 Ga0307509_10153912
464 Ga0265313_10070761
465 Ga0307508_10000103
466 Ga0265314_10063717
467 Ga0265342_10045091
468 Ga0307516_10000023
469 Ga0307516_10034522
470 Ga0307516_10048694
471 Ga0307516_10321687
472 Ga0307518_10040199
473 Ga0307518_10041655
474 Ga0307518_10115170
475 Ga0307507_10016087
476 Ga0307507_10203310
477 Ga0307510_10083274
478 Ga0373948_0009389
479 Ga0373926_0000462
480 Ga0373944_0000209
481 Ga0373936_0000618
482 Ga0373936_0000711
483 Ga0373936_0004994
484 Ga0373945_0000317
485 Ga0373943_0002461
486 Ga0373946_0000302
487 Ga0373962_0002873
488 Ga0316574_0107649
489 Ga0373935_0008779
490 Ga0373927_0010131
491 Ga0373933_0019022
492 Ga0373933_0076336
493 Ga0373947_0001227
494 Ga0372808_005045
495 Ga0373925_0000101
496 Ga0373925_0003521
497 Ga0436365_0270466
498 Ga0436365_0645420
499 Ga0451849_1143166
500 Ga0439448_0048949
501 Ga0439463_009354
502 Ga0439444_0023575
503 Ga0439440_0000291
504 Ga0466963_0026548
505 Ga0466964_0047689
506 Ga0495592_0001646
507 Ga0495603_0065772
508 Ga0495603_0109740
509 Ga0495629_0016694
510 Ga0495629_0038020
511 Ga0495629_0104341
512 Ga0495629_0154150
513 Ga0495629_0251039
514 Ga0495638_0000079
515 Ga0495638_0000191
516 Ga0495638_0006821
517 Ga0495638_0021409
518 Ga0495638_0092333
519 Ga0495641_0022220
520 Ga0495651_0006555
521 Ga0495651_0030560
522 Ga0495651_0089906
523 Ga0495651_0141773
524 Ga0495653_0009630
525 Ga0495653_0012456
526 Ga0495582_0092983
527 Ga0495639_0020812
528 Ga0495639_0027999
529 Ga0495662_0000299
530 Ga0495662_0002821
531 Ga0495662_0031777
532 Ga0495664_0002926
533 Ga0495664_0026413
534 Ga0495594_0042328
535 Ga0495594_0051100
536 Ga0495594_0069836
537 Ga0495607_0013199
538 Ga0495583_0000586
539 Ga0495583_0025789
540 Ga0495606_0017647
541 Ga0495608_0025191
542 Ga0495608_0040545
543 Ga0495616_0016585
544 Ga0495618_0008789
545 Ga0495618_0044689
546 Ga0495620_0009196
547 Ga0495620_0022730
548 Ga0495628_0044330
549 Ga0495628_0100562
550 Ga0495630_0006345
551 Ga0495630_0032649
552 Ga0495630_0112708
553 Ga0495630_0206433
554 Ga0495632_0004334
555 Ga0495643_0005022
556 Ga0495648_0000124
557 Ga0495666_0000305
558 Ga0495665_0005081
559 Ga0495640_0029597
560 Ga0495640_0084837
561 Ga0495587_0002727
562 Ga0495609_0050031
563 Ga0495645_0045937
564 Ga0495645_0110193
565 Ga0495633_0008915
566 Ga0495667_0003631
567 Ga0495667_0194832
568 Ga0495668_0073460
569 Ga0495634_0002985
570 Ga0495634_0074920
571 Ga0495611_0052943
572 Ga0495625_0000011
573 Ga0495635_0000692
574 Ga0495635_0001772
575 Ga0495635_0004427
576 Ga0495635_0083364
577 Ga0495588_0012972
578 Ga0495657_0000085
579 Ga0495657_0035688
580 Ga0495657_0071341
581 Ga0495657_0114502
582 Ga0495646_0010345
583 Ga0495647_0092503
584 Ga0495658_0064462
585 Ga0495613_0000365
586 Ga0495613_0000645
587 Ga0495613_0017383
588 Ga0495624_0034822
589 Ga0495624_0101163
590 Ga0495670_0006269
591 Ga0495671_0000082
592 Ga0495589_0013285
593 Ga0495600_0118637
594 Ga0495660_0065760
595 Ga0495581_0000467
596 Ga0495581_0009881
597 Ga0495604_0002377
598 Ga0495674_0002764
599 Ga0495676_0000632
600 Ga0495676_0006802
601 Ga0495676_0015207
602 Ga0495676_0056014
603 Ga0495680_0007179
604 Ga0495680_0007475
605 Ga0495687_001483
606 Ga0495687_047952
607 Ga0495685_015065
608 Ga0495685_016895
609 Ga0495673_0000412
610 Ga0495681_0073018
611 Ga0495684_0007612
612 Ga0495684_0051914
613 Ga0495686_0048681
614 Ga0495593_0000589
615 Ga0495593_0023108
616 Ga0495593_0057496
617 Ga0495602_0078900
618 Ga0495602_0082192
619 Ga0495614_0001203
620 Ga0495614_0035062
621 Ga0495614_0076995
622 Ga0496104_0206379
623 Ga0496112_0155852
624 Ga0495678_044163
625 Ga0501031_0009049
626 Ga0501033_0009543
627 Ga0501036_0012001
628 Ga0501039_0019619
629 Ga0501039_0196051
630 Ga0501040_0002395
631 Ga0501042_0049131
632 Ga0501043_0029115
633 Ga0501046_0105473
634 Ga0501047_0009622
635 Ga0501047_0031488
636 Ga0501047_0053175
637 Ga0501047_0182295
638 Ga0501048_0017121
639 Ga0501067_0021456
640 Ga0501070_0315088
641 Ga0501071_0014789
642 Ga0501072_0015399
643 Ga0501072_0016240
644 Ga0501073_0217053
645 Ga0501074_0024619
646 Ga0501076_0063080
647 Ga0501076_0081588
648 Ga0501077_0026778
649 Ga0501079_0019344
650 Ga0501080_0036544
651 Ga0501080_0077186
652 Ga0501080_0174994
653 Ga0501081_0068856
654 Ga0501083_0033466
655 Ga0501035_0049579
656 Ga0501035_0124209
657 Ga0501035_0150181
658 Ga0501044_0045906
659 nmdc:mga0yw44_45303_c1
660 nmdc:mga06z11_20311_c1
661 nmdc:mga06z11_68_c1
662 nmdc:mga06z11_79125_c1
663 nmdc:mga04h51_36_c1
664 nmdc:mga04h51_55318_c1
665 nmdc:mga07m45_13445_c1
666 nmdc:mga07m45_95355_c1
667 nmdc:mga05p37_232090_c1
668 nmdc:mga05p37_29862_c1
669 nmdc:mga05p37_505193_c1
670 nmdc:mga05p37_90338_c1
671 nmdc:mga09592_124517_c1
672 nmdc:mga09592_257045_c1
673 nmdc:mga09592_320118_c1
674 nmdc:mga0qj67_283_c1
675 nmdc:mga0qj67_32950_c1
676 nmdc:mga0qj67_44611_c1
677 nmdc:mga06r32_12552_c1
678 nmdc:mga06r32_181764_c1
679 nmdc:mga06r32_576509_c1
680 nmdc:mga06r32_855_c1
681 nmdc:mga06r32_90849_c1
682 nmdc:mga08y16_5095_c1
683 Ga0495619_0017582
684 Ga0495619_0063127
685 Ga0500578_0025859
686 Ga0500583_0032686
687 Ga0500583_0131006
688 Ga0500566_0005501
689 Ga0500640_000534
690 Ga0500560_001944
691 Ga0500572_073754
692 Ga0500595_014143
693 Ga0500652_004597
694 Ga0500652_119089
695 Ga0500658_0034769
696 Ga0500559_0009834
697 Ga0500559_0017908
698 Ga0500573_0003012
699 Ga0500573_0051745
700 Ga0500579_109599
701 Ga0500624_000127
702 Ga0500633_0030289
703 Ga0500634_0075748
704 Ga0501084_0042752
705 Ga0501084_0260134
706 Ga0501082_0019844
707 Ga0501082_0254936
708 Ga0530510_0020395
709 2508676573
710 2512641774
711 2585313767
712 2616697741
713 2671836178
714 2676200519
715 2686534244
716 2686539998
717 2689956991
718 2689963584
719 2689993976
720 2689994272
721 2738890823
722 2744955434
723 2774845097
724 2774854334
725 2895888816
726 2919710257
727 3003006634
728 8002775655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19328

DAP_DH_C

2,4-diaminopentanoate dehydrogenase C-terminal domain

136

343

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g1h-assembly1.cif.gz_A-2 amine dehydrogenase from petrotoga mobilis; open form 0.8535 3 344
6g1m-assembly2.cif.gz_D amine dehydrogenase from petrotoga mobilis; open and closed form 0.8441 5 344
6g1m-assembly2.cif.gz_D amine dehydrogenase from petrotoga mobilis; open and closed form 0.8374 5 344
6g1h-assembly1.cif.gz_A-2 amine dehydrogenase from petrotoga mobilis; open form 0.8327 3 344
7xdu-assembly1.cif.gz_A ttheramdh-nad+ 0.8231 3 342
ID Description Score Start End Superfamily
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9528 4 99 3.40.50.720
af_O53407_4_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9254 5 150 3.40.50.720
af_O53407_4_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8727 5 150 3.40.50.720
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8667 4 99 3.40.50.720
3uuwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7883 5 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534SHQ8-F1-model_v4 Dihydrodipicolinate reductase 0.9981 4 65
AF-V7KJH6-F1-model_v4 deleted 0.992 3 76
AF-A0A2S9FB84-F1-model_v4 Dihydrodipicolinate reductase 0.9852 6 62
AF-A0A2S8MLS4-F1-model_v4 deleted 0.9785 4 68
AF-A0A6B3I505-F1-model_v4 Dihydrodipicolinate reductase 0.978 5 62 GO:0008839
GO:0009089

Map