F423070
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 363 | 173 | 359 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300046501|Ga0495607_0004232|Ga0495607_0004232_9163_9546 |
| Length | 127 |
| Sequence | MMMLLHGFVALSKTYTIQAPMTRALFICTQNRLRSPTAEHVFSTWPGVETDSAGLGADANVPLSPEQIEWANIIFVMEKTHKNRLSTKFRRYLNGKRVICLDIPDDYEYMQPELVRLLESKAGRFLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 3 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 4 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 39 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 47 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 48 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 74 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 75 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 76 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 77 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 78 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 79 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 80 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 81 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 82 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 83 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 84 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 85 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 86 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 87 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 155 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 156 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 157 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 158 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 161 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 167 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 169 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 170 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 171 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 172 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 173 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 0 |
| Isolates | 1.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.88 |
| Nodule | 0 |
| Rhizoplane | 4.96 |
| Rhizosphere | 74.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1001605 | 3300002774 | Bacteria | 6163 |
| 2 | JGI25159J45721_1000552 | 3300002987 | Bacteria | 16976 |
| 3 | JGI25159J45721_1006092 | 3300002987 | Bacteria | 3663 |
| 4 | rootH2_10122097 | 3300003320 | Bacteria | 1890 |
| 5 | JGI25160J50197_1009803 | 3300003354 | Bacteria | 3518 |
| 6 | JGI25161J50226_1000465 | 3300003374 | Bacteria | 18592 |
| 7 | JGI25161J50226_1003566 | 3300003374 | Bacteria | 3518 |
| 8 | Ga0055525_1000074 | 3300003759 | Bacteria | 178058 |
| 9 | Ga0055526_1000018 | 3300003771 | Bacteria | 198838 |
| 10 | Ga0055526_1005722 | 3300003771 | Bacteria | 7029 |
| 11 | Ga0055526_1006256 | 3300003771 | Bacteria | 6521 |
| 12 | Ga0055537_1005650 | 3300003773 | Bacteria | 3313 |
| 13 | Ga0055537_1008145 | 3300003773 | Bacteria | 2448 |
| 14 | Ga0055524_1000716 | 3300003775 | Bacteria | 22809 |
| 15 | Ga0055524_1001141 | 3300003775 | Bacteria | 15987 |
| 16 | Ga0055524_1001903 | 3300003775 | Bacteria | 11324 |
| 17 | Ga0055524_1014094 | 3300003775 | Bacteria | 2980 |
| 18 | Ga0055534_1007349 | 3300003784 | Bacteria | 2634 |
| 19 | Ga0055530_10001313 | 3300003791 | Bacteria | 18696 |
| 20 | Ga0055530_10001696 | 3300003791 | Bacteria | 15599 |
| 21 | Ga0055530_10005572 | 3300003791 | Bacteria | 5931 |
| 22 | Ga0055531_10001761 | 3300003794 | Bacteria | 15430 |
| 23 | Ga0055531_10020505 | 3300003794 | Bacteria | 2610 |
| 24 | Ga0055543_1000222 | 3300004625 | Bacteria | 45583 |
| 25 | Ga0065165_1000710 | 3300005262 | Bacteria | 47150 |
| 26 | Ga0065165_1001411 | 3300005262 | Bacteria | 26128 |
| 27 | Ga0065165_1041145 | 3300005262 | Bacteria | 1373 |
| 28 | Ga0070658_10000546 | 3300005327 | Bacteria | 32588 |
| 29 | Ga0070666_10000034 | 3300005335 | Bacteria | 121537 |
| 30 | Ga0070691_10531389 | 3300005341 | Bacteria | 684 |
| 31 | Ga0070661_100029530 | 3300005344 | Bacteria | 3958 |
| 32 | Ga0070668_100367777 | 3300005347 | Bacteria | 1221 |
| 33 | Ga0070669_100447301 | 3300005353 | Bacteria | 1064 |
| 34 | Ga0070667_100011325 | 3300005367 | Bacteria | 7376 |
| 35 | Ga0070663_100460895 | 3300005455 | Bacteria | 1049 |
| 36 | Ga0070662_100435045 | 3300005457 | Bacteria | 1087 |
| 37 | Ga0070685_10393211 | 3300005466 | Bacteria | 958 |
| 38 | Ga0070679_100346375 | 3300005530 | Bacteria | 1434 |
| 39 | Ga0070665_100099630 | 3300005548 | Bacteria | 2910 |
| 40 | Ga0068855_100634945 | 3300005563 | Bacteria | 1148 |
| 41 | Ga0070702_101124253 | 3300005615 | Unclassified | 629 |
| 42 | Ga0068858_101356559 | 3300005842 | Unclassified | 700 |
| 43 | Ga0068862_100370425 | 3300005844 | Bacteria | 1333 |
| 44 | Ga0075431_100332420 | 3300006847 | Unclassified | 1530 |
| 45 | Ga0075431_100456231 | 3300006847 | Bacteria | 1273 |
| 46 | Ga0105240_10000127 | 3300009093 | Bacteria | 156461 |
| 47 | Ga0105239_10000056 | 3300010375 | Bacteria | 157615 |
| 48 | Ga0157327_1055861 | 3300012512 | Unclassified | 575 |
| 49 | Ga0163162_10320135 | 3300013306 | Bacteria | 1683 |
| 50 | Ga0157372_10704521 | 3300013307 | Bacteria | 1175 |
| 51 | Ga0209436_100375 | 3300025208 | Bacteria | 20163 |
| 52 | Ga0209674_104736 | 3300025226 | Bacteria | 2153 |
| 53 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 54 | Ga0207425_1056933 | 3300025245 | Bacteria | 698 |
| 55 | Ga0209677_109073 | 3300025253 | Bacteria | 1831 |
| 56 | Ga0209129_1000583 | 3300025258 | Bacteria | 25095 |
| 57 | Ga0209129_1042005 | 3300025258 | Bacteria | 720 |
| 58 | Ga0209565_1002163 | 3300025263 | Bacteria | 7398 |
| 59 | Ga0209565_1005249 | 3300025263 | Bacteria | 3796 |
| 60 | Ga0209565_1014369 | 3300025263 | Bacteria | 1821 |
| 61 | Ga0209673_1111532 | 3300025273 | Bacteria | 571 |
| 62 | Ga0209130_1000474 | 3300025284 | Bacteria | 41406 |
| 63 | Ga0209675_1001523 | 3300025291 | Bacteria | 13227 |
| 64 | Ga0209675_1011107 | 3300025291 | Bacteria | 3008 |
| 65 | Ga0209676_1000472 | 3300025292 | Bacteria | 67063 |
| 66 | Ga0209025_1044308 | 3300025294 | Bacteria | 1861 |
| 67 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 68 | Ga0209564_1000134 | 3300025295 | Bacteria | 188346 |
| 69 | Ga0209758_1030442 | 3300025297 | Bacteria | 2235 |
| 70 | Ga0209050_1000092 | 3300025298 | Bacteria | 252702 |
| 71 | Ga0209256_1000706 | 3300025299 | Bacteria | 44385 |
| 72 | Ga0209257_1002123 | 3300025304 | Bacteria | 20708 |
| 73 | Ga0209257_1005053 | 3300025304 | Bacteria | 9586 |
| 74 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 75 | Ga0207705_10755738 | 3300025909 | Bacteria | 755 |
| 76 | Ga0207684_11579823 | 3300025910 | Bacteria | 532 |
| 77 | Ga0207695_10000243 | 3300025913 | Bacteria | 141682 |
| 78 | Ga0207649_10541036 | 3300025920 | Bacteria | 890 |
| 79 | Ga0207681_10062027 | 3300025923 | Bacteria | 2572 |
| 80 | Ga0207694_10001082 | 3300025924 | Bacteria | 23634 |
| 81 | Ga0207706_10260289 | 3300025933 | Bacteria | 1514 |
| 82 | Ga0207667_11313046 | 3300025949 | Bacteria | 699 |
| 83 | Ga0207668_10335481 | 3300025972 | Bacteria | 1259 |
| 84 | Ga0207658_10022917 | 3300025986 | Bacteria | 4352 |
| 85 | Ga0207703_11091577 | 3300026035 | Unclassified | 766 |
| 86 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 87 | Ga0268265_10630740 | 3300028380 | Bacteria | 1028 |
| 88 | Ga0268264_10077667 | 3300028381 | Bacteria | 2829 |
| 89 | Ga0307408_100000094 | 3300031548 | Bacteria | 97519 |
| 90 | Ga0307408_100000961 | 3300031548 | Bacteria | 22360 |
| 91 | Ga0307408_100008980 | 3300031548 | Bacteria | 6604 |
| 92 | Ga0307408_100031037 | 3300031548 | Bacteria | 3716 |
| 93 | Ga0307416_102108701 | 3300032002 | Bacteria | 666 |
| 94 | Ga0307510_10001111 | 3300033180 | Bacteria | 28776 |
| 95 | Ga0395899_0020607 | 3300037312 | Bacteria | 4998 |
| 96 | Ga0395900_0006527 | 3300037418 | Bacteria | 12152 |
| 97 | Ga0395900_0613668 | 3300037418 | Bacteria | 1027 |
| 98 | Ga0395898_0365455 | 3300037466 | Bacteria | 1376 |
| 99 | Ga0395905_0000111 | 3300037471 | Bacteria | 136345 |
| 100 | Ga0395905_0268348 | 3300037471 | Bacteria | 1592 |
| 101 | Ga0395901_0480951 | 3300038443 | Bacteria | 1267 |
| 102 | Ga0395901_0698251 | 3300038443 | Bacteria | 1012 |
| 103 | Ga0395901_2003967 | 3300038443 | Bacteria | 525 |
| 104 | Ga0436361_0633983 | 3300039447 | Bacteria | 516 |
| 105 | Ga0466972_0000073 | 3300044658 | Bacteria | 96438 |
| 106 | Ga0466965_0170210 | 3300044683 | Unclassified | 1146 |
| 107 | Ga0466966_0005816 | 3300044684 | Bacteria | 8130 |
| 108 | Ga0466961_0121628 | 3300044693 | Bacteria | 1638 |
| 109 | Ga0466971_0105700 | 3300044719 | Bacteria | 1296 |
| 110 | Ga0495617_015864 | 3300046452 | Bacteria | 2549 |
| 111 | Ga0495627_210894 | 3300046453 | Unclassified | 534 |
| 112 | Ga0495603_0080820 | 3300046455 | Bacteria | 1904 |
| 113 | Ga0495590_0000006 | 3300046457 | Bacteria | 372949 |
| 114 | Ga0495590_0000179 | 3300046457 | Bacteria | 37217 |
| 115 | Ga0495590_0193470 | 3300046457 | Bacteria | 746 |
| 116 | Ga0495590_0284631 | 3300046457 | Bacteria | 620 |
| 117 | Ga0495591_000127 | 3300046458 | Bacteria | 83271 |
| 118 | Ga0495629_0019974 | 3300046459 | Bacteria | 4780 |
| 119 | Ga0495650_0002151 | 3300046471 | Bacteria | 16727 |
| 120 | Ga0495650_0011779 | 3300046471 | Bacteria | 4755 |
| 121 | Ga0495650_0058859 | 3300046471 | Bacteria | 1549 |
| 122 | Ga0495582_0013147 | 3300046473 | Bacteria | 4555 |
| 123 | Ga0495605_0000022 | 3300046474 | Bacteria | 248321 |
| 124 | Ga0495605_0008843 | 3300046474 | Bacteria | 5677 |
| 125 | Ga0495605_0009786 | 3300046474 | Bacteria | 5383 |
| 126 | Ga0495605_0012496 | 3300046474 | Bacteria | 4708 |
| 127 | Ga0495605_0037504 | 3300046474 | Bacteria | 2437 |
| 128 | Ga0495584_0000606 | 3300046491 | Bacteria | 24016 |
| 129 | Ga0495584_0009106 | 3300046491 | Bacteria | 5126 |
| 130 | Ga0495584_0009755 | 3300046491 | Bacteria | 4938 |
| 131 | Ga0495584_0018020 | 3300046491 | Bacteria | 3589 |
| 132 | Ga0495584_0021778 | 3300046491 | Bacteria | 3254 |
| 133 | Ga0495584_0065109 | 3300046491 | Bacteria | 1833 |
| 134 | Ga0495584_0068960 | 3300046491 | Bacteria | 1776 |
| 135 | Ga0495584_0473455 | 3300046491 | Bacteria | 637 |
| 136 | Ga0495585_0004177 | 3300046492 | Bacteria | 9431 |
| 137 | Ga0495585_0006790 | 3300046492 | Bacteria | 7065 |
| 138 | Ga0495585_0007441 | 3300046492 | Bacteria | 6701 |
| 139 | Ga0495585_0020935 | 3300046492 | Bacteria | 3757 |
| 140 | Ga0495585_0066692 | 3300046492 | Bacteria | 1970 |
| 141 | Ga0495585_0152442 | 3300046492 | Bacteria | 1204 |
| 142 | Ga0495585_0167100 | 3300046492 | Bacteria | 1138 |
| 143 | Ga0495585_0431232 | 3300046492 | Unclassified | 632 |
| 144 | Ga0495594_0056351 | 3300046499 | Bacteria | 2168 |
| 145 | Ga0495596_0000526 | 3300046500 | Bacteria | 24051 |
| 146 | Ga0495596_0022201 | 3300046500 | Bacteria | 2585 |
| 147 | Ga0495596_0031295 | 3300046500 | Bacteria | 2126 |
| 148 | Ga0495596_0033697 | 3300046500 | Bacteria | 2037 |
| 149 | Ga0495596_0040285 | 3300046500 | Bacteria | 1844 |
| 150 | Ga0495607_0004232 | 3300046501 | Bacteria | 10642 |
| 151 | Ga0495607_0006406 | 3300046501 | Bacteria | 8291 |
| 152 | Ga0495607_0007881 | 3300046501 | Bacteria | 7327 |
| 153 | Ga0495607_0008031 | 3300046501 | Bacteria | 7246 |
| 154 | Ga0495607_0027290 | 3300046501 | Bacteria | 3532 |
| 155 | Ga0495607_0027424 | 3300046501 | Bacteria | 3522 |
| 156 | Ga0495583_0000816 | 3300046506 | Bacteria | 38101 |
| 157 | Ga0495583_0001071 | 3300046506 | Bacteria | 30564 |
| 158 | Ga0495583_0036460 | 3300046506 | Bacteria | 2339 |
| 159 | Ga0495583_0253260 | 3300046506 | Bacteria | 705 |
| 160 | Ga0495606_0004520 | 3300046507 | Bacteria | 13843 |
| 161 | Ga0495606_0062113 | 3300046507 | Bacteria | 2386 |
| 162 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 163 | Ga0495610_0000452 | 3300046512 | Bacteria | 42500 |
| 164 | Ga0495616_0007535 | 3300046513 | Bacteria | 6514 |
| 165 | Ga0495616_0008838 | 3300046513 | Bacteria | 5926 |
| 166 | Ga0495616_0037729 | 3300046513 | Bacteria | 2484 |
| 167 | Ga0495616_0039360 | 3300046513 | Bacteria | 2422 |
| 168 | Ga0495616_0049674 | 3300046513 | Bacteria | 2101 |
| 169 | Ga0495631_0001363 | 3300046518 | Bacteria | 14907 |
| 170 | Ga0495631_0018774 | 3300046518 | Bacteria | 3251 |
| 171 | Ga0495631_0053241 | 3300046518 | Bacteria | 1766 |
| 172 | Ga0495631_0058684 | 3300046518 | Bacteria | 1673 |
| 173 | Ga0495631_0063784 | 3300046518 | Bacteria | 1595 |
| 174 | Ga0495632_0002044 | 3300046519 | Bacteria | 15859 |
| 175 | Ga0495632_0014318 | 3300046519 | Bacteria | 4490 |
| 176 | Ga0495632_0023752 | 3300046519 | Bacteria | 3268 |
| 177 | Ga0495637_0000029 | 3300046520 | Bacteria | 143929 |
| 178 | Ga0495643_0005182 | 3300046522 | Bacteria | 8892 |
| 179 | Ga0495643_0011635 | 3300046522 | Bacteria | 5348 |
| 180 | Ga0495643_0037101 | 3300046522 | Bacteria | 2675 |
| 181 | Ga0495644_0006552 | 3300046523 | Bacteria | 4507 |
| 182 | Ga0495644_0008139 | 3300046523 | Bacteria | 4032 |
| 183 | Ga0495644_0085021 | 3300046523 | Bacteria | 1192 |
| 184 | Ga0495644_0208599 | 3300046523 | Unclassified | 754 |
| 185 | Ga0495648_0005153 | 3300046524 | Bacteria | 10931 |
| 186 | Ga0495648_0006062 | 3300046524 | Bacteria | 9921 |
| 187 | Ga0495642_0006484 | 3300046528 | Bacteria | 4490 |
| 188 | Ga0495642_0014315 | 3300046528 | Bacteria | 3072 |
| 189 | Ga0495642_0015678 | 3300046528 | Bacteria | 2948 |
| 190 | Ga0495642_0073336 | 3300046528 | Bacteria | 1434 |
| 191 | Ga0495642_0113800 | 3300046528 | Bacteria | 1158 |
| 192 | Ga0495642_0424523 | 3300046528 | Bacteria | 587 |
| 193 | Ga0495654_0016289 | 3300046530 | Bacteria | 3934 |
| 194 | Ga0495654_0186886 | 3300046530 | Bacteria | 894 |
| 195 | Ga0495609_0052589 | 3300046538 | Bacteria | 1812 |
| 196 | Ga0495609_0070287 | 3300046538 | Bacteria | 1539 |
| 197 | Ga0495609_0126426 | 3300046538 | Bacteria | 1097 |
| 198 | Ga0495597_0001116 | 3300046542 | Bacteria | 20304 |
| 199 | Ga0495597_0006469 | 3300046542 | Bacteria | 6060 |
| 200 | Ga0495622_0145193 | 3300046557 | Bacteria | 1075 |
| 201 | Ga0495633_0002345 | 3300046558 | Bacteria | 13449 |
| 202 | Ga0495633_0006109 | 3300046558 | Bacteria | 7213 |
| 203 | Ga0495633_0009595 | 3300046558 | Bacteria | 5333 |
| 204 | Ga0495633_0072997 | 3300046558 | Bacteria | 1599 |
| 205 | Ga0495633_0110965 | 3300046558 | Bacteria | 1271 |
| 206 | Ga0495633_0210177 | 3300046558 | Bacteria | 892 |
| 207 | Ga0495633_0243830 | 3300046558 | Bacteria | 820 |
| 208 | Ga0495633_0341911 | 3300046558 | Bacteria | 678 |
| 209 | Ga0495656_0180058 | 3300046615 | Bacteria | 1038 |
| 210 | Ga0495656_0536501 | 3300046615 | Bacteria | 623 |
| 211 | Ga0495656_0660039 | 3300046615 | Bacteria | 562 |
| 212 | Ga0495668_0000243 | 3300046616 | Bacteria | 77845 |
| 213 | Ga0495668_0000536 | 3300046616 | Bacteria | 47214 |
| 214 | Ga0495668_0000617 | 3300046616 | Bacteria | 43027 |
| 215 | Ga0495668_0009515 | 3300046616 | Bacteria | 5962 |
| 216 | Ga0495668_0011340 | 3300046616 | Bacteria | 5344 |
| 217 | Ga0495668_0012044 | 3300046616 | Bacteria | 5147 |
| 218 | Ga0495668_0020486 | 3300046616 | Bacteria | 3804 |
| 219 | Ga0495668_0027212 | 3300046616 | Bacteria | 3240 |
| 220 | Ga0495668_0230371 | 3300046616 | Bacteria | 1014 |
| 221 | Ga0495611_0000913 | 3300046648 | Bacteria | 15999 |
| 222 | Ga0495611_0005791 | 3300046648 | Bacteria | 5272 |
| 223 | Ga0495611_0022624 | 3300046648 | Bacteria | 2720 |
| 224 | Ga0495611_0083498 | 3300046648 | Bacteria | 1471 |
| 225 | Ga0495625_0061703 | 3300046660 | Bacteria | 2652 |
| 226 | Ga0495625_0175773 | 3300046660 | Bacteria | 1427 |
| 227 | Ga0495625_0227592 | 3300046660 | Bacteria | 1219 |
| 228 | Ga0495625_0502083 | 3300046660 | Bacteria | 741 |
| 229 | Ga0495661_0007189 | 3300046665 | Bacteria | 7768 |
| 230 | Ga0495661_0010783 | 3300046665 | Bacteria | 6220 |
| 231 | Ga0495661_0012739 | 3300046665 | Bacteria | 5674 |
| 232 | Ga0495661_0015541 | 3300046665 | Bacteria | 5079 |
| 233 | Ga0495661_0023434 | 3300046665 | Bacteria | 4008 |
| 234 | Ga0495661_0046874 | 3300046665 | Bacteria | 2635 |
| 235 | Ga0495661_0052312 | 3300046665 | Bacteria | 2461 |
| 236 | Ga0495661_0073877 | 3300046665 | Bacteria | 1985 |
| 237 | Ga0495661_0235653 | 3300046665 | Bacteria | 941 |
| 238 | Ga0495661_0250403 | 3300046665 | Bacteria | 904 |
| 239 | Ga0495661_0376444 | 3300046665 | Bacteria | 694 |
| 240 | Ga0495588_0098175 | 3300046674 | Bacteria | 1537 |
| 241 | Ga0495588_0163637 | 3300046674 | Bacteria | 1176 |
| 242 | Ga0495669_0014048 | 3300046684 | Bacteria | 3421 |
| 243 | Ga0495669_0072365 | 3300046684 | Bacteria | 1573 |
| 244 | Ga0495669_0213339 | 3300046684 | Bacteria | 924 |
| 245 | Ga0495613_0362001 | 3300046689 | Bacteria | 994 |
| 246 | Ga0495670_0007485 | 3300046691 | Bacteria | 5365 |
| 247 | Ga0495670_0014215 | 3300046691 | Bacteria | 3916 |
| 248 | Ga0495670_0020263 | 3300046691 | Bacteria | 3278 |
| 249 | Ga0495670_0032321 | 3300046691 | Bacteria | 2602 |
| 250 | Ga0495670_0044471 | 3300046691 | Bacteria | 2217 |
| 251 | Ga0495670_0170361 | 3300046691 | Bacteria | 1146 |
| 252 | Ga0495670_0224853 | 3300046691 | Bacteria | 997 |
| 253 | Ga0495670_0272405 | 3300046691 | Bacteria | 904 |
| 254 | Ga0495671_0006970 | 3300046692 | Bacteria | 6480 |
| 255 | Ga0495671_0007895 | 3300046692 | Bacteria | 6018 |
| 256 | Ga0495671_0018698 | 3300046692 | Bacteria | 3674 |
| 257 | Ga0495671_0063855 | 3300046692 | Bacteria | 1813 |
| 258 | Ga0495671_0116039 | 3300046692 | Bacteria | 1307 |
| 259 | Ga0495671_0149616 | 3300046692 | Bacteria | 1137 |
| 260 | Ga0495649_0000243 | 3300046694 | Bacteria | 48016 |
| 261 | Ga0495649_0001732 | 3300046694 | Bacteria | 16121 |
| 262 | Ga0495649_0013755 | 3300046694 | Bacteria | 4659 |
| 263 | Ga0495649_0028285 | 3300046694 | Bacteria | 3107 |
| 264 | Ga0495649_0093249 | 3300046694 | Bacteria | 1603 |
| 265 | Ga0495649_0208838 | 3300046694 | Bacteria | 1012 |
| 266 | Ga0495589_0001411 | 3300046794 | Bacteria | 13927 |
| 267 | Ga0495589_0005145 | 3300046794 | Bacteria | 6921 |
| 268 | Ga0495589_0013837 | 3300046794 | Bacteria | 4160 |
| 269 | Ga0495589_0043927 | 3300046794 | Bacteria | 2224 |
| 270 | Ga0495660_0004430 | 3300046810 | Bacteria | 8494 |
| 271 | Ga0495660_0008583 | 3300046810 | Bacteria | 5979 |
| 272 | Ga0495660_0027189 | 3300046810 | Bacteria | 3237 |
| 273 | Ga0495660_0249292 | 3300046810 | Bacteria | 824 |
| 274 | Ga0495581_0049624 | 3300047315 | Bacteria | 2423 |
| 275 | Ga0495672_0000175 | 3300047320 | Bacteria | 93127 |
| 276 | Ga0495672_0004423 | 3300047320 | Bacteria | 11518 |
| 277 | Ga0495672_0129208 | 3300047320 | Bacteria | 1331 |
| 278 | Ga0495683_0000379 | 3300047323 | Bacteria | 36310 |
| 279 | Ga0495683_0001668 | 3300047323 | Bacteria | 14159 |
| 280 | Ga0495683_0025030 | 3300047323 | Bacteria | 3060 |
| 281 | Ga0495683_0219140 | 3300047323 | Bacteria | 849 |
| 282 | Ga0495687_204280 | 3300047443 | Bacteria | 624 |
| 283 | Ga0495687_207131 | 3300047443 | Bacteria | 618 |
| 284 | Ga0495677_0000159 | 3300047445 | Bacteria | 32329 |
| 285 | Ga0495677_0000788 | 3300047445 | Bacteria | 12782 |
| 286 | Ga0495677_0008007 | 3300047445 | Bacteria | 3927 |
| 287 | Ga0495677_0009108 | 3300047445 | Bacteria | 3669 |
| 288 | Ga0495677_0052763 | 3300047445 | Bacteria | 1498 |
| 289 | Ga0495679_006720 | 3300047446 | Bacteria | 4907 |
| 290 | Ga0495679_012864 | 3300047446 | Bacteria | 3166 |
| 291 | Ga0495679_052927 | 3300047446 | Bacteria | 1213 |
| 292 | Ga0495685_109868 | 3300047447 | Bacteria | 908 |
| 293 | Ga0495685_212197 | 3300047447 | Bacteria | 619 |
| 294 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 295 | Ga0495681_0001208 | 3300047470 | Bacteria | 19632 |
| 296 | Ga0495681_0002749 | 3300047470 | Bacteria | 12452 |
| 297 | Ga0495681_0008789 | 3300047470 | Bacteria | 6292 |
| 298 | Ga0495681_0011118 | 3300047470 | Bacteria | 5394 |
| 299 | Ga0495681_0034154 | 3300047470 | Bacteria | 2537 |
| 300 | Ga0495681_0039822 | 3300047470 | Bacteria | 2292 |
| 301 | Ga0495681_0058307 | 3300047470 | Bacteria | 1789 |
| 302 | Ga0495681_0278799 | 3300047470 | Bacteria | 652 |
| 303 | Ga0495686_0007527 | 3300047472 | Bacteria | 8154 |
| 304 | Ga0495686_0008204 | 3300047472 | Bacteria | 7701 |
| 305 | Ga0495686_0215748 | 3300047472 | Bacteria | 1094 |
| 306 | Ga0495614_0005443 | 3300048089 | Bacteria | 5739 |
| 307 | Ga0495626_0000003 | 3300048091 | Bacteria | 427774 |
| 308 | Ga0495626_0020586 | 3300048091 | Bacteria | 3284 |
| 309 | Ga0495626_0030025 | 3300048091 | Bacteria | 2623 |
| 310 | Ga0495626_0039825 | 3300048091 | Bacteria | 2221 |
| 311 | Ga0495626_0101528 | 3300048091 | Bacteria | 1253 |
| 312 | Ga0496102_0024270 | 3300048905 | Bacteria | 5390 |
| 313 | Ga0496102_0100742 | 3300048905 | Bacteria | 2683 |
| 314 | Ga0496102_0405951 | 3300048905 | Bacteria | 1280 |
| 315 | Ga0496102_1193474 | 3300048905 | Bacteria | 680 |
| 316 | Ga0496103_0161412 | 3300048906 | Bacteria | 1437 |
| 317 | Ga0496104_0034394 | 3300048907 | Bacteria | 4726 |
| 318 | Ga0496105_0024799 | 3300048908 | Bacteria | 4875 |
| 319 | Ga0496107_0230202 | 3300048910 | Bacteria | 1379 |
| 320 | Ga0496108_0304307 | 3300048911 | Bacteria | 1389 |
| 321 | Ga0496109_0229320 | 3300048912 | Bacteria | 1747 |
| 322 | Ga0496109_0455874 | 3300048912 | Bacteria | 1208 |
| 323 | Ga0496110_0000454 | 3300048913 | Bacteria | 27858 |
| 324 | Ga0496110_0248272 | 3300048913 | Bacteria | 1620 |
| 325 | Ga0496110_1371646 | 3300048913 | Bacteria | 616 |
| 326 | Ga0496111_0029894 | 3300048914 | Bacteria | 3872 |
| 327 | Ga0496112_1417849 | 3300048915 | Bacteria | 609 |
| 328 | Ga0496113_0037548 | 3300048916 | Bacteria | 3556 |
| 329 | Ga0496115_0040367 | 3300048918 | Bacteria | 3710 |
| 330 | Ga0496117_0044917 | 3300048920 | Bacteria | 3196 |
| 331 | Ga0496118_0001363 | 3300048921 | Bacteria | 36814 |
| 332 | Ga0496119_0000158 | 3300048922 | Bacteria | 93884 |
| 333 | Ga0496120_0000268 | 3300048923 | Bacteria | 86899 |
| 334 | Ga0496121_0086607 | 3300048924 | Bacteria | 2461 |
| 335 | Ga0496121_0169800 | 3300048924 | Bacteria | 1586 |
| 336 | Ga0496122_0002477 | 3300048925 | Bacteria | 26088 |
| 337 | Ga0496123_0045843 | 3300048926 | Bacteria | 2973 |
| 338 | Ga0496123_0203334 | 3300048926 | Bacteria | 1013 |
| 339 | Ga0496124_0004271 | 3300048927 | Bacteria | 16806 |
| 340 | Ga0496124_0079365 | 3300048927 | Bacteria | 2703 |
| 341 | Ga0496124_0091461 | 3300048927 | Bacteria | 2479 |
| 342 | Ga0496124_0123863 | 3300048927 | Bacteria | 2062 |
| 343 | Ga0496124_0128108 | 3300048927 | Bacteria | 2020 |
| 344 | Ga0496125_0190755 | 3300048928 | Bacteria | 1353 |
| 345 | Ga0496125_0287098 | 3300048928 | Bacteria | 1015 |
| 346 | Ga0495678_000194 | 3300049459 | Bacteria | 71366 |
| 347 | Ga0495678_010953 | 3300049459 | Bacteria | 4369 |
| 348 | Ga0495678_186395 | 3300049459 | Bacteria | 647 |
| 349 | Ga0495682_0007313 | 3300049460 | Bacteria | 4404 |
| 350 | Ga0501227_006447 | 3300049665 | Bacteria | 2523 |
| 351 | Ga0501263_008537 | 3300049760 | Bacteria | 1225 |
| 352 | nmdc:mga06r32_127624_c1 | 3300050510 | Bacteria | 2513 |
| 353 | nmdc:mga06r32_228629_c1 | 3300050510 | Unclassified | 1848 |
| 354 | Ga0500646_0036255 | 3300053090 | Bacteria | 1373 |
| 355 | Ga0500651_0704104 | 3300053093 | Bacteria | 540 |
| 356 | Ga0500618_009739 | 3300053125 | Bacteria | 2612 |
| 357 | Ga0500586_005495 | 3300053145 | Bacteria | 3212 |
| 358 | Ga0500661_029912 | 3300055283 | Unclassified | 961 |
| 359 | Ga0466962_0203579 | 3300061719 | Bacteria | 967 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2643221554 | 2643787556 | 103 |
| 2 | iso_pu_bacteria | 2643221638 | 2644213581 | 103 |
| 3 | iso_pu_bacteria | 2808606418 | 2809147320 | 103 |
| 4 | 3300026035 | Ga0207703_11091577 | Ga0207703_110915772 | 104 |
| 5 | iso_pu_bacteria | 2593339239 | 2595449572 | 105 |
| 6 | 3300005327 | Ga0070658_10000546 | Ga0070658_1000054623 | 106 |
| 7 | 3300005335 | Ga0070666_10000034 | Ga0070666_10000034117 | 106 |
| 8 | 3300005344 | Ga0070661_100029530 | Ga0070661_1000295302 | 106 |
| 9 | 3300005347 | Ga0070668_100367777 | Ga0070668_1003677772 | 106 |
| 10 | 3300005367 | Ga0070667_100011325 | Ga0070667_1000113255 | 106 |
| 11 | 3300005455 | Ga0070663_100460895 | Ga0070663_1004608952 | 106 |
| 12 | 3300005466 | Ga0070685_10393211 | Ga0070685_103932111 | 106 |
| 13 | 3300005548 | Ga0070665_100099630 | Ga0070665_1000996305 | 106 |
| 14 | 3300005842 | Ga0068858_101356559 | Ga0068858_1013565592 | 106 |
| 15 | 3300005844 | Ga0068862_100370425 | Ga0068862_1003704252 | 106 |
| 16 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005241 | 106 |
| 17 | 3300025924 | Ga0207694_10001082 | Ga0207694_1000108214 | 106 |
| 18 | 3300025972 | Ga0207668_10335481 | Ga0207668_103354812 | 106 |
| 19 | 3300025986 | Ga0207658_10022917 | Ga0207658_100229176 | 106 |
| 20 | 3300028379 | Ga0268266_10000004 | Ga0268266_100000041284 | 106 |
| 21 | 3300028380 | Ga0268265_10630740 | Ga0268265_106307402 | 106 |
| 22 | 3300028381 | Ga0268264_10077667 | Ga0268264_100776672 | 106 |
| 23 | 3300033180 | Ga0307510_10001111 | Ga0307510_1000111119 | 106 |
| 24 | 3300053090 | Ga0500646_0036255 | Ga0500646_0036255_264_593 | 106 |
| 25 | 3300002987 | JGI25159J45721_1000552 | JGI25159J45721_10005527 | 107 |
| 26 | 3300003320 | rootH2_10122097 | rootH2_101220974 | 107 |
| 27 | 3300003374 | JGI25161J50226_1000465 | JGI25161J50226_100046519 | 107 |
| 28 | 3300003759 | Ga0055525_1000074 | Ga0055525_100007478 | 107 |
| 29 | 3300003771 | Ga0055526_1005722 | Ga0055526_10057227 | 107 |
| 30 | 3300003773 | Ga0055537_1005650 | Ga0055537_10056507 | 107 |
| 31 | 3300003773 | Ga0055537_1008145 | Ga0055537_10081453 | 107 |
| 32 | 3300003775 | Ga0055524_1000716 | Ga0055524_100071619 | 107 |
| 33 | 3300003775 | Ga0055524_1001141 | Ga0055524_100114114 | 107 |
| 34 | 3300003775 | Ga0055524_1001903 | Ga0055524_100190310 | 107 |
| 35 | 3300003791 | Ga0055530_10001313 | Ga0055530_100013135 | 107 |
| 36 | 3300003791 | Ga0055530_10001696 | Ga0055530_100016963 | 107 |
| 37 | 3300004625 | Ga0055543_1000222 | Ga0055543_100022225 | 107 |
| 38 | 3300005262 | Ga0065165_1000710 | Ga0065165_100071024 | 107 |
| 39 | 3300005262 | Ga0065165_1001411 | Ga0065165_100141112 | 107 |
| 40 | 3300005262 | Ga0065165_1041145 | Ga0065165_10411451 | 107 |
| 41 | 3300005530 | Ga0070679_100346375 | Ga0070679_1003463752 | 107 |
| 42 | 3300005563 | Ga0068855_100634945 | Ga0068855_1006349452 | 107 |
| 43 | 3300013306 | Ga0163162_10320135 | Ga0163162_103201352 | 107 |
| 44 | 3300013307 | Ga0157372_10704521 | Ga0157372_107045212 | 107 |
| 45 | 3300025208 | Ga0209436_100375 | Ga0209436_1003759 | 107 |
| 46 | 3300025230 | Ga0209563_100003 | Ga0209563_10000376 | 107 |
| 47 | 3300025263 | Ga0209565_1002163 | Ga0209565_10021632 | 107 |
| 48 | 3300025263 | Ga0209565_1005249 | Ga0209565_10052492 | 107 |
| 49 | 3300025263 | Ga0209565_1014369 | Ga0209565_10143692 | 107 |
| 50 | 3300025273 | Ga0209673_1111532 | Ga0209673_11115321 | 107 |
| 51 | 3300025284 | Ga0209130_1000474 | Ga0209130_100047425 | 107 |
| 52 | 3300025291 | Ga0209675_1001523 | Ga0209675_10015234 | 107 |
| 53 | 3300025295 | Ga0209564_1000134 | Ga0209564_100013458 | 107 |
| 54 | 3300025298 | Ga0209050_1000092 | Ga0209050_100009258 | 107 |
| 55 | 3300025299 | Ga0209256_1000706 | Ga0209256_100070615 | 107 |
| 56 | 3300025909 | Ga0207705_10755738 | Ga0207705_107557381 | 107 |
| 57 | 3300025949 | Ga0207667_11313046 | Ga0207667_113130462 | 107 |
| 58 | 3300031548 | Ga0307408_100000094 | Ga0307408_10000009432 | 107 |
| 59 | 3300031548 | Ga0307408_100008980 | Ga0307408_1000089804 | 107 |
| 60 | 3300031548 | Ga0307408_100031037 | Ga0307408_1000310372 | 107 |
| 61 | 3300037312 | Ga0395899_0020607 | Ga0395899_0020607_1460_1783 | 107 |
| 62 | 3300037418 | Ga0395900_0006527 | Ga0395900_0006527_5705_6028 | 107 |
| 63 | 3300037466 | Ga0395898_0365455 | Ga0395898_0365455_498_821 | 107 |
| 64 | 3300037471 | Ga0395905_0000111 | Ga0395905_0000111_78131_78454 | 107 |
| 65 | 3300037471 | Ga0395905_0268348 | Ga0395905_0268348_893_1216 | 107 |
| 66 | 3300038443 | Ga0395901_0480951 | Ga0395901_0480951_536_859 | 107 |
| 67 | 3300038443 | Ga0395901_0698251 | Ga0395901_0698251_598_921 | 107 |
| 68 | 3300038443 | Ga0395901_2003967 | Ga0395901_2003967_108_431 | 107 |
| 69 | 3300044683 | Ga0466965_0170210 | Ga0466965_0170210_698_1114 | 107 |
| 70 | 3300044684 | Ga0466966_0005816 | Ga0466966_0005816_2338_2661 | 107 |
| 71 | 3300044693 | Ga0466961_0121628 | Ga0466961_0121628_987_1310 | 107 |
| 72 | 3300044719 | Ga0466971_0105700 | Ga0466971_0105700_141_464 | 107 |
| 73 | 3300046452 | Ga0495617_015864 | Ga0495617_015864_959_1282 | 107 |
| 74 | 3300046455 | Ga0495603_0080820 | Ga0495603_0080820_1003_1326 | 107 |
| 75 | 3300046457 | Ga0495590_0000179 | Ga0495590_0000179_14031_14354 | 107 |
| 76 | 3300046457 | Ga0495590_0193470 | Ga0495590_0193470_101_427 | 107 |
| 77 | 3300046457 | Ga0495590_0284631 | Ga0495590_0284631_47_370 | 107 |
| 78 | 3300046458 | Ga0495591_000127 | Ga0495591_000127_22974_23297 | 107 |
| 79 | 3300046459 | Ga0495629_0019974 | Ga0495629_0019974_46_369 | 107 |
| 80 | 3300046471 | Ga0495650_0002151 | Ga0495650_0002151_12322_12678 | 107 |
| 81 | 3300046471 | Ga0495650_0011779 | Ga0495650_0011779_2844_3167 | 107 |
| 82 | 3300046471 | Ga0495650_0058859 | Ga0495650_0058859_102_425 | 107 |
| 83 | 3300046473 | Ga0495582_0013147 | Ga0495582_0013147_2735_3058 | 107 |
| 84 | 3300046474 | Ga0495605_0000022 | Ga0495605_0000022_106182_106505 | 107 |
| 85 | 3300046474 | Ga0495605_0008843 | Ga0495605_0008843_4012_4335 | 107 |
| 86 | 3300046474 | Ga0495605_0009786 | Ga0495605_0009786_3016_3339 | 107 |
| 87 | 3300046474 | Ga0495605_0012496 | Ga0495605_0012496_1972_2295 | 107 |
| 88 | 3300046474 | Ga0495605_0037504 | Ga0495605_0037504_325_648 | 107 |
| 89 | 3300046491 | Ga0495584_0000606 | Ga0495584_0000606_20671_20994 | 107 |
| 90 | 3300046491 | Ga0495584_0009755 | Ga0495584_0009755_3273_3596 | 107 |
| 91 | 3300046491 | Ga0495584_0065109 | Ga0495584_0065109_705_1031 | 107 |
| 92 | 3300046491 | Ga0495584_0068960 | Ga0495584_0068960_549_872 | 107 |
| 93 | 3300046491 | Ga0495584_0473455 | Ga0495584_0473455_146_469 | 107 |
| 94 | 3300046492 | Ga0495585_0004177 | Ga0495585_0004177_5815_6138 | 107 |
| 95 | 3300046492 | Ga0495585_0020935 | Ga0495585_0020935_2092_2415 | 107 |
| 96 | 3300046492 | Ga0495585_0066692 | Ga0495585_0066692_445_768 | 107 |
| 97 | 3300046492 | Ga0495585_0152442 | Ga0495585_0152442_75_437 | 107 |
| 98 | 3300046492 | Ga0495585_0167100 | Ga0495585_0167100_393_719 | 107 |
| 99 | 3300046499 | Ga0495594_0056351 | Ga0495594_0056351_1003_1326 | 107 |
| 100 | 3300046500 | Ga0495596_0000526 | Ga0495596_0000526_18337_18660 | 107 |
| 101 | 3300046500 | Ga0495596_0022201 | Ga0495596_0022201_975_1298 | 107 |
| 102 | 3300046500 | Ga0495596_0031295 | Ga0495596_0031295_897_1220 | 107 |
| 103 | 3300046500 | Ga0495596_0033697 | Ga0495596_0033697_1702_2025 | 107 |
| 104 | 3300046500 | Ga0495596_0040285 | Ga0495596_0040285_460_783 | 107 |
| 105 | 3300046501 | Ga0495607_0004232 | Ga0495607_0004232_9163_9546 | 107 |
| 106 | 3300046501 | Ga0495607_0006406 | Ga0495607_0006406_2357_2680 | 107 |
| 107 | 3300046501 | Ga0495607_0007881 | Ga0495607_0007881_3632_3955 | 107 |
| 108 | 3300046501 | Ga0495607_0008031 | Ga0495607_0008031_954_1277 | 107 |
| 109 | 3300046501 | Ga0495607_0027290 | Ga0495607_0027290_2834_3157 | 107 |
| 110 | 3300046501 | Ga0495607_0027424 | Ga0495607_0027424_2391_2714 | 107 |
| 111 | 3300046506 | Ga0495583_0000816 | Ga0495583_0000816_3005_3328 | 107 |
| 112 | 3300046506 | Ga0495583_0001071 | Ga0495583_0001071_4823_5146 | 107 |
| 113 | 3300046506 | Ga0495583_0036460 | Ga0495583_0036460_233_595 | 107 |
| 114 | 3300046506 | Ga0495583_0253260 | Ga0495583_0253260_266_589 | 107 |
| 115 | 3300046507 | Ga0495606_0062113 | Ga0495606_0062113_136_459 | 107 |
| 116 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_525170_525526 | 107 |
| 117 | 3300046512 | Ga0495610_0000452 | Ga0495610_0000452_14316_14639 | 107 |
| 118 | 3300046513 | Ga0495616_0007535 | Ga0495616_0007535_500_883 | 107 |
| 119 | 3300046513 | Ga0495616_0008838 | Ga0495616_0008838_2500_2823 | 107 |
| 120 | 3300046513 | Ga0495616_0037729 | Ga0495616_0037729_677_1000 | 107 |
| 121 | 3300046513 | Ga0495616_0039360 | Ga0495616_0039360_756_1079 | 107 |
| 122 | 3300046513 | Ga0495616_0049674 | Ga0495616_0049674_874_1197 | 107 |
| 123 | 3300046518 | Ga0495631_0001363 | Ga0495631_0001363_11440_11763 | 107 |
| 124 | 3300046518 | Ga0495631_0018774 | Ga0495631_0018774_2034_2357 | 107 |
| 125 | 3300046518 | Ga0495631_0053241 | Ga0495631_0053241_601_924 | 107 |
| 126 | 3300046518 | Ga0495631_0058684 | Ga0495631_0058684_890_1213 | 107 |
| 127 | 3300046519 | Ga0495632_0002044 | Ga0495632_0002044_6570_6953 | 107 |
| 128 | 3300046519 | Ga0495632_0014318 | Ga0495632_0014318_3814_4137 | 107 |
| 129 | 3300046519 | Ga0495632_0023752 | Ga0495632_0023752_381_704 | 107 |
| 130 | 3300046520 | Ga0495637_0000029 | Ga0495637_0000029_23415_23738 | 107 |
| 131 | 3300046522 | Ga0495643_0005182 | Ga0495643_0005182_2910_3233 | 107 |
| 132 | 3300046522 | Ga0495643_0011635 | Ga0495643_0011635_3939_4262 | 107 |
| 133 | 3300046522 | Ga0495643_0037101 | Ga0495643_0037101_1899_2222 | 107 |
| 134 | 3300046523 | Ga0495644_0006552 | Ga0495644_0006552_1386_1709 | 107 |
| 135 | 3300046523 | Ga0495644_0008139 | Ga0495644_0008139_3334_3657 | 107 |
| 136 | 3300046523 | Ga0495644_0085021 | Ga0495644_0085021_46_369 | 107 |
| 137 | 3300046524 | Ga0495648_0005153 | Ga0495648_0005153_2480_2803 | 107 |
| 138 | 3300046524 | Ga0495648_0006062 | Ga0495648_0006062_1230_1586 | 107 |
| 139 | 3300046528 | Ga0495642_0006484 | Ga0495642_0006484_1014_1337 | 107 |
| 140 | 3300046528 | Ga0495642_0014315 | Ga0495642_0014315_1716_2039 | 107 |
| 141 | 3300046528 | Ga0495642_0015678 | Ga0495642_0015678_339_662 | 107 |
| 142 | 3300046528 | Ga0495642_0424523 | Ga0495642_0424523_62_385 | 107 |
| 143 | 3300046530 | Ga0495654_0016289 | Ga0495654_0016289_2624_2947 | 107 |
| 144 | 3300046530 | Ga0495654_0186886 | Ga0495654_0186886_421_744 | 107 |
| 145 | 3300046538 | Ga0495609_0052589 | Ga0495609_0052589_1160_1483 | 107 |
| 146 | 3300046538 | Ga0495609_0070287 | Ga0495609_0070287_479_805 | 107 |
| 147 | 3300046538 | Ga0495609_0126426 | Ga0495609_0126426_265_588 | 107 |
| 148 | 3300046542 | Ga0495597_0001116 | Ga0495597_0001116_19191_19514 | 107 |
| 149 | 3300046542 | Ga0495597_0006469 | Ga0495597_0006469_1168_1491 | 107 |
| 150 | 3300046557 | Ga0495622_0145193 | Ga0495622_0145193_46_369 | 107 |
| 151 | 3300046558 | Ga0495633_0002345 | Ga0495633_0002345_8845_9168 | 107 |
| 152 | 3300046558 | Ga0495633_0009595 | Ga0495633_0009595_2804_3127 | 107 |
| 153 | 3300046558 | Ga0495633_0072997 | Ga0495633_0072997_434_757 | 107 |
| 154 | 3300046558 | Ga0495633_0110965 | Ga0495633_0110965_713_1036 | 107 |
| 155 | 3300046558 | Ga0495633_0210177 | Ga0495633_0210177_220_582 | 107 |
| 156 | 3300046558 | Ga0495633_0341911 | Ga0495633_0341911_335_658 | 107 |
| 157 | 3300046615 | Ga0495656_0660039 | Ga0495656_0660039_74_397 | 107 |
| 158 | 3300046616 | Ga0495668_0000617 | Ga0495668_0000617_5906_6262 | 107 |
| 159 | 3300046616 | Ga0495668_0011340 | Ga0495668_0011340_1884_2207 | 107 |
| 160 | 3300046616 | Ga0495668_0012044 | Ga0495668_0012044_4694_5017 | 107 |
| 161 | 3300046616 | Ga0495668_0020486 | Ga0495668_0020486_1098_1421 | 107 |
| 162 | 3300046616 | Ga0495668_0027212 | Ga0495668_0027212_1613_1936 | 107 |
| 163 | 3300046616 | Ga0495668_0230371 | Ga0495668_0230371_332_655 | 107 |
| 164 | 3300046648 | Ga0495611_0000913 | Ga0495611_0000913_3109_3432 | 107 |
| 165 | 3300046648 | Ga0495611_0005791 | Ga0495611_0005791_2826_3149 | 107 |
| 166 | 3300046648 | Ga0495611_0083498 | Ga0495611_0083498_1011_1334 | 107 |
| 167 | 3300046660 | Ga0495625_0175773 | Ga0495625_0175773_515_838 | 107 |
| 168 | 3300046660 | Ga0495625_0227592 | Ga0495625_0227592_117_473 | 107 |
| 169 | 3300046660 | Ga0495625_0502083 | Ga0495625_0502083_185_508 | 107 |
| 170 | 3300046665 | Ga0495661_0007189 | Ga0495661_0007189_3010_3333 | 107 |
| 171 | 3300046665 | Ga0495661_0010783 | Ga0495661_0010783_5057_5440 | 107 |
| 172 | 3300046665 | Ga0495661_0015541 | Ga0495661_0015541_1693_2016 | 107 |
| 173 | 3300046665 | Ga0495661_0046874 | Ga0495661_0046874_1470_1793 | 107 |
| 174 | 3300046665 | Ga0495661_0052312 | Ga0495661_0052312_105_428 | 107 |
| 175 | 3300046665 | Ga0495661_0073877 | Ga0495661_0073877_814_1137 | 107 |
| 176 | 3300046665 | Ga0495661_0235653 | Ga0495661_0235653_110_433 | 107 |
| 177 | 3300046665 | Ga0495661_0250403 | Ga0495661_0250403_145_468 | 107 |
| 178 | 3300046665 | Ga0495661_0376444 | Ga0495661_0376444_44_400 | 107 |
| 179 | 3300046674 | Ga0495588_0098175 | Ga0495588_0098175_856_1179 | 107 |
| 180 | 3300046674 | Ga0495588_0163637 | Ga0495588_0163637_405_728 | 107 |
| 181 | 3300046684 | Ga0495669_0014048 | Ga0495669_0014048_2889_3212 | 107 |
| 182 | 3300046684 | Ga0495669_0072365 | Ga0495669_0072365_80_403 | 107 |
| 183 | 3300046684 | Ga0495669_0213339 | Ga0495669_0213339_303_626 | 107 |
| 184 | 3300046689 | Ga0495613_0362001 | Ga0495613_0362001_146_469 | 107 |
| 185 | 3300046691 | Ga0495670_0014215 | Ga0495670_0014215_2124_2447 | 107 |
| 186 | 3300046691 | Ga0495670_0032321 | Ga0495670_0032321_110_433 | 107 |
| 187 | 3300046691 | Ga0495670_0044471 | Ga0495670_0044471_1226_1549 | 107 |
| 188 | 3300046692 | Ga0495671_0006970 | Ga0495671_0006970_5522_5845 | 107 |
| 189 | 3300046692 | Ga0495671_0007895 | Ga0495671_0007895_889_1212 | 107 |
| 190 | 3300046692 | Ga0495671_0063855 | Ga0495671_0063855_392_748 | 107 |
| 191 | 3300046692 | Ga0495671_0149616 | Ga0495671_0149616_128_451 | 107 |
| 192 | 3300046694 | Ga0495649_0000243 | Ga0495649_0000243_43250_43573 | 107 |
| 193 | 3300046694 | Ga0495649_0001732 | Ga0495649_0001732_11723_12046 | 107 |
| 194 | 3300046694 | Ga0495649_0013755 | Ga0495649_0013755_4114_4437 | 107 |
| 195 | 3300046694 | Ga0495649_0093249 | Ga0495649_0093249_183_506 | 107 |
| 196 | 3300046694 | Ga0495649_0208838 | Ga0495649_0208838_208_531 | 107 |
| 197 | 3300046794 | Ga0495589_0001411 | Ga0495589_0001411_10496_10819 | 107 |
| 198 | 3300046794 | Ga0495589_0005145 | Ga0495589_0005145_5163_5486 | 107 |
| 199 | 3300046794 | Ga0495589_0013837 | Ga0495589_0013837_825_1148 | 107 |
| 200 | 3300046794 | Ga0495589_0043927 | Ga0495589_0043927_600_923 | 107 |
| 201 | 3300046810 | Ga0495660_0004430 | Ga0495660_0004430_291_647 | 107 |
| 202 | 3300046810 | Ga0495660_0008583 | Ga0495660_0008583_4519_4842 | 107 |
| 203 | 3300046810 | Ga0495660_0027189 | Ga0495660_0027189_2039_2362 | 107 |
| 204 | 3300046810 | Ga0495660_0249292 | Ga0495660_0249292_221_544 | 107 |
| 205 | 3300047315 | Ga0495581_0049624 | Ga0495581_0049624_1540_1863 | 107 |
| 206 | 3300047320 | Ga0495672_0000175 | Ga0495672_0000175_22903_23226 | 107 |
| 207 | 3300047320 | Ga0495672_0004423 | Ga0495672_0004423_2685_3008 | 107 |
| 208 | 3300047320 | Ga0495672_0129208 | Ga0495672_0129208_214_537 | 107 |
| 209 | 3300047323 | Ga0495683_0000379 | Ga0495683_0000379_13581_13904 | 107 |
| 210 | 3300047323 | Ga0495683_0025030 | Ga0495683_0025030_1099_1422 | 107 |
| 211 | 3300047323 | Ga0495683_0219140 | Ga0495683_0219140_133_456 | 107 |
| 212 | 3300047443 | Ga0495687_207131 | Ga0495687_207131_120_446 | 107 |
| 213 | 3300047445 | Ga0495677_0000159 | Ga0495677_0000159_13866_14189 | 107 |
| 214 | 3300047445 | Ga0495677_0000788 | Ga0495677_0000788_7555_7878 | 107 |
| 215 | 3300047445 | Ga0495677_0008007 | Ga0495677_0008007_1333_1656 | 107 |
| 216 | 3300047445 | Ga0495677_0009108 | Ga0495677_0009108_738_1061 | 107 |
| 217 | 3300047446 | Ga0495679_006720 | Ga0495679_006720_3509_3832 | 107 |
| 218 | 3300047446 | Ga0495679_012864 | Ga0495679_012864_2775_3098 | 107 |
| 219 | 3300047446 | Ga0495679_052927 | Ga0495679_052927_530_853 | 107 |
| 220 | 3300047447 | Ga0495685_109868 | Ga0495685_109868_222_545 | 107 |
| 221 | 3300047447 | Ga0495685_212197 | Ga0495685_212197_87_410 | 107 |
| 222 | 3300047469 | Ga0495673_0000017 | Ga0495673_0000017_195137_195493 | 107 |
| 223 | 3300047470 | Ga0495681_0001208 | Ga0495681_0001208_4399_4722 | 107 |
| 224 | 3300047470 | Ga0495681_0002749 | Ga0495681_0002749_7086_7409 | 107 |
| 225 | 3300047470 | Ga0495681_0008789 | Ga0495681_0008789_39_362 | 107 |
| 226 | 3300047470 | Ga0495681_0011118 | Ga0495681_0011118_3145_3468 | 107 |
| 227 | 3300047470 | Ga0495681_0034154 | Ga0495681_0034154_71_394 | 107 |
| 228 | 3300047470 | Ga0495681_0039822 | Ga0495681_0039822_469_792 | 107 |
| 229 | 3300047470 | Ga0495681_0278799 | Ga0495681_0278799_206_529 | 107 |
| 230 | 3300047472 | Ga0495686_0007527 | Ga0495686_0007527_4927_5250 | 107 |
| 231 | 3300047472 | Ga0495686_0215748 | Ga0495686_0215748_369_692 | 107 |
| 232 | 3300048089 | Ga0495614_0005443 | Ga0495614_0005443_3145_3468 | 107 |
| 233 | 3300048091 | Ga0495626_0000003 | Ga0495626_0000003_203853_204176 | 107 |
| 234 | 3300048091 | Ga0495626_0020586 | Ga0495626_0020586_1296_1619 | 107 |
| 235 | 3300048091 | Ga0495626_0030025 | Ga0495626_0030025_376_699 | 107 |
| 236 | 3300048091 | Ga0495626_0039825 | Ga0495626_0039825_1029_1352 | 107 |
| 237 | 3300048091 | Ga0495626_0101528 | Ga0495626_0101528_545_868 | 107 |
| 238 | 3300048905 | Ga0496102_0100742 | Ga0496102_0100742_361_684 | 107 |
| 239 | 3300048905 | Ga0496102_0405951 | Ga0496102_0405951_753_1076 | 107 |
| 240 | 3300048905 | Ga0496102_1193474 | Ga0496102_1193474_14_337 | 107 |
| 241 | 3300048906 | Ga0496103_0161412 | Ga0496103_0161412_636_959 | 107 |
| 242 | 3300048910 | Ga0496107_0230202 | Ga0496107_0230202_748_1071 | 107 |
| 243 | 3300048911 | Ga0496108_0304307 | Ga0496108_0304307_490_813 | 107 |
| 244 | 3300048912 | Ga0496109_0229320 | Ga0496109_0229320_1367_1690 | 107 |
| 245 | 3300048912 | Ga0496109_0455874 | Ga0496109_0455874_488_811 | 107 |
| 246 | 3300048913 | Ga0496110_0000454 | Ga0496110_0000454_17449_17772 | 107 |
| 247 | 3300048913 | Ga0496110_0248272 | Ga0496110_0248272_199_522 | 107 |
| 248 | 3300048914 | Ga0496111_0029894 | Ga0496111_0029894_35_358 | 107 |
| 249 | 3300048915 | Ga0496112_1417849 | Ga0496112_1417849_170_493 | 107 |
| 250 | 3300048916 | Ga0496113_0037548 | Ga0496113_0037548_1425_1748 | 107 |
| 251 | 3300048918 | Ga0496115_0040367 | Ga0496115_0040367_488_811 | 107 |
| 252 | 3300048925 | Ga0496122_0002477 | Ga0496122_0002477_16224_16547 | 107 |
| 253 | 3300048926 | Ga0496123_0045843 | Ga0496123_0045843_1146_1469 | 107 |
| 254 | 3300048926 | Ga0496123_0203334 | Ga0496123_0203334_495_818 | 107 |
| 255 | 3300048927 | Ga0496124_0004271 | Ga0496124_0004271_4244_4567 | 107 |
| 256 | 3300048927 | Ga0496124_0091461 | Ga0496124_0091461_1618_1941 | 107 |
| 257 | 3300048927 | Ga0496124_0123863 | Ga0496124_0123863_1569_1892 | 107 |
| 258 | 3300048927 | Ga0496124_0128108 | Ga0496124_0128108_136_459 | 107 |
| 259 | 3300048928 | Ga0496125_0190755 | Ga0496125_0190755_421_744 | 107 |
| 260 | 3300048928 | Ga0496125_0287098 | Ga0496125_0287098_231_554 | 107 |
| 261 | 3300049459 | Ga0495678_000194 | Ga0495678_000194_3909_4232 | 107 |
| 262 | 3300049459 | Ga0495678_010953 | Ga0495678_010953_178_501 | 107 |
| 263 | 3300049460 | Ga0495682_0007313 | Ga0495682_0007313_3021_3344 | 107 |
| 264 | 3300049665 | Ga0501227_006447 | Ga0501227_006447_2083_2406 | 107 |
| 265 | 3300053145 | Ga0500586_005495 | Ga0500586_005495_2737_3093 | 107 |
| 266 | 3300061719 | Ga0466962_0203579 | Ga0466962_0203579_121_444 | 107 |
| 267 | 3300039447 | Ga0436361_0633983 | Ga0436361_0633983_145_471 | 108 |
| 268 | 3300046453 | Ga0495627_210894 | Ga0495627_210894_62_406 | 108 |
| 269 | 3300046491 | Ga0495584_0021778 | Ga0495584_0021778_2763_3128 | 108 |
| 270 | 3300046492 | Ga0495585_0007441 | Ga0495585_0007441_4768_5112 | 108 |
| 271 | 3300046518 | Ga0495631_0063784 | Ga0495631_0063784_1018_1362 | 108 |
| 272 | 3300046523 | Ga0495644_0208599 | Ga0495644_0208599_246_590 | 108 |
| 273 | 3300046528 | Ga0495642_0113800 | Ga0495642_0113800_352_696 | 108 |
| 274 | 3300046615 | Ga0495656_0180058 | Ga0495656_0180058_330_674 | 108 |
| 275 | 3300046616 | Ga0495668_0009515 | Ga0495668_0009515_710_1054 | 108 |
| 276 | 3300046648 | Ga0495611_0022624 | Ga0495611_0022624_813_1157 | 108 |
| 277 | 3300046691 | Ga0495670_0224853 | Ga0495670_0224853_553_879 | 108 |
| 278 | 3300046691 | Ga0495670_0272405 | Ga0495670_0272405_136_474 | 108 |
| 279 | 3300046692 | Ga0495671_0116039 | Ga0495671_0116039_334_678 | 108 |
| 280 | 3300047445 | Ga0495677_0052763 | Ga0495677_0052763_505_849 | 108 |
| 281 | 3300047470 | Ga0495681_0058307 | Ga0495681_0058307_1148_1492 | 108 |
| 282 | 3300002774 | JGI25150J39212_1001605 | JGI25150J39212_10016055 | 109 |
| 283 | 3300002987 | JGI25159J45721_1006092 | JGI25159J45721_10060923 | 109 |
| 284 | 3300003354 | JGI25160J50197_1009803 | JGI25160J50197_10098032 | 109 |
| 285 | 3300003374 | JGI25161J50226_1003566 | JGI25161J50226_10035663 | 109 |
| 286 | 3300003771 | Ga0055526_1000018 | Ga0055526_1000018160 | 109 |
| 287 | 3300003771 | Ga0055526_1006256 | Ga0055526_10062564 | 109 |
| 288 | 3300003775 | Ga0055524_1014094 | Ga0055524_10140942 | 109 |
| 289 | 3300003784 | Ga0055534_1007349 | Ga0055534_10073494 | 109 |
| 290 | 3300003791 | Ga0055530_10005572 | Ga0055530_100055725 | 109 |
| 291 | 3300003794 | Ga0055531_10001761 | Ga0055531_1000176110 | 109 |
| 292 | 3300003794 | Ga0055531_10020505 | Ga0055531_100205053 | 109 |
| 293 | 3300005341 | Ga0070691_10531389 | Ga0070691_105313891 | 109 |
| 294 | 3300005353 | Ga0070669_100447301 | Ga0070669_1004473012 | 109 |
| 295 | 3300005457 | Ga0070662_100435045 | Ga0070662_1004350451 | 109 |
| 296 | 3300005615 | Ga0070702_101124253 | Ga0070702_1011242531 | 109 |
| 297 | 3300006847 | Ga0075431_100332420 | Ga0075431_1003324202 | 109 |
| 298 | 3300006847 | Ga0075431_100456231 | Ga0075431_1004562312 | 109 |
| 299 | 3300009093 | Ga0105240_10000127 | Ga0105240_1000012758 | 109 |
| 300 | 3300010375 | Ga0105239_10000056 | Ga0105239_10000056123 | 109 |
| 301 | 3300012512 | Ga0157327_1055861 | Ga0157327_10558611 | 109 |
| 302 | 3300025226 | Ga0209674_104736 | Ga0209674_1047362 | 109 |
| 303 | 3300025245 | Ga0207425_1056933 | Ga0207425_10569332 | 109 |
| 304 | 3300025253 | Ga0209677_109073 | Ga0209677_1090732 | 109 |
| 305 | 3300025258 | Ga0209129_1000583 | Ga0209129_10005832 | 109 |
| 306 | 3300025258 | Ga0209129_1042005 | Ga0209129_10420052 | 109 |
| 307 | 3300025291 | Ga0209675_1011107 | Ga0209675_10111072 | 109 |
| 308 | 3300025292 | Ga0209676_1000472 | Ga0209676_10004725 | 109 |
| 309 | 3300025294 | Ga0209025_1044308 | Ga0209025_10443083 | 109 |
| 310 | 3300025295 | Ga0209564_1000068 | Ga0209564_1000068266 | 109 |
| 311 | 3300025297 | Ga0209758_1030442 | Ga0209758_10304422 | 109 |
| 312 | 3300025304 | Ga0209257_1002123 | Ga0209257_10021237 | 109 |
| 313 | 3300025304 | Ga0209257_1005053 | Ga0209257_10050535 | 109 |
| 314 | 3300025910 | Ga0207684_11579823 | Ga0207684_115798231 | 109 |
| 315 | 3300025913 | Ga0207695_10000243 | Ga0207695_1000024382 | 109 |
| 316 | 3300025920 | Ga0207649_10541036 | Ga0207649_105410362 | 109 |
| 317 | 3300025923 | Ga0207681_10062027 | Ga0207681_100620272 | 109 |
| 318 | 3300025933 | Ga0207706_10260289 | Ga0207706_102602892 | 109 |
| 319 | 3300031548 | Ga0307408_100000961 | Ga0307408_10000096118 | 109 |
| 320 | 3300032002 | Ga0307416_102108701 | Ga0307416_1021087012 | 109 |
| 321 | 3300037418 | Ga0395900_0613668 | Ga0395900_0613668_96_428 | 109 |
| 322 | 3300044658 | Ga0466972_0000073 | Ga0466972_0000073_122_451 | 109 |
| 323 | 3300046457 | Ga0495590_0000006 | Ga0495590_0000006_217180_217515 | 109 |
| 324 | 3300046491 | Ga0495584_0009106 | Ga0495584_0009106_3114_3443 | 109 |
| 325 | 3300046491 | Ga0495584_0018020 | Ga0495584_0018020_2022_2351 | 109 |
| 326 | 3300046492 | Ga0495585_0006790 | Ga0495585_0006790_881_1228 | 109 |
| 327 | 3300046492 | Ga0495585_0431232 | Ga0495585_0431232_164_496 | 109 |
| 328 | 3300046507 | Ga0495606_0004520 | Ga0495606_0004520_3914_4243 | 109 |
| 329 | 3300046528 | Ga0495642_0073336 | Ga0495642_0073336_431_760 | 109 |
| 330 | 3300046558 | Ga0495633_0006109 | Ga0495633_0006109_1908_2255 | 109 |
| 331 | 3300046558 | Ga0495633_0243830 | Ga0495633_0243830_234_566 | 109 |
| 332 | 3300046615 | Ga0495656_0536501 | Ga0495656_0536501_101_433 | 109 |
| 333 | 3300046616 | Ga0495668_0000243 | Ga0495668_0000243_48910_49245 | 109 |
| 334 | 3300046616 | Ga0495668_0000536 | Ga0495668_0000536_25453_25788 | 109 |
| 335 | 3300046660 | Ga0495625_0061703 | Ga0495625_0061703_1205_1537 | 109 |
| 336 | 3300046665 | Ga0495661_0012739 | Ga0495661_0012739_1093_1440 | 109 |
| 337 | 3300046665 | Ga0495661_0023434 | Ga0495661_0023434_2010_2342 | 109 |
| 338 | 3300046691 | Ga0495670_0007485 | Ga0495670_0007485_304_651 | 109 |
| 339 | 3300046691 | Ga0495670_0020263 | Ga0495670_0020263_1715_2053 | 109 |
| 340 | 3300046691 | Ga0495670_0170361 | Ga0495670_0170361_750_1085 | 109 |
| 341 | 3300046692 | Ga0495671_0018698 | Ga0495671_0018698_2246_2578 | 109 |
| 342 | 3300046694 | Ga0495649_0028285 | Ga0495649_0028285_1814_2146 | 109 |
| 343 | 3300047323 | Ga0495683_0001668 | Ga0495683_0001668_13622_13951 | 109 |
| 344 | 3300047443 | Ga0495687_204280 | Ga0495687_204280_162_497 | 109 |
| 345 | 3300047472 | Ga0495686_0008204 | Ga0495686_0008204_1581_1910 | 109 |
| 346 | 3300048905 | Ga0496102_0024270 | Ga0496102_0024270_4316_4645 | 109 |
| 347 | 3300048907 | Ga0496104_0034394 | Ga0496104_0034394_1788_2120 | 109 |
| 348 | 3300048908 | Ga0496105_0024799 | Ga0496105_0024799_674_1006 | 109 |
| 349 | 3300048913 | Ga0496110_1371646 | Ga0496110_1371646_171_509 | 109 |
| 350 | 3300048920 | Ga0496117_0044917 | Ga0496117_0044917_2496_2828 | 109 |
| 351 | 3300048921 | Ga0496118_0001363 | Ga0496118_0001363_33226_33558 | 109 |
| 352 | 3300048922 | Ga0496119_0000158 | Ga0496119_0000158_56573_56905 | 109 |
| 353 | 3300048923 | Ga0496120_0000268 | Ga0496120_0000268_36980_37312 | 109 |
| 354 | 3300048924 | Ga0496121_0086607 | Ga0496121_0086607_879_1208 | 109 |
| 355 | 3300048924 | Ga0496121_0169800 | Ga0496121_0169800_941_1270 | 109 |
| 356 | 3300048927 | Ga0496124_0079365 | Ga0496124_0079365_2093_2422 | 109 |
| 357 | 3300049459 | Ga0495678_186395 | Ga0495678_186395_123_458 | 109 |
| 358 | 3300049760 | Ga0501263_008537 | Ga0501263_008537_370_699 | 109 |
| 359 | 3300050510 | nmdc:mga06r32_127624_c1 | nmdc:mga06r32_127624_c1_266_595 | 109 |
| 360 | 3300050510 | nmdc:mga06r32_228629_c1 | nmdc:mga06r32_228629_c1_633_971 | 109 |
| 361 | 3300053093 | Ga0500651_0704104 | Ga0500651_0704104_34_378 | 109 |
| 362 | 3300053125 | Ga0500618_009739 | Ga0500618_009739_397_738 | 109 |
| 363 | 3300055283 | Ga0500661_029912 | Ga0500661_029912_10_339 | 109 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1pnt-assembly1.cif.gz_A | crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution | 0.8161 | 1 | 108 |
| 7dhf-assembly2.cif.gz_B | vibrio vulnificus wzb in complex with benzylphosphonate | 0.8089 | 2 | 109 |
| 6y2v-assembly1.cif.gz_A | crystal structure of the double mutant l13r i16k of low molecular weight protein tyrosine phosphatase (lmw-ptp) | 0.8083 | 1 | 108 |
| 7dhe-assembly4.cif.gz_D | vibrio vulnificus wzb in complex with benzylphosphonate | 0.8039 | 2 | 109 |
| 1pnt-assembly1.cif.gz_A | crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution | 0.8025 | 1 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wjaB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.799 | 2 | 105 | 3.40.50.2300 |
| af_A7WK41_4_164_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7978 | 2 | 106 | 3.40.50.2300 |
| 5gotA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7976 | 1 | 106 | 3.40.50.2300 |
| 2cwdC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7742 | 1 | 106 | 3.40.50.2300 |
| 5gotA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7715 | 1 | 106 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7PTH3-F1-model_v4 | deleted | 1.002 | 1 | 57 |
|
| AF-A0A841VHZ0-F1-model_v4 | Phosphotyrosine protein phosphatase | 0.9997 | 1 | 84 |
|
| AF-A0A6M8FRA9-F1-model_v4 | Phosphotyrosine protein phosphatase | 0.9989 | 1 | 107 |
GO:0004726
GO:0030946 GO:0140793 |
| AF-A0A244C1W3-F1-model_v4 | deleted | 0.998 | 1 | 48 |
|
| AF-A0A5X6P2R1-F1-model_v4 | Phosphotyrosine protein phosphatase | 0.9948 | 3 | 70 |
GO:0004726
GO:0030946 GO:0140793 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar