F423094

General Info

Members Datasets Scaffolds Average Seq Length
363 226 363 50

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0397648|Ga0496105_0397648_527_721
Length 57
Sequence MSRWRCPGCGYVYDEEQGHPREGFPPGTPWSEVPDDVRDKVDFEPDDRGRVTFDRRR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 13.22
Rhizosphere 83.2
Stem 0
Stem Tuber 0
Unclassified 3.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000709 3300001979 Bacteria 14444
2 JGI24751J29686_10136385 3300002459 Bacteria 519
3 rootL2_10091476 3300003322 Unclassified 1284
4 Ga0070658_10395381 3300005327 Bacteria 1187
5 Ga0070658_11182932 3300005327 Bacteria 665
6 Ga0070683_100000619 3300005329 Bacteria 25554
7 Ga0070683_100010491 3300005329 Bacteria 7968
8 Ga0070683_100145564 3300005329 Bacteria 2245
9 Ga0070683_100398420 3300005329 Bacteria 1312
10 Ga0070670_101222754 3300005331 Bacteria 687
11 Ga0070682_100000013 3300005337 Bacteria 254641
12 Ga0070682_101320482 3300005337 Bacteria 614
13 Ga0068868_100000082 3300005338 Bacteria 57070
14 Ga0070689_100069950 3300005340 Bacteria 2739
15 Ga0070691_10003693 3300005341 Bacteria 6912
16 Ga0070668_100125001 3300005347 Bacteria 2060
17 Ga0070669_100006808 3300005353 Bacteria 8223
18 Ga0070669_101114753 3300005353 Bacteria 680
19 Ga0070675_100000111 3300005354 Bacteria 47699
20 Ga0070675_100771729 3300005354 Bacteria 878
21 Ga0070674_100000008 3300005356 Bacteria 143844
22 Ga0070674_100000064 3300005356 Bacteria 47689
23 Ga0070688_100000068 3300005365 Bacteria 50778
24 Ga0070659_100003667 3300005366 Bacteria 10949
25 Ga0070703_10375902 3300005406 Bacteria 613
26 Ga0070714_100262796 3300005435 Bacteria 1599
27 Ga0070714_100386872 3300005435 Bacteria 1320
28 Ga0070711_100017558 3300005439 Bacteria 4558
29 Ga0070705_100494235 3300005440 Bacteria 927
30 Ga0070663_100103220 3300005455 Bacteria 2131
31 Ga0070663_100243149 3300005455 Bacteria 1421
32 Ga0070678_100013405 3300005456 Bacteria 5139
33 Ga0070678_100062255 3300005456 Bacteria 2755
34 Ga0070662_100000004 3300005457 Bacteria 195534
35 Ga0070685_10000364 3300005466 Bacteria 27523
36 Ga0070684_100001272 3300005535 Bacteria 18055
37 Ga0070684_100001455 3300005535 Bacteria 17079
38 Ga0070684_100027529 3300005535 Bacteria 4799
39 Ga0070684_100308797 3300005535 Bacteria 1452
40 Ga0070684_100433346 3300005535 Bacteria 1214
41 Ga0070684_100456269 3300005535 Bacteria 1182
42 Ga0070684_100642360 3300005535 Bacteria 988
43 Ga0070684_102255310 3300005535 Bacteria 513
44 Ga0068853_100031357 3300005539 Bacteria 4496
45 Ga0070696_100278668 3300005546 Bacteria 1274
46 Ga0070696_101005892 3300005546 Bacteria 697
47 Ga0070696_102017716 3300005546 Bacteria 501
48 Ga0070693_100356339 3300005547 Bacteria 1003
49 Ga0070665_100000106 3300005548 Bacteria 157315
50 Ga0070665_100001339 3300005548 Bacteria 29297
51 Ga0070704_101271073 3300005549 Bacteria 673
52 Ga0068855_100610917 3300005563 Bacteria 1175
53 Ga0070664_100019512 3300005564 Bacteria 5578
54 Ga0068856_100009507 3300005614 Bacteria 9442
55 Ga0068856_100309207 3300005614 Bacteria 1598
56 Ga0068852_101379395 3300005616 Bacteria 727
57 Ga0068852_101398646 3300005616 Bacteria 722
58 Ga0068864_100000045 3300005618 Bacteria 154739
59 Ga0068866_10000001 3300005718 Bacteria 519680
60 Ga0068866_10000237 3300005718 Bacteria 25933
61 Ga0068861_100361398 3300005719 Bacteria 1277
62 Ga0068851_10753471 3300005834 Bacteria 602
63 Ga0068870_10139291 3300005840 Bacteria 1418
64 Ga0068863_100004198 3300005841 Bacteria 14226
65 Ga0068858_100000216 3300005842 Bacteria 62188
66 Ga0068860_100009131 3300005843 Bacteria 9862
67 Ga0081455_10005387 3300005937 Bacteria 14047
68 Ga0081540_1041345 3300005983 Bacteria 2391
69 Ga0081540_1209823 3300005983 Bacteria 701
70 Ga0070715_10000001 3300006163 Bacteria 693690
71 Ga0070712_100004201 3300006175 Bacteria 8862
72 Ga0068871_100827431 3300006358 Bacteria 855
73 Ga0075436_101165501 3300006914 Bacteria 581
74 Ga0105244_10406805 3300009036 Bacteria 626
75 Ga0105240_11580879 3300009093 Bacteria 686
76 Ga0111539_12771030 3300009094 Bacteria 568
77 Ga0111539_12835874 3300009094 Bacteria 561
78 Ga0105245_10000016 3300009098 Bacteria 204372
79 Ga0105245_10000454 3300009098 Bacteria 37583
80 Ga0105247_10058212 3300009101 Bacteria 2390
81 Ga0105243_10042273 3300009148 Bacteria 3568
82 Ga0105243_10254918 3300009148 Bacteria 1568
83 Ga0105243_11901678 3300009148 Bacteria 628
84 Ga0105241_10395940 3300009174 Bacteria 1210
85 Ga0105242_10000398 3300009176 Bacteria 34481
86 Ga0105242_10000430 3300009176 Bacteria 33469
87 Ga0105249_10000616 3300009553 Bacteria 32470
88 Ga0105239_12546070 3300010375 Bacteria 596
89 Ga0105239_12728279 3300010375 Bacteria 576
90 Ga0105246_10276406 3300011119 Bacteria 1345
91 Ga0105246_11270434 3300011119 Bacteria 681
92 Ga0157342_1015036 3300012507 Bacteria 844
93 Ga0157370_10120674 3300013104 Bacteria 2447
94 Ga0157374_10003475 3300013296 Bacteria 13240
95 Ga0157374_10363742 3300013296 Bacteria 1439
96 Ga0157378_10009271 3300013297 Bacteria 8574
97 Ga0157378_10106341 3300013297 Bacteria 2567
98 Ga0157375_10073133 3300013308 Bacteria 3447
99 Ga0157375_10108808 3300013308 Bacteria 2867
100 Ga0157380_10000281 3300014326 Bacteria 30636
101 Ga0157379_10087728 3300014968 Bacteria 2789
102 Ga0157379_10140055 3300014968 Bacteria 2181
103 Ga0157376_10022813 3300014969 Bacteria 4887
104 Ga0157376_10054985 3300014969 Bacteria 3320
105 Ga0157376_13051552 3300014969 Bacteria 507
106 Ga0163161_10000035 3300017792 Bacteria 155979
107 Ga0206349_1955911 3300020075 Bacteria 873
108 Ga0206354_10977116 3300020081 Bacteria 704
109 Ga0206354_11518587 3300020081 Bacteria 1076
110 Ga0207653_10042382 3300025885 Bacteria 1497
111 Ga0207642_10000002 3300025899 Bacteria 658166
112 Ga0207710_10029428 3300025900 Bacteria 2390
113 Ga0207685_10000082 3300025905 Bacteria 18011
114 Ga0207705_10237015 3300025909 Bacteria 1389
115 Ga0207705_11460832 3300025909 Bacteria 518
116 Ga0207654_10277549 3300025911 Bacteria 1132
117 Ga0207693_10006565 3300025915 Bacteria 9624
118 Ga0207693_10655495 3300025915 Bacteria 815
119 Ga0207662_10455169 3300025918 Bacteria 876
120 Ga0207649_10716693 3300025920 Bacteria 777
121 Ga0207681_10006568 3300025923 Bacteria 7140
122 Ga0207681_10328674 3300025923 Bacteria 1218
123 Ga0207659_10000010 3300025926 Bacteria 286639
124 Ga0207687_10000018 3300025927 Bacteria 236159
125 Ga0207687_10001114 3300025927 Bacteria 18263
126 Ga0207664_10199611 3300025929 Bacteria 1726
127 Ga0207664_10403526 3300025929 Bacteria 1216
128 Ga0207690_10003714 3300025932 Bacteria 9077
129 Ga0207706_10000012 3300025933 Bacteria 195475
130 Ga0207686_10000033 3300025934 Bacteria 143602
131 Ga0207686_10000322 3300025934 Bacteria 34436
132 Ga0207686_10119110 3300025934 Bacteria 1794
133 Ga0207709_10050733 3300025935 Bacteria 2539
134 Ga0207709_10160526 3300025935 Bacteria 1567
135 Ga0207670_10053406 3300025936 Bacteria 2722
136 Ga0207669_10000004 3300025937 Bacteria 196828
137 Ga0207669_10000018 3300025937 Bacteria 114254
138 Ga0207661_10000262 3300025944 Bacteria 33960
139 Ga0207661_10001202 3300025944 Bacteria 17324
140 Ga0207661_10005636 3300025944 Bacteria 8835
141 Ga0207661_10068346 3300025944 Bacteria 2893
142 Ga0207661_10074372 3300025944 Bacteria 2785
143 Ga0207679_10012868 3300025945 Bacteria 5472
144 Ga0207667_10646703 3300025949 Bacteria 1063
145 Ga0207667_11963721 3300025949 Bacteria 546
146 Ga0207712_10000007 3300025961 Bacteria 539589
147 Ga0207668_10063553 3300025972 Bacteria 2605
148 Ga0207640_11971116 3300025981 Bacteria 529
149 Ga0207658_10480497 3300025986 Bacteria 1104
150 Ga0207677_10000519 3300026023 Bacteria 24757
151 Ga0207703_10000023 3300026035 Bacteria 222018
152 Ga0207639_10001493 3300026041 Bacteria 15745
153 Ga0207678_10450677 3300026067 Bacteria 1118
154 Ga0207678_11336132 3300026067 Bacteria 634
155 Ga0207702_10050174 3300026078 Bacteria 3523
156 Ga0207702_10402683 3300026078 Bacteria 1320
157 Ga0207702_11286416 3300026078 Bacteria 725
158 Ga0207641_10000151 3300026088 Bacteria 99225
159 Ga0207641_10003840 3300026088 Bacteria 13160
160 Ga0207676_10000016 3300026095 Bacteria 311561
161 Ga0207675_100221232 3300026118 Bacteria 1824
162 Ga0207675_100789810 3300026118 Bacteria 962
163 Ga0207675_101701894 3300026118 Bacteria 651
164 Ga0207683_10061455 3300026121 Bacteria 3306
165 Ga0207683_10126026 3300026121 Bacteria 2301
166 Ga0207698_11324451 3300026142 Bacteria 735
167 Ga0268266_10000047 3300028379 Bacteria 310996
168 Ga0268266_10011189 3300028379 Bacteria 7808
169 Ga0268266_10990469 3300028379 Bacteria 813
170 Ga0268264_10006050 3300028381 Bacteria 10226
171 Ga0265319_1000122 3300028563 Bacteria 58869
172 Ga0265322_10162773 3300028654 Bacteria 638
173 Ga0265336_10073092 3300028666 Bacteria 1025
174 Ga0265338_10000706 3300028800 Bacteria 56988
175 Ga0265325_10069390 3300031241 Bacteria 1772
176 Ga0265331_10069932 3300031250 Bacteria 1643
177 Ga0265316_10426232 3300031344 Bacteria 953
178 Ga0265342_10095355 3300031712 Bacteria 1701
179 Ga0373954_0234627 3300035118 Bacteria 903
180 Ga0373957_0135554 3300035120 Bacteria 1004
181 Ga0373955_0327242 3300035172 Bacteria 926
182 Ga0373947_0797049 3300035725 Bacteria 645
183 Ga0373937_0261987 3300036401 Bacteria 1630
184 Ga0451800_1087336 3300041459 Bacteria 1073
185 Ga0451802_1034845 3300041460 Bacteria 704
186 Ga0451807_1676608 3300041486 Bacteria 520
187 Ga0451853_0061737 3300041512 Bacteria 1376
188 Ga0466969_0513821 3300044656 Bacteria 547
189 Ga0466965_0900267 3300044683 Bacteria 516
190 Ga0466963_0000001 3300044694 Bacteria 110556
191 Ga0466957_0492347 3300044842 Bacteria 849
192 Ga0466958_0036369 3300045836 Bacteria 2947
193 Ga0466967_1798478 3300045976 Bacteria 610
194 Ga0495592_0000657 3300046454 Bacteria 24027
195 Ga0495603_0000016 3300046455 Bacteria 67399
196 Ga0495603_0000333 3300046455 Bacteria 25490
197 Ga0495603_0007614 3300046455 Bacteria 6518
198 Ga0495629_0000272 3300046459 Bacteria 44883
199 Ga0495629_0348504 3300046459 Bacteria 1010
200 Ga0495629_0483456 3300046459 Bacteria 836
201 Ga0495638_0015640 3300046460 Bacteria 5092
202 Ga0495641_0000044 3300046461 Bacteria 77415
203 Ga0495641_0047762 3300046461 Bacteria 1964
204 Ga0495641_0213714 3300046461 Bacteria 865
205 Ga0495651_0136215 3300046462 Bacteria 1786
206 Ga0495651_0271172 3300046462 Bacteria 1150
207 Ga0495653_0092823 3300046463 Bacteria 2203
208 Ga0495582_0000011 3300046473 Bacteria 113352
209 Ga0495664_0080924 3300046477 Bacteria 1947
210 Ga0495664_0280591 3300046477 Bacteria 1007
211 Ga0495608_0000423 3300046511 Bacteria 29473
212 Ga0495608_0015106 3300046511 Bacteria 5357
213 Ga0495610_0066935 3300046512 Bacteria 1690
214 Ga0495618_0000174 3300046514 Bacteria 45942
215 Ga0495618_0536639 3300046514 Bacteria 702
216 Ga0495620_0000144 3300046515 Bacteria 58204
217 Ga0495628_0000891 3300046516 Bacteria 27515
218 Ga0495628_0041770 3300046516 Bacteria 3660
219 Ga0495628_0093307 3300046516 Bacteria 2328
220 Ga0495628_0149548 3300046516 Bacteria 1779
221 Ga0495630_0009997 3300046517 Bacteria 6832
222 Ga0495630_0080436 3300046517 Bacteria 2458
223 Ga0495637_0298824 3300046520 Bacteria 571
224 Ga0495644_0000091 3300046523 Bacteria 45180
225 Ga0495652_1072059 3300046529 Bacteria 524
226 Ga0495640_0004808 3300046533 Bacteria 10755
227 Ga0495586_0019427 3300046535 Bacteria 3617
228 Ga0495587_0002239 3300046536 Bacteria 12930
229 Ga0495587_0171499 3300046536 Bacteria 1232
230 Ga0495598_0000676 3300046537 Bacteria 6462
231 Ga0495621_0074047 3300046539 Bacteria 1259
232 Ga0495645_0553794 3300046543 Bacteria 712
233 Ga0495633_0040962 3300046558 Bacteria 2204
234 Ga0495667_0000018 3300046559 Bacteria 188610
235 Ga0495667_0722419 3300046559 Bacteria 617
236 Ga0495667_0909894 3300046559 Bacteria 539
237 Ga0495668_0027772 3300046616 Bacteria 3206
238 Ga0495668_0758599 3300046616 Bacteria 537
239 Ga0495634_0000018 3300046642 Bacteria 121323
240 Ga0495634_0000247 3300046642 Bacteria 50931
241 Ga0495634_0067019 3300046642 Bacteria 2375
242 Ga0495634_0330558 3300046642 Bacteria 916
243 Ga0495634_0788613 3300046642 Bacteria 542
244 Ga0495625_0000587 3300046660 Bacteria 52838
245 Ga0495635_0169049 3300046663 Bacteria 1487
246 Ga0495588_0110200 3300046674 Bacteria 1450
247 Ga0495657_0804815 3300046675 Bacteria 537
248 Ga0495599_0010843 3300046678 Bacteria 5584
249 Ga0495599_0084624 3300046678 Bacteria 1981
250 Ga0495647_0000008 3300046681 Bacteria 101193
251 Ga0495647_0007295 3300046681 Bacteria 3697
252 Ga0495658_0000005 3300046683 Bacteria 149839
253 Ga0495613_0000113 3300046689 Bacteria 79559
254 Ga0495613_0000803 3300046689 Bacteria 24344
255 Ga0495613_0942027 3300046689 Bacteria 557
256 Ga0495624_0001700 3300046690 Bacteria 16831
257 Ga0495624_0041070 3300046690 Bacteria 2961
258 Ga0495649_0005093 3300046694 Bacteria 8439
259 Ga0495600_0001684 3300046809 Bacteria 12350
260 Ga0495600_0160114 3300046809 Bacteria 1455
261 Ga0495600_0209298 3300046809 Bacteria 1250
262 Ga0495581_0825342 3300047315 Bacteria 531
263 Ga0495604_0001310 3300047317 Bacteria 20341
264 Ga0495604_0002477 3300047317 Bacteria 14740
265 Ga0495672_0191354 3300047320 Bacteria 1029
266 Ga0495676_0018293 3300047321 Bacteria 6178
267 Ga0495676_0246533 3300047321 Bacteria 1221
268 Ga0495680_0000773 3300047322 Bacteria 35829
269 Ga0495680_0001716 3300047322 Bacteria 23253
270 Ga0495680_0011368 3300047322 Bacteria 7881
271 Ga0495679_016678 3300047446 Bacteria 2652
272 Ga0495685_047888 3300047447 Bacteria 1453
273 Ga0495673_0099162 3300047469 Bacteria 1180
274 Ga0495684_0295675 3300047471 Bacteria 1164
275 Ga0495686_0450993 3300047472 Bacteria 683
276 Ga0495593_0081269 3300047673 Bacteria 1676
277 Ga0495602_0001172 3300048088 Bacteria 25703
278 Ga0495602_0064008 3300048088 Bacteria 3183
279 Ga0496100_0000425 3300048903 Bacteria 20471
280 Ga0496100_0632653 3300048903 Bacteria 832
281 Ga0496100_0753439 3300048903 Bacteria 762
282 Ga0496101_0030866 3300048904 Bacteria 3762
283 Ga0496102_0000039 3300048905 Bacteria 198306
284 Ga0496102_0011663 3300048905 Bacteria 7586
285 Ga0496102_0721220 3300048905 Bacteria 920
286 Ga0496103_0000008 3300048906 Bacteria 340474
287 Ga0496103_0011787 3300048906 Bacteria 5186
288 Ga0496103_0628749 3300048906 Bacteria 683
289 Ga0496104_0000004 3300048907 Bacteria 641830
290 Ga0496104_0000009 3300048907 Bacteria 488055
291 Ga0496104_0233976 3300048907 Bacteria 1749
292 Ga0496104_0809912 3300048907 Bacteria 843
293 Ga0496105_0000001 3300048908 Bacteria 1328178
294 Ga0496105_0000007 3300048908 Bacteria 339658
295 Ga0496105_0397648 3300048908 Bacteria 1094
296 Ga0496105_1232444 3300048908 Bacteria 549
297 Ga0496106_0000997 3300048909 Bacteria 20676
298 Ga0496106_0199762 3300048909 Bacteria 1591
299 Ga0496107_0006601 3300048910 Bacteria 7986
300 Ga0496108_0000001 3300048911 Bacteria 919044
301 Ga0496108_0002109 3300048911 Bacteria 15927
302 Ga0496108_0011964 3300048911 Bacteria 7059
303 Ga0496108_0500009 3300048911 Bacteria 1062
304 Ga0496109_0000003 3300048912 Bacteria 420862
305 Ga0496109_0000129 3300048912 Bacteria 77469
306 Ga0496109_0360620 3300048912 Bacteria 1373
307 Ga0496109_0554822 3300048912 Bacteria 1084
308 Ga0496109_1250179 3300048912 Bacteria 679
309 Ga0496110_0000087 3300048913 Bacteria 48905
310 Ga0496110_0276697 3300048913 Bacteria 1528
311 Ga0496110_0525526 3300048913 Bacteria 1076
312 Ga0496111_0000010 3300048914 Bacteria 92600
313 Ga0496111_0304462 3300048914 Bacteria 1181
314 Ga0496112_0325501 3300048915 Bacteria 1481
315 Ga0496112_0531405 3300048915 Bacteria 1110
316 Ga0496113_0380591 3300048916 Bacteria 1133
317 Ga0496113_0945537 3300048916 Bacteria 680
318 Ga0496113_1069811 3300048916 Bacteria 633
319 Ga0496114_0000014 3300048917 Bacteria 297902
320 Ga0496114_0316586 3300048917 Bacteria 1378
321 Ga0496114_1331093 3300048917 Bacteria 605
322 Ga0496115_0000125 3300048918 Bacteria 69936
323 Ga0496115_0033562 3300048918 Bacteria 4052
324 Ga0496117_0005647 3300048920 Bacteria 13056
325 Ga0496117_0081685 3300048920 Bacteria 2120
326 Ga0496118_0000818 3300048921 Bacteria 49518
327 Ga0496118_0318887 3300048921 Bacteria 844
328 Ga0496119_0040292 3300048922 Bacteria 2990
329 Ga0496120_0160859 3300048923 Bacteria 1119
330 Ga0496124_0448700 3300048927 Bacteria 880
331 Ga0496125_0107121 3300048928 Bacteria 2037
332 Ga0496126_0503680 3300048929 Bacteria 967
333 Ga0501042_0018580 3300049578 Bacteria 4815
334 Ga0501042_0041312 3300049578 Bacteria 3279
335 Ga0501042_0245057 3300049578 Bacteria 1293
336 Ga0501046_0549781 3300049580 Bacteria 823
337 Ga0501067_0579392 3300049583 Bacteria 629
338 Ga0501068_0048547 3300049584 Bacteria 2563
339 Ga0501069_0244646 3300049585 Bacteria 1046
340 Ga0501070_0082316 3300049586 Bacteria 2664
341 Ga0501075_0518033 3300049591 Bacteria 910
342 Ga0501076_0041221 3300049592 Bacteria 3631
343 Ga0501077_0571231 3300049593 Bacteria 726
344 Ga0501081_0793334 3300049743 Bacteria 713
345 Ga0501045_0608690 3300049824 Bacteria 809
346 nmdc:mga08x19_455027_c1 3300050514 Bacteria 901
347 Ga0495601_0000013 3300053077 Bacteria 226476
348 Ga0495601_0175050 3300053077 Bacteria 1403
349 Ga0495601_0810637 3300053077 Bacteria 594
350 Ga0495601_0936900 3300053077 Bacteria 546
351 Ga0495612_0003520 3300053078 Bacteria 6488
352 Ga0495612_0005643 3300053078 Bacteria 5171
353 Ga0495655_0000001 3300053083 Bacteria 419518
354 Ga0495595_0058936 3300053084 Bacteria 1794
355 Ga0495595_0438141 3300053084 Bacteria 664
356 Ga0495619_0005151 3300053085 Bacteria 8297
357 Ga0495619_0009830 3300053085 Bacteria 6030
358 Ga0495619_0161088 3300053085 Bacteria 1550
359 Ga0500614_000117 3300053123 Bacteria 19001
360 Ga0500628_000010 3300053129 Bacteria 122210
361 Ga0501084_0312690 3300054114 Bacteria 1327
362 Ga0501084_1041976 3300054114 Bacteria 687
363 Ga0530510_1482486 3300061734 Bacteria 521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0000425 Ga0496100_0000425_4362_4526 46
2 3300048904 Ga0496101_0030866 Ga0496101_0030866_2432_2596 46
3 3300005353 Ga0070669_100006808 Ga0070669_1000068085 47
4 3300005546 Ga0070696_102017716 Ga0070696_1020177162 47
5 3300009093 Ga0105240_11580879 Ga0105240_115808792 47
6 3300025923 Ga0207681_10006568 Ga0207681_100065683 47
7 3300046559 Ga0495667_0000018 Ga0495667_0000018_178397_178567 47
8 3300046675 Ga0495657_0804815 Ga0495657_0804815_60_224 47
9 3300047322 Ga0495680_0001716 Ga0495680_0001716_5045_5215 47
10 3300048905 Ga0496102_0721220 Ga0496102_0721220_307_477 47
11 3300049580 Ga0501046_0549781 Ga0501046_0549781_332_496 47
12 3300049583 Ga0501067_0579392 Ga0501067_0579392_118_282 47
13 3300049585 Ga0501069_0244646 Ga0501069_0244646_863_1027 47
14 3300049591 Ga0501075_0518033 Ga0501075_0518033_378_542 47
15 3300049743 Ga0501081_0793334 Ga0501081_0793334_362_526 47
16 3300049824 Ga0501045_0608690 Ga0501045_0608690_297_461 47
17 3300054114 Ga0501084_0312690 Ga0501084_0312690_757_921 47
18 3300054114 Ga0501084_1041976 Ga0501084_1041976_144_308 47
19 3300061734 Ga0530510_1482486 Ga0530510_1482486_288_452 47
20 3300003322 rootL2_10091476 rootL2_100914762 48
21 3300005331 Ga0070670_101222754 Ga0070670_1012227542 48
22 3300005341 Ga0070691_10003693 Ga0070691_100036937 48
23 3300005356 Ga0070674_100000008 Ga0070674_10000000814 48
24 3300005548 Ga0070665_100000106 Ga0070665_100000106115 48
25 3300005614 Ga0068856_100009507 Ga0068856_1000095072 48
26 3300005618 Ga0068864_100000045 Ga0068864_100000045145 48
27 3300005718 Ga0068866_10000237 Ga0068866_1000023718 48
28 3300005842 Ga0068858_100000216 Ga0068858_10000021631 48
29 3300006163 Ga0070715_10000001 Ga0070715_10000001297 48
30 3300009148 Ga0105243_10254918 Ga0105243_102549183 48
31 3300009148 Ga0105243_11901678 Ga0105243_119016782 48
32 3300009174 Ga0105241_10395940 Ga0105241_103959402 48
33 3300014326 Ga0157380_10000281 Ga0157380_100002812 48
34 3300014969 Ga0157376_10054985 Ga0157376_100549854 48
35 3300025905 Ga0207685_10000082 Ga0207685_1000008213 48
36 3300025911 Ga0207654_10277549 Ga0207654_102775492 48
37 3300025934 Ga0207686_10119110 Ga0207686_101191102 48
38 3300025935 Ga0207709_10160526 Ga0207709_101605262 48
39 3300025937 Ga0207669_10000004 Ga0207669_10000004194 48
40 3300025949 Ga0207667_11963721 Ga0207667_119637212 48
41 3300026035 Ga0207703_10000023 Ga0207703_10000023177 48
42 3300026078 Ga0207702_10050174 Ga0207702_100501747 48
43 3300026095 Ga0207676_10000016 Ga0207676_1000001619 48
44 3300028379 Ga0268266_10000047 Ga0268266_10000047267 48
45 3300044842 Ga0466957_0492347 Ga0466957_0492347_235_402 48
46 3300045976 Ga0466967_1798478 Ga0466967_1798478_41_208 48
47 3300046455 Ga0495603_0000333 Ga0495603_0000333_3184_3351 48
48 3300046461 Ga0495641_0000044 Ga0495641_0000044_56376_56549 48
49 3300046511 Ga0495608_0015106 Ga0495608_0015106_4342_4515 48
50 3300046516 Ga0495628_0149548 Ga0495628_0149548_873_1046 48
51 3300046517 Ga0495630_0080436 Ga0495630_0080436_622_795 48
52 3300046529 Ga0495652_1072059 Ga0495652_1072059_96_269 48
53 3300046537 Ga0495598_0000676 Ga0495598_0000676_2682_2861 48
54 3300046674 Ga0495588_0110200 Ga0495588_0110200_146_313 48
55 3300046678 Ga0495599_0010843 Ga0495599_0010843_464_637 48
56 3300046694 Ga0495649_0005093 Ga0495649_0005093_1095_1268 48
57 3300046809 Ga0495600_0160114 Ga0495600_0160114_212_385 48
58 3300047321 Ga0495676_0018293 Ga0495676_0018293_1816_1989 48
59 3300047446 Ga0495679_016678 Ga0495679_016678_1576_1749 48
60 3300048088 Ga0495602_0064008 Ga0495602_0064008_2978_3151 48
61 3300048908 Ga0496105_1232444 Ga0496105_1232444_56_229 48
62 3300048911 Ga0496108_0011964 Ga0496108_0011964_4269_4436 48
63 3300048912 Ga0496109_0360620 Ga0496109_0360620_271_438 48
64 3300048916 Ga0496113_0945537 Ga0496113_0945537_437_610 48
65 3300048916 Ga0496113_1069811 Ga0496113_1069811_227_394 48
66 3300049578 Ga0501042_0041312 Ga0501042_0041312_281_460 48
67 3300053123 Ga0500614_000117 Ga0500614_000117_2642_2815 48
68 3300005329 Ga0070683_100398420 Ga0070683_1003984202 49
69 3300005353 Ga0070669_101114753 Ga0070669_1011147532 49
70 3300005406 Ga0070703_10375902 Ga0070703_103759021 49
71 3300005535 Ga0070684_102255310 Ga0070684_1022553101 49
72 3300005563 Ga0068855_100610917 Ga0068855_1006109172 49
73 3300005616 Ga0068852_101398646 Ga0068852_1013986462 49
74 3300005840 Ga0068870_10139291 Ga0068870_101392912 49
75 3300005983 Ga0081540_1209823 Ga0081540_12098232 49
76 3300009176 Ga0105242_10000430 Ga0105242_100004302 49
77 3300010375 Ga0105239_12728279 Ga0105239_127282792 49
78 3300013308 Ga0157375_10108808 Ga0157375_101088084 49
79 3300014968 Ga0157379_10140055 Ga0157379_101400552 49
80 3300020075 Ga0206349_1955911 Ga0206349_19559112 49
81 3300020081 Ga0206354_10977116 Ga0206354_109771162 49
82 3300025885 Ga0207653_10042382 Ga0207653_100423821 49
83 3300025923 Ga0207681_10328674 Ga0207681_103286742 49
84 3300025934 Ga0207686_10000033 Ga0207686_1000003347 49
85 3300025944 Ga0207661_10074372 Ga0207661_100743725 49
86 3300025949 Ga0207667_10646703 Ga0207667_106467032 49
87 3300026078 Ga0207702_11286416 Ga0207702_112864162 49
88 3300035118 Ga0373954_0234627 Ga0373954_0234627_530_700 49
89 3300041460 Ga0451802_1034845 Ga0451802_1034845_117_290 49
90 3300044656 Ga0466969_0513821 Ga0466969_0513821_115_291 49
91 3300046455 Ga0495603_0000016 Ga0495603_0000016_65525_65695 49
92 3300046461 Ga0495641_0213714 Ga0495641_0213714_13_183 49
93 3300046516 Ga0495628_0000891 Ga0495628_0000891_5445_5621 49
94 3300046536 Ga0495587_0171499 Ga0495587_0171499_371_544 49
95 3300046616 Ga0495668_0758599 Ga0495668_0758599_178_348 49
96 3300046663 Ga0495635_0169049 Ga0495635_0169049_684_854 49
97 3300046689 Ga0495613_0942027 Ga0495613_0942027_105_275 49
98 3300046809 Ga0495600_0209298 Ga0495600_0209298_212_382 49
99 3300047673 Ga0495593_0081269 Ga0495593_0081269_703_873 49
100 3300048907 Ga0496104_0809912 Ga0496104_0809912_315_485 49
101 3300048908 Ga0496105_0397648 Ga0496105_0397648_527_721 49
102 3300048911 Ga0496108_0500009 Ga0496108_0500009_708_878 49
103 3300048912 Ga0496109_0554822 Ga0496109_0554822_85_255 49
104 3300048913 Ga0496110_0525526 Ga0496110_0525526_302_472 49
105 3300048915 Ga0496112_0325501 Ga0496112_0325501_195_365 49
106 3300048916 Ga0496113_0380591 Ga0496113_0380591_11_181 49
107 3300048917 Ga0496114_0316586 Ga0496114_0316586_783_959 49
108 3300048917 Ga0496114_1331093 Ga0496114_1331093_309_479 49
109 3300048918 Ga0496115_0033562 Ga0496115_0033562_3458_3628 49
110 3300049578 Ga0501042_0245057 Ga0501042_0245057_743_919 49
111 3300053083 Ga0495655_0000001 Ga0495655_0000001_165478_165651 49
112 3300053085 Ga0495619_0005151 Ga0495619_0005151_5536_5709 49
113 3300053085 Ga0495619_0009830 Ga0495619_0009830_5633_5803 49
114 3300053129 Ga0500628_000010 Ga0500628_000010_39679_39852 49
115 3300001979 JGI24740J21852_10000709 JGI24740J21852_100007093 50
116 3300002459 JGI24751J29686_10136385 JGI24751J29686_101363852 50
117 3300005327 Ga0070658_10395381 Ga0070658_103953812 50
118 3300005327 Ga0070658_11182932 Ga0070658_111829322 50
119 3300005329 Ga0070683_100000619 Ga0070683_10000061915 50
120 3300005329 Ga0070683_100010491 Ga0070683_1000104912 50
121 3300005329 Ga0070683_100145564 Ga0070683_1001455643 50
122 3300005337 Ga0070682_100000013 Ga0070682_10000001380 50
123 3300005337 Ga0070682_101320482 Ga0070682_1013204822 50
124 3300005338 Ga0068868_100000082 Ga0068868_10000008222 50
125 3300005340 Ga0070689_100069950 Ga0070689_1000699502 50
126 3300005347 Ga0070668_100125001 Ga0070668_1001250012 50
127 3300005354 Ga0070675_100000111 Ga0070675_10000011129 50
128 3300005354 Ga0070675_100771729 Ga0070675_1007717292 50
129 3300005356 Ga0070674_100000064 Ga0070674_10000006413 50
130 3300005365 Ga0070688_100000068 Ga0070688_1000000685 50
131 3300005366 Ga0070659_100003667 Ga0070659_10000366711 50
132 3300005435 Ga0070714_100262796 Ga0070714_1002627962 50
133 3300005435 Ga0070714_100386872 Ga0070714_1003868722 50
134 3300005439 Ga0070711_100017558 Ga0070711_1000175583 50
135 3300005440 Ga0070705_100494235 Ga0070705_1004942352 50
136 3300005455 Ga0070663_100103220 Ga0070663_1001032202 50
137 3300005455 Ga0070663_100243149 Ga0070663_1002431492 50
138 3300005456 Ga0070678_100013405 Ga0070678_1000134054 50
139 3300005456 Ga0070678_100062255 Ga0070678_1000622552 50
140 3300005457 Ga0070662_100000004 Ga0070662_10000000462 50
141 3300005466 Ga0070685_10000364 Ga0070685_100003646 50
142 3300005535 Ga0070684_100001272 Ga0070684_1000012723 50
143 3300005535 Ga0070684_100001455 Ga0070684_1000014554 50
144 3300005535 Ga0070684_100027529 Ga0070684_1000275297 50
145 3300005535 Ga0070684_100308797 Ga0070684_1003087971 50
146 3300005535 Ga0070684_100433346 Ga0070684_1004333462 50
147 3300005535 Ga0070684_100456269 Ga0070684_1004562692 50
148 3300005535 Ga0070684_100642360 Ga0070684_1006423602 50
149 3300005539 Ga0068853_100031357 Ga0068853_1000313578 50
150 3300005546 Ga0070696_100278668 Ga0070696_1002786682 50
151 3300005546 Ga0070696_101005892 Ga0070696_1010058922 50
152 3300005547 Ga0070693_100356339 Ga0070693_1003563391 50
153 3300005548 Ga0070665_100001339 Ga0070665_10000133911 50
154 3300005549 Ga0070704_101271073 Ga0070704_1012710732 50
155 3300005564 Ga0070664_100019512 Ga0070664_1000195124 50
156 3300005614 Ga0068856_100309207 Ga0068856_1003092073 50
157 3300005616 Ga0068852_101379395 Ga0068852_1013793952 50
158 3300005718 Ga0068866_10000001 Ga0068866_10000001334 50
159 3300005719 Ga0068861_100361398 Ga0068861_1003613982 50
160 3300005834 Ga0068851_10753471 Ga0068851_107534712 50
161 3300005841 Ga0068863_100004198 Ga0068863_10000419816 50
162 3300005843 Ga0068860_100009131 Ga0068860_1000091318 50
163 3300005937 Ga0081455_10005387 Ga0081455_100053875 50
164 3300005983 Ga0081540_1041345 Ga0081540_10413452 50
165 3300006175 Ga0070712_100004201 Ga0070712_1000042014 50
166 3300006358 Ga0068871_100827431 Ga0068871_1008274312 50
167 3300006914 Ga0075436_101165501 Ga0075436_1011655012 50
168 3300009036 Ga0105244_10406805 Ga0105244_104068052 50
169 3300009094 Ga0111539_12771030 Ga0111539_127710301 50
170 3300009094 Ga0111539_12835874 Ga0111539_128358741 50
171 3300009098 Ga0105245_10000016 Ga0105245_1000001626 50
172 3300009098 Ga0105245_10000454 Ga0105245_1000045417 50
173 3300009101 Ga0105247_10058212 Ga0105247_100582122 50
174 3300009148 Ga0105243_10042273 Ga0105243_100422733 50
175 3300009176 Ga0105242_10000398 Ga0105242_1000039821 50
176 3300009553 Ga0105249_10000616 Ga0105249_100006162 50
177 3300010375 Ga0105239_12546070 Ga0105239_125460702 50
178 3300011119 Ga0105246_10276406 Ga0105246_102764063 50
179 3300011119 Ga0105246_11270434 Ga0105246_112704341 50
180 3300012507 Ga0157342_1015036 Ga0157342_10150361 50
181 3300013104 Ga0157370_10120674 Ga0157370_101206743 50
182 3300013296 Ga0157374_10003475 Ga0157374_1000347516 50
183 3300013296 Ga0157374_10363742 Ga0157374_103637422 50
184 3300013297 Ga0157378_10009271 Ga0157378_1000927111 50
185 3300013297 Ga0157378_10106341 Ga0157378_101063415 50
186 3300013308 Ga0157375_10073133 Ga0157375_100731334 50
187 3300014968 Ga0157379_10087728 Ga0157379_100877282 50
188 3300014969 Ga0157376_10022813 Ga0157376_100228138 50
189 3300014969 Ga0157376_13051552 Ga0157376_130515521 50
190 3300017792 Ga0163161_10000035 Ga0163161_10000035107 50
191 3300020081 Ga0206354_11518587 Ga0206354_115185872 50
192 3300025899 Ga0207642_10000002 Ga0207642_1000000254 50
193 3300025900 Ga0207710_10029428 Ga0207710_100294282 50
194 3300025909 Ga0207705_10237015 Ga0207705_102370152 50
195 3300025909 Ga0207705_11460832 Ga0207705_114608322 50
196 3300025915 Ga0207693_10006565 Ga0207693_100065652 50
197 3300025915 Ga0207693_10655495 Ga0207693_106554952 50
198 3300025918 Ga0207662_10455169 Ga0207662_104551692 50
199 3300025920 Ga0207649_10716693 Ga0207649_107166931 50
200 3300025926 Ga0207659_10000010 Ga0207659_10000010126 50
201 3300025927 Ga0207687_10000018 Ga0207687_10000018198 50
202 3300025927 Ga0207687_10001114 Ga0207687_100011145 50
203 3300025929 Ga0207664_10199611 Ga0207664_101996114 50
204 3300025929 Ga0207664_10403526 Ga0207664_104035262 50
205 3300025932 Ga0207690_10003714 Ga0207690_100037149 50
206 3300025933 Ga0207706_10000012 Ga0207706_10000012156 50
207 3300025934 Ga0207686_10000322 Ga0207686_1000032211 50
208 3300025935 Ga0207709_10050733 Ga0207709_100507334 50
209 3300025936 Ga0207670_10053406 Ga0207670_100534063 50
210 3300025937 Ga0207669_10000018 Ga0207669_1000001893 50
211 3300025944 Ga0207661_10000262 Ga0207661_1000026213 50
212 3300025944 Ga0207661_10001202 Ga0207661_1000120220 50
213 3300025944 Ga0207661_10005636 Ga0207661_100056369 50
214 3300025944 Ga0207661_10068346 Ga0207661_100683464 50
215 3300025945 Ga0207679_10012868 Ga0207679_100128684 50
216 3300025961 Ga0207712_10000007 Ga0207712_10000007304 50
217 3300025972 Ga0207668_10063553 Ga0207668_100635532 50
218 3300025981 Ga0207640_11971116 Ga0207640_119711162 50
219 3300025986 Ga0207658_10480497 Ga0207658_104804972 50
220 3300026023 Ga0207677_10000519 Ga0207677_1000051910 50
221 3300026041 Ga0207639_10001493 Ga0207639_100014932 50
222 3300026067 Ga0207678_10450677 Ga0207678_104506772 50
223 3300026067 Ga0207678_11336132 Ga0207678_113361322 50
224 3300026078 Ga0207702_10402683 Ga0207702_104026833 50
225 3300026088 Ga0207641_10000151 Ga0207641_1000015183 50
226 3300026088 Ga0207641_10003840 Ga0207641_100038402 50
227 3300026118 Ga0207675_100221232 Ga0207675_1002212321 50
228 3300026118 Ga0207675_100789810 Ga0207675_1007898102 50
229 3300026118 Ga0207675_101701894 Ga0207675_1017018942 50
230 3300026121 Ga0207683_10061455 Ga0207683_100614552 50
231 3300026121 Ga0207683_10126026 Ga0207683_101260264 50
232 3300026142 Ga0207698_11324451 Ga0207698_113244512 50
233 3300028379 Ga0268266_10011189 Ga0268266_100111891 50
234 3300028379 Ga0268266_10990469 Ga0268266_109904692 50
235 3300028381 Ga0268264_10006050 Ga0268264_100060508 50
236 3300028563 Ga0265319_1000122 Ga0265319_100012214 50
237 3300028654 Ga0265322_10162773 Ga0265322_101627732 50
238 3300028666 Ga0265336_10073092 Ga0265336_100730922 50
239 3300028800 Ga0265338_10000706 Ga0265338_1000070614 50
240 3300031241 Ga0265325_10069390 Ga0265325_100693902 50
241 3300031250 Ga0265331_10069932 Ga0265331_100699322 50
242 3300031344 Ga0265316_10426232 Ga0265316_104262322 50
243 3300031712 Ga0265342_10095355 Ga0265342_100953552 50
244 3300035120 Ga0373957_0135554 Ga0373957_0135554_481_663 50
245 3300035172 Ga0373955_0327242 Ga0373955_0327242_95_277 50
246 3300035725 Ga0373947_0797049 Ga0373947_0797049_393_572 50
247 3300036401 Ga0373937_0261987 Ga0373937_0261987_1109_1291 50
248 3300041459 Ga0451800_1087336 Ga0451800_1087336_261_434 50
249 3300041486 Ga0451807_1676608 Ga0451807_1676608_185_358 50
250 3300041512 Ga0451853_0061737 Ga0451853_0061737_586_759 50
251 3300044683 Ga0466965_0900267 Ga0466965_0900267_318_491 50
252 3300044694 Ga0466963_0000001 Ga0466963_0000001_52400_52582 50
253 3300045836 Ga0466958_0036369 Ga0466958_0036369_271_444 50
254 3300046454 Ga0495592_0000657 Ga0495592_0000657_4505_4684 50
255 3300046455 Ga0495603_0007614 Ga0495603_0007614_4430_4609 50
256 3300046459 Ga0495629_0000272 Ga0495629_0000272_7176_7349 50
257 3300046459 Ga0495629_0348504 Ga0495629_0348504_58_237 50
258 3300046459 Ga0495629_0483456 Ga0495629_0483456_18_197 50
259 3300046460 Ga0495638_0015640 Ga0495638_0015640_2787_2960 50
260 3300046461 Ga0495641_0047762 Ga0495641_0047762_872_1045 50
261 3300046462 Ga0495651_0136215 Ga0495651_0136215_300_476 50
262 3300046462 Ga0495651_0271172 Ga0495651_0271172_484_663 50
263 3300046463 Ga0495653_0092823 Ga0495653_0092823_443_622 50
264 3300046473 Ga0495582_0000011 Ga0495582_0000011_55850_56023 50
265 3300046477 Ga0495664_0080924 Ga0495664_0080924_938_1111 50
266 3300046477 Ga0495664_0280591 Ga0495664_0280591_153_332 50
267 3300046511 Ga0495608_0000423 Ga0495608_0000423_3518_3697 50
268 3300046512 Ga0495610_0066935 Ga0495610_0066935_1135_1308 50
269 3300046514 Ga0495618_0000174 Ga0495618_0000174_21773_21952 50
270 3300046514 Ga0495618_0536639 Ga0495618_0536639_96_269 50
271 3300046515 Ga0495620_0000144 Ga0495620_0000144_20708_20887 50
272 3300046516 Ga0495628_0041770 Ga0495628_0041770_220_399 50
273 3300046516 Ga0495628_0093307 Ga0495628_0093307_1514_1693 50
274 3300046517 Ga0495630_0009997 Ga0495630_0009997_3444_3623 50
275 3300046520 Ga0495637_0298824 Ga0495637_0298824_83_256 50
276 3300046523 Ga0495644_0000091 Ga0495644_0000091_22973_23152 50
277 3300046533 Ga0495640_0004808 Ga0495640_0004808_291_470 50
278 3300046535 Ga0495586_0019427 Ga0495586_0019427_678_857 50
279 3300046536 Ga0495587_0002239 Ga0495587_0002239_4439_4612 50
280 3300046539 Ga0495621_0074047 Ga0495621_0074047_625_804 50
281 3300046543 Ga0495645_0553794 Ga0495645_0553794_219_395 50
282 3300046558 Ga0495633_0040962 Ga0495633_0040962_763_942 50
283 3300046559 Ga0495667_0722419 Ga0495667_0722419_285_461 50
284 3300046559 Ga0495667_0909894 Ga0495667_0909894_196_375 50
285 3300046616 Ga0495668_0027772 Ga0495668_0027772_28_201 50
286 3300046642 Ga0495634_0000018 Ga0495634_0000018_86094_86270 50
287 3300046642 Ga0495634_0000247 Ga0495634_0000247_27193_27372 50
288 3300046642 Ga0495634_0067019 Ga0495634_0067019_471_650 50
289 3300046642 Ga0495634_0330558 Ga0495634_0330558_525_704 50
290 3300046642 Ga0495634_0788613 Ga0495634_0788613_21_194 50
291 3300046660 Ga0495625_0000587 Ga0495625_0000587_5910_6086 50
292 3300046678 Ga0495599_0084624 Ga0495599_0084624_1572_1748 50
293 3300046681 Ga0495647_0000008 Ga0495647_0000008_30026_30205 50
294 3300046681 Ga0495647_0007295 Ga0495647_0007295_1634_1813 50
295 3300046683 Ga0495658_0000005 Ga0495658_0000005_57327_57500 50
296 3300046689 Ga0495613_0000113 Ga0495613_0000113_45181_45354 50
297 3300046689 Ga0495613_0000803 Ga0495613_0000803_4551_4730 50
298 3300046690 Ga0495624_0001700 Ga0495624_0001700_15137_15310 50
299 3300046690 Ga0495624_0041070 Ga0495624_0041070_2385_2564 50
300 3300046809 Ga0495600_0001684 Ga0495600_0001684_6588_6767 50
301 3300047315 Ga0495581_0825342 Ga0495581_0825342_34_213 50
302 3300047317 Ga0495604_0001310 Ga0495604_0001310_4900_5073 50
303 3300047317 Ga0495604_0002477 Ga0495604_0002477_13087_13260 50
304 3300047320 Ga0495672_0191354 Ga0495672_0191354_309_488 50
305 3300047321 Ga0495676_0246533 Ga0495676_0246533_194_373 50
306 3300047322 Ga0495680_0000773 Ga0495680_0000773_5402_5581 50
307 3300047322 Ga0495680_0011368 Ga0495680_0011368_3204_3377 50
308 3300047447 Ga0495685_047888 Ga0495685_047888_1003_1182 50
309 3300047469 Ga0495673_0099162 Ga0495673_0099162_732_905 50
310 3300047471 Ga0495684_0295675 Ga0495684_0295675_256_435 50
311 3300047472 Ga0495686_0450993 Ga0495686_0450993_347_520 50
312 3300048088 Ga0495602_0001172 Ga0495602_0001172_7677_7850 50
313 3300048903 Ga0496100_0632653 Ga0496100_0632653_182_361 50
314 3300048903 Ga0496100_0753439 Ga0496100_0753439_182_355 50
315 3300048905 Ga0496102_0000039 Ga0496102_0000039_124004_124180 50
316 3300048905 Ga0496102_0011663 Ga0496102_0011663_2710_2883 50
317 3300048906 Ga0496103_0000008 Ga0496103_0000008_245259_245435 50
318 3300048906 Ga0496103_0011787 Ga0496103_0011787_1128_1301 50
319 3300048906 Ga0496103_0628749 Ga0496103_0628749_488_661 50
320 3300048907 Ga0496104_0000004 Ga0496104_0000004_210909_211082 50
321 3300048907 Ga0496104_0000009 Ga0496104_0000009_177489_177671 50
322 3300048907 Ga0496104_0233976 Ga0496104_0233976_945_1118 50
323 3300048908 Ga0496105_0000001 Ga0496105_0000001_430749_430922 50
324 3300048908 Ga0496105_0000007 Ga0496105_0000007_310385_310567 50
325 3300048909 Ga0496106_0000997 Ga0496106_0000997_15628_15807 50
326 3300048909 Ga0496106_0199762 Ga0496106_0199762_512_685 50
327 3300048910 Ga0496107_0006601 Ga0496107_0006601_2236_2415 50
328 3300048911 Ga0496108_0000001 Ga0496108_0000001_589065_589244 50
329 3300048911 Ga0496108_0002109 Ga0496108_0002109_9450_9623 50
330 3300048912 Ga0496109_0000003 Ga0496109_0000003_263611_263790 50
331 3300048912 Ga0496109_0000129 Ga0496109_0000129_45235_45408 50
332 3300048912 Ga0496109_1250179 Ga0496109_1250179_405_578 50
333 3300048913 Ga0496110_0000087 Ga0496110_0000087_14973_15146 50
334 3300048913 Ga0496110_0276697 Ga0496110_0276697_635_808 50
335 3300048914 Ga0496111_0000010 Ga0496111_0000010_33801_33974 50
336 3300048914 Ga0496111_0304462 Ga0496111_0304462_432_605 50
337 3300048915 Ga0496112_0531405 Ga0496112_0531405_464_646 50
338 3300048917 Ga0496114_0000014 Ga0496114_0000014_235640_235813 50
339 3300048918 Ga0496115_0000125 Ga0496115_0000125_57299_57472 50
340 3300048920 Ga0496117_0005647 Ga0496117_0005647_3798_3971 50
341 3300048920 Ga0496117_0081685 Ga0496117_0081685_381_554 50
342 3300048921 Ga0496118_0000818 Ga0496118_0000818_16889_17062 50
343 3300048921 Ga0496118_0318887 Ga0496118_0318887_656_832 50
344 3300048922 Ga0496119_0040292 Ga0496119_0040292_1469_1642 50
345 3300048923 Ga0496120_0160859 Ga0496120_0160859_508_681 50
346 3300048927 Ga0496124_0448700 Ga0496124_0448700_77_250 50
347 3300048928 Ga0496125_0107121 Ga0496125_0107121_1238_1417 50
348 3300048929 Ga0496126_0503680 Ga0496126_0503680_550_723 50
349 3300049578 Ga0501042_0018580 Ga0501042_0018580_2994_3167 50
350 3300049584 Ga0501068_0048547 Ga0501068_0048547_1291_1464 50
351 3300049586 Ga0501070_0082316 Ga0501070_0082316_1067_1240 50
352 3300049592 Ga0501076_0041221 Ga0501076_0041221_1943_2152 50
353 3300049593 Ga0501077_0571231 Ga0501077_0571231_414_587 50
354 3300050514 nmdc:mga08x19_455027_c1 nmdc:mga08x19_455027_c1_124_303 50
355 3300053077 Ga0495601_0000013 Ga0495601_0000013_107724_107897 50
356 3300053077 Ga0495601_0175050 Ga0495601_0175050_472_648 50
357 3300053077 Ga0495601_0810637 Ga0495601_0810637_267_446 50
358 3300053077 Ga0495601_0936900 Ga0495601_0936900_141_314 50
359 3300053078 Ga0495612_0003520 Ga0495612_0003520_1914_2087 50
360 3300053078 Ga0495612_0005643 Ga0495612_0005643_4433_4606 50
361 3300053084 Ga0495595_0058936 Ga0495595_0058936_801_974 50
362 3300053084 Ga0495595_0438141 Ga0495595_0438141_273_449 50
363 3300053085 Ga0495619_0161088 Ga0495619_0161088_1262_1441 50

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00301

Rubredoxin

Rubredoxin

3

38

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cfw-assembly1.cif.gz_A ga-substituted desulforedoxin 0.8997 2 14
1dhg-assembly1.cif.gz_A hg-substituted desulforedoxin 0.8869 2 14
1dcd-assembly1.cif.gz_A desulforedoxin complexed with cd2+ 0.8778 2 14
1h7v-assembly1.cif.gz_A rubredoxin from guillardia theta 0.8686 3 35
1dcd-assembly1.cif.gz_B desulforedoxin complexed with cd2+ 0.8663 2 14
ID Description Score Start End Superfamily
1h7vA00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.8686 3 35 2.20.28.10
2ji3C01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Desulphoferrodoxin, N-terminal domain 0.8639 1 14 2.20.28.100
af_Q9SLI4_94_150_2.20.28.10 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.8396 3 36 2.20.28.10
2kn9A01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.81 2 46 2.20.28.10
1vzhA01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Desulphoferrodoxin, N-terminal domain 0.7873 1 14 2.20.28.100
ID Description Score Start End GO Terms
AF-A0A2N7WER3-F1-model_v4 Rubredoxin 0.8893 1 36 GO:0005506
GO:0009055
GO:0043448
AF-A0A2W5DAS8-F1-model_v4 deleted 0.8839 2 34
AF-A0A415TMK5-F1-model_v4 deleted 0.8834 1 34
AF-A0A1G8GQ93-F1-model_v4 Rubredoxin-NAD+ reductase 0.8824 1 36 GO:0005506
GO:0005737
GO:0016491
AF-A0A800GHS1-F1-model_v4 Rubredoxin 0.8772 1 36 GO:0005506
GO:0009055
GO:0043448

Feature Viewer

pLDDT pTM Quality
80.11 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map