F423070

General Info

Members Datasets Scaffolds Average Seq Length
363 173 359 109

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0004232|Ga0495607_0004232_9163_9546
Length 127
Sequence MMMLLHGFVALSKTYTIQAPMTRALFICTQNRLRSPTAEHVFSTWPGVETDSAGLGADANVPLSPEQIEWANIIFVMEKTHKNRLSTKFRRYLNGKRVICLDIPDDYEYMQPELVRLLESKAGRFLR

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
88 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
166 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
172 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.88
Nodule 0
Rhizoplane 4.96
Rhizosphere 74.38
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1001605 3300002774 Bacteria 6163
2 JGI25159J45721_1000552 3300002987 Bacteria 16976
3 JGI25159J45721_1006092 3300002987 Bacteria 3663
4 rootH2_10122097 3300003320 Bacteria 1890
5 JGI25160J50197_1009803 3300003354 Bacteria 3518
6 JGI25161J50226_1000465 3300003374 Bacteria 18592
7 JGI25161J50226_1003566 3300003374 Bacteria 3518
8 Ga0055525_1000074 3300003759 Bacteria 178058
9 Ga0055526_1000018 3300003771 Bacteria 198838
10 Ga0055526_1005722 3300003771 Bacteria 7029
11 Ga0055526_1006256 3300003771 Bacteria 6521
12 Ga0055537_1005650 3300003773 Bacteria 3313
13 Ga0055537_1008145 3300003773 Bacteria 2448
14 Ga0055524_1000716 3300003775 Bacteria 22809
15 Ga0055524_1001141 3300003775 Bacteria 15987
16 Ga0055524_1001903 3300003775 Bacteria 11324
17 Ga0055524_1014094 3300003775 Bacteria 2980
18 Ga0055534_1007349 3300003784 Bacteria 2634
19 Ga0055530_10001313 3300003791 Bacteria 18696
20 Ga0055530_10001696 3300003791 Bacteria 15599
21 Ga0055530_10005572 3300003791 Bacteria 5931
22 Ga0055531_10001761 3300003794 Bacteria 15430
23 Ga0055531_10020505 3300003794 Bacteria 2610
24 Ga0055543_1000222 3300004625 Bacteria 45583
25 Ga0065165_1000710 3300005262 Bacteria 47150
26 Ga0065165_1001411 3300005262 Bacteria 26128
27 Ga0065165_1041145 3300005262 Bacteria 1373
28 Ga0070658_10000546 3300005327 Bacteria 32588
29 Ga0070666_10000034 3300005335 Bacteria 121537
30 Ga0070691_10531389 3300005341 Bacteria 684
31 Ga0070661_100029530 3300005344 Bacteria 3958
32 Ga0070668_100367777 3300005347 Bacteria 1221
33 Ga0070669_100447301 3300005353 Bacteria 1064
34 Ga0070667_100011325 3300005367 Bacteria 7376
35 Ga0070663_100460895 3300005455 Bacteria 1049
36 Ga0070662_100435045 3300005457 Bacteria 1087
37 Ga0070685_10393211 3300005466 Bacteria 958
38 Ga0070679_100346375 3300005530 Bacteria 1434
39 Ga0070665_100099630 3300005548 Bacteria 2910
40 Ga0068855_100634945 3300005563 Bacteria 1148
41 Ga0070702_101124253 3300005615 Unclassified 629
42 Ga0068858_101356559 3300005842 Unclassified 700
43 Ga0068862_100370425 3300005844 Bacteria 1333
44 Ga0075431_100332420 3300006847 Unclassified 1530
45 Ga0075431_100456231 3300006847 Bacteria 1273
46 Ga0105240_10000127 3300009093 Bacteria 156461
47 Ga0105239_10000056 3300010375 Bacteria 157615
48 Ga0157327_1055861 3300012512 Unclassified 575
49 Ga0163162_10320135 3300013306 Bacteria 1683
50 Ga0157372_10704521 3300013307 Bacteria 1175
51 Ga0209436_100375 3300025208 Bacteria 20163
52 Ga0209674_104736 3300025226 Bacteria 2153
53 Ga0209563_100003 3300025230 Bacteria 1932942
54 Ga0207425_1056933 3300025245 Bacteria 698
55 Ga0209677_109073 3300025253 Bacteria 1831
56 Ga0209129_1000583 3300025258 Bacteria 25095
57 Ga0209129_1042005 3300025258 Bacteria 720
58 Ga0209565_1002163 3300025263 Bacteria 7398
59 Ga0209565_1005249 3300025263 Bacteria 3796
60 Ga0209565_1014369 3300025263 Bacteria 1821
61 Ga0209673_1111532 3300025273 Bacteria 571
62 Ga0209130_1000474 3300025284 Bacteria 41406
63 Ga0209675_1001523 3300025291 Bacteria 13227
64 Ga0209675_1011107 3300025291 Bacteria 3008
65 Ga0209676_1000472 3300025292 Bacteria 67063
66 Ga0209025_1044308 3300025294 Bacteria 1861
67 Ga0209564_1000068 3300025295 Bacteria 311171
68 Ga0209564_1000134 3300025295 Bacteria 188346
69 Ga0209758_1030442 3300025297 Bacteria 2235
70 Ga0209050_1000092 3300025298 Bacteria 252702
71 Ga0209256_1000706 3300025299 Bacteria 44385
72 Ga0209257_1002123 3300025304 Bacteria 20708
73 Ga0209257_1005053 3300025304 Bacteria 9586
74 Ga0207680_10000005 3300025903 Bacteria 660983
75 Ga0207705_10755738 3300025909 Bacteria 755
76 Ga0207684_11579823 3300025910 Bacteria 532
77 Ga0207695_10000243 3300025913 Bacteria 141682
78 Ga0207649_10541036 3300025920 Bacteria 890
79 Ga0207681_10062027 3300025923 Bacteria 2572
80 Ga0207694_10001082 3300025924 Bacteria 23634
81 Ga0207706_10260289 3300025933 Bacteria 1514
82 Ga0207667_11313046 3300025949 Bacteria 699
83 Ga0207668_10335481 3300025972 Bacteria 1259
84 Ga0207658_10022917 3300025986 Bacteria 4352
85 Ga0207703_11091577 3300026035 Unclassified 766
86 Ga0268266_10000004 3300028379 Bacteria 1495817
87 Ga0268265_10630740 3300028380 Bacteria 1028
88 Ga0268264_10077667 3300028381 Bacteria 2829
89 Ga0307408_100000094 3300031548 Bacteria 97519
90 Ga0307408_100000961 3300031548 Bacteria 22360
91 Ga0307408_100008980 3300031548 Bacteria 6604
92 Ga0307408_100031037 3300031548 Bacteria 3716
93 Ga0307416_102108701 3300032002 Bacteria 666
94 Ga0307510_10001111 3300033180 Bacteria 28776
95 Ga0395899_0020607 3300037312 Bacteria 4998
96 Ga0395900_0006527 3300037418 Bacteria 12152
97 Ga0395900_0613668 3300037418 Bacteria 1027
98 Ga0395898_0365455 3300037466 Bacteria 1376
99 Ga0395905_0000111 3300037471 Bacteria 136345
100 Ga0395905_0268348 3300037471 Bacteria 1592
101 Ga0395901_0480951 3300038443 Bacteria 1267
102 Ga0395901_0698251 3300038443 Bacteria 1012
103 Ga0395901_2003967 3300038443 Bacteria 525
104 Ga0436361_0633983 3300039447 Bacteria 516
105 Ga0466972_0000073 3300044658 Bacteria 96438
106 Ga0466965_0170210 3300044683 Unclassified 1146
107 Ga0466966_0005816 3300044684 Bacteria 8130
108 Ga0466961_0121628 3300044693 Bacteria 1638
109 Ga0466971_0105700 3300044719 Bacteria 1296
110 Ga0495617_015864 3300046452 Bacteria 2549
111 Ga0495627_210894 3300046453 Unclassified 534
112 Ga0495603_0080820 3300046455 Bacteria 1904
113 Ga0495590_0000006 3300046457 Bacteria 372949
114 Ga0495590_0000179 3300046457 Bacteria 37217
115 Ga0495590_0193470 3300046457 Bacteria 746
116 Ga0495590_0284631 3300046457 Bacteria 620
117 Ga0495591_000127 3300046458 Bacteria 83271
118 Ga0495629_0019974 3300046459 Bacteria 4780
119 Ga0495650_0002151 3300046471 Bacteria 16727
120 Ga0495650_0011779 3300046471 Bacteria 4755
121 Ga0495650_0058859 3300046471 Bacteria 1549
122 Ga0495582_0013147 3300046473 Bacteria 4555
123 Ga0495605_0000022 3300046474 Bacteria 248321
124 Ga0495605_0008843 3300046474 Bacteria 5677
125 Ga0495605_0009786 3300046474 Bacteria 5383
126 Ga0495605_0012496 3300046474 Bacteria 4708
127 Ga0495605_0037504 3300046474 Bacteria 2437
128 Ga0495584_0000606 3300046491 Bacteria 24016
129 Ga0495584_0009106 3300046491 Bacteria 5126
130 Ga0495584_0009755 3300046491 Bacteria 4938
131 Ga0495584_0018020 3300046491 Bacteria 3589
132 Ga0495584_0021778 3300046491 Bacteria 3254
133 Ga0495584_0065109 3300046491 Bacteria 1833
134 Ga0495584_0068960 3300046491 Bacteria 1776
135 Ga0495584_0473455 3300046491 Bacteria 637
136 Ga0495585_0004177 3300046492 Bacteria 9431
137 Ga0495585_0006790 3300046492 Bacteria 7065
138 Ga0495585_0007441 3300046492 Bacteria 6701
139 Ga0495585_0020935 3300046492 Bacteria 3757
140 Ga0495585_0066692 3300046492 Bacteria 1970
141 Ga0495585_0152442 3300046492 Bacteria 1204
142 Ga0495585_0167100 3300046492 Bacteria 1138
143 Ga0495585_0431232 3300046492 Unclassified 632
144 Ga0495594_0056351 3300046499 Bacteria 2168
145 Ga0495596_0000526 3300046500 Bacteria 24051
146 Ga0495596_0022201 3300046500 Bacteria 2585
147 Ga0495596_0031295 3300046500 Bacteria 2126
148 Ga0495596_0033697 3300046500 Bacteria 2037
149 Ga0495596_0040285 3300046500 Bacteria 1844
150 Ga0495607_0004232 3300046501 Bacteria 10642
151 Ga0495607_0006406 3300046501 Bacteria 8291
152 Ga0495607_0007881 3300046501 Bacteria 7327
153 Ga0495607_0008031 3300046501 Bacteria 7246
154 Ga0495607_0027290 3300046501 Bacteria 3532
155 Ga0495607_0027424 3300046501 Bacteria 3522
156 Ga0495583_0000816 3300046506 Bacteria 38101
157 Ga0495583_0001071 3300046506 Bacteria 30564
158 Ga0495583_0036460 3300046506 Bacteria 2339
159 Ga0495583_0253260 3300046506 Bacteria 705
160 Ga0495606_0004520 3300046507 Bacteria 13843
161 Ga0495606_0062113 3300046507 Bacteria 2386
162 Ga0495610_0000004 3300046512 Bacteria 1006135
163 Ga0495610_0000452 3300046512 Bacteria 42500
164 Ga0495616_0007535 3300046513 Bacteria 6514
165 Ga0495616_0008838 3300046513 Bacteria 5926
166 Ga0495616_0037729 3300046513 Bacteria 2484
167 Ga0495616_0039360 3300046513 Bacteria 2422
168 Ga0495616_0049674 3300046513 Bacteria 2101
169 Ga0495631_0001363 3300046518 Bacteria 14907
170 Ga0495631_0018774 3300046518 Bacteria 3251
171 Ga0495631_0053241 3300046518 Bacteria 1766
172 Ga0495631_0058684 3300046518 Bacteria 1673
173 Ga0495631_0063784 3300046518 Bacteria 1595
174 Ga0495632_0002044 3300046519 Bacteria 15859
175 Ga0495632_0014318 3300046519 Bacteria 4490
176 Ga0495632_0023752 3300046519 Bacteria 3268
177 Ga0495637_0000029 3300046520 Bacteria 143929
178 Ga0495643_0005182 3300046522 Bacteria 8892
179 Ga0495643_0011635 3300046522 Bacteria 5348
180 Ga0495643_0037101 3300046522 Bacteria 2675
181 Ga0495644_0006552 3300046523 Bacteria 4507
182 Ga0495644_0008139 3300046523 Bacteria 4032
183 Ga0495644_0085021 3300046523 Bacteria 1192
184 Ga0495644_0208599 3300046523 Unclassified 754
185 Ga0495648_0005153 3300046524 Bacteria 10931
186 Ga0495648_0006062 3300046524 Bacteria 9921
187 Ga0495642_0006484 3300046528 Bacteria 4490
188 Ga0495642_0014315 3300046528 Bacteria 3072
189 Ga0495642_0015678 3300046528 Bacteria 2948
190 Ga0495642_0073336 3300046528 Bacteria 1434
191 Ga0495642_0113800 3300046528 Bacteria 1158
192 Ga0495642_0424523 3300046528 Bacteria 587
193 Ga0495654_0016289 3300046530 Bacteria 3934
194 Ga0495654_0186886 3300046530 Bacteria 894
195 Ga0495609_0052589 3300046538 Bacteria 1812
196 Ga0495609_0070287 3300046538 Bacteria 1539
197 Ga0495609_0126426 3300046538 Bacteria 1097
198 Ga0495597_0001116 3300046542 Bacteria 20304
199 Ga0495597_0006469 3300046542 Bacteria 6060
200 Ga0495622_0145193 3300046557 Bacteria 1075
201 Ga0495633_0002345 3300046558 Bacteria 13449
202 Ga0495633_0006109 3300046558 Bacteria 7213
203 Ga0495633_0009595 3300046558 Bacteria 5333
204 Ga0495633_0072997 3300046558 Bacteria 1599
205 Ga0495633_0110965 3300046558 Bacteria 1271
206 Ga0495633_0210177 3300046558 Bacteria 892
207 Ga0495633_0243830 3300046558 Bacteria 820
208 Ga0495633_0341911 3300046558 Bacteria 678
209 Ga0495656_0180058 3300046615 Bacteria 1038
210 Ga0495656_0536501 3300046615 Bacteria 623
211 Ga0495656_0660039 3300046615 Bacteria 562
212 Ga0495668_0000243 3300046616 Bacteria 77845
213 Ga0495668_0000536 3300046616 Bacteria 47214
214 Ga0495668_0000617 3300046616 Bacteria 43027
215 Ga0495668_0009515 3300046616 Bacteria 5962
216 Ga0495668_0011340 3300046616 Bacteria 5344
217 Ga0495668_0012044 3300046616 Bacteria 5147
218 Ga0495668_0020486 3300046616 Bacteria 3804
219 Ga0495668_0027212 3300046616 Bacteria 3240
220 Ga0495668_0230371 3300046616 Bacteria 1014
221 Ga0495611_0000913 3300046648 Bacteria 15999
222 Ga0495611_0005791 3300046648 Bacteria 5272
223 Ga0495611_0022624 3300046648 Bacteria 2720
224 Ga0495611_0083498 3300046648 Bacteria 1471
225 Ga0495625_0061703 3300046660 Bacteria 2652
226 Ga0495625_0175773 3300046660 Bacteria 1427
227 Ga0495625_0227592 3300046660 Bacteria 1219
228 Ga0495625_0502083 3300046660 Bacteria 741
229 Ga0495661_0007189 3300046665 Bacteria 7768
230 Ga0495661_0010783 3300046665 Bacteria 6220
231 Ga0495661_0012739 3300046665 Bacteria 5674
232 Ga0495661_0015541 3300046665 Bacteria 5079
233 Ga0495661_0023434 3300046665 Bacteria 4008
234 Ga0495661_0046874 3300046665 Bacteria 2635
235 Ga0495661_0052312 3300046665 Bacteria 2461
236 Ga0495661_0073877 3300046665 Bacteria 1985
237 Ga0495661_0235653 3300046665 Bacteria 941
238 Ga0495661_0250403 3300046665 Bacteria 904
239 Ga0495661_0376444 3300046665 Bacteria 694
240 Ga0495588_0098175 3300046674 Bacteria 1537
241 Ga0495588_0163637 3300046674 Bacteria 1176
242 Ga0495669_0014048 3300046684 Bacteria 3421
243 Ga0495669_0072365 3300046684 Bacteria 1573
244 Ga0495669_0213339 3300046684 Bacteria 924
245 Ga0495613_0362001 3300046689 Bacteria 994
246 Ga0495670_0007485 3300046691 Bacteria 5365
247 Ga0495670_0014215 3300046691 Bacteria 3916
248 Ga0495670_0020263 3300046691 Bacteria 3278
249 Ga0495670_0032321 3300046691 Bacteria 2602
250 Ga0495670_0044471 3300046691 Bacteria 2217
251 Ga0495670_0170361 3300046691 Bacteria 1146
252 Ga0495670_0224853 3300046691 Bacteria 997
253 Ga0495670_0272405 3300046691 Bacteria 904
254 Ga0495671_0006970 3300046692 Bacteria 6480
255 Ga0495671_0007895 3300046692 Bacteria 6018
256 Ga0495671_0018698 3300046692 Bacteria 3674
257 Ga0495671_0063855 3300046692 Bacteria 1813
258 Ga0495671_0116039 3300046692 Bacteria 1307
259 Ga0495671_0149616 3300046692 Bacteria 1137
260 Ga0495649_0000243 3300046694 Bacteria 48016
261 Ga0495649_0001732 3300046694 Bacteria 16121
262 Ga0495649_0013755 3300046694 Bacteria 4659
263 Ga0495649_0028285 3300046694 Bacteria 3107
264 Ga0495649_0093249 3300046694 Bacteria 1603
265 Ga0495649_0208838 3300046694 Bacteria 1012
266 Ga0495589_0001411 3300046794 Bacteria 13927
267 Ga0495589_0005145 3300046794 Bacteria 6921
268 Ga0495589_0013837 3300046794 Bacteria 4160
269 Ga0495589_0043927 3300046794 Bacteria 2224
270 Ga0495660_0004430 3300046810 Bacteria 8494
271 Ga0495660_0008583 3300046810 Bacteria 5979
272 Ga0495660_0027189 3300046810 Bacteria 3237
273 Ga0495660_0249292 3300046810 Bacteria 824
274 Ga0495581_0049624 3300047315 Bacteria 2423
275 Ga0495672_0000175 3300047320 Bacteria 93127
276 Ga0495672_0004423 3300047320 Bacteria 11518
277 Ga0495672_0129208 3300047320 Bacteria 1331
278 Ga0495683_0000379 3300047323 Bacteria 36310
279 Ga0495683_0001668 3300047323 Bacteria 14159
280 Ga0495683_0025030 3300047323 Bacteria 3060
281 Ga0495683_0219140 3300047323 Bacteria 849
282 Ga0495687_204280 3300047443 Bacteria 624
283 Ga0495687_207131 3300047443 Bacteria 618
284 Ga0495677_0000159 3300047445 Bacteria 32329
285 Ga0495677_0000788 3300047445 Bacteria 12782
286 Ga0495677_0008007 3300047445 Bacteria 3927
287 Ga0495677_0009108 3300047445 Bacteria 3669
288 Ga0495677_0052763 3300047445 Bacteria 1498
289 Ga0495679_006720 3300047446 Bacteria 4907
290 Ga0495679_012864 3300047446 Bacteria 3166
291 Ga0495679_052927 3300047446 Bacteria 1213
292 Ga0495685_109868 3300047447 Bacteria 908
293 Ga0495685_212197 3300047447 Bacteria 619
294 Ga0495673_0000017 3300047469 Bacteria 574970
295 Ga0495681_0001208 3300047470 Bacteria 19632
296 Ga0495681_0002749 3300047470 Bacteria 12452
297 Ga0495681_0008789 3300047470 Bacteria 6292
298 Ga0495681_0011118 3300047470 Bacteria 5394
299 Ga0495681_0034154 3300047470 Bacteria 2537
300 Ga0495681_0039822 3300047470 Bacteria 2292
301 Ga0495681_0058307 3300047470 Bacteria 1789
302 Ga0495681_0278799 3300047470 Bacteria 652
303 Ga0495686_0007527 3300047472 Bacteria 8154
304 Ga0495686_0008204 3300047472 Bacteria 7701
305 Ga0495686_0215748 3300047472 Bacteria 1094
306 Ga0495614_0005443 3300048089 Bacteria 5739
307 Ga0495626_0000003 3300048091 Bacteria 427774
308 Ga0495626_0020586 3300048091 Bacteria 3284
309 Ga0495626_0030025 3300048091 Bacteria 2623
310 Ga0495626_0039825 3300048091 Bacteria 2221
311 Ga0495626_0101528 3300048091 Bacteria 1253
312 Ga0496102_0024270 3300048905 Bacteria 5390
313 Ga0496102_0100742 3300048905 Bacteria 2683
314 Ga0496102_0405951 3300048905 Bacteria 1280
315 Ga0496102_1193474 3300048905 Bacteria 680
316 Ga0496103_0161412 3300048906 Bacteria 1437
317 Ga0496104_0034394 3300048907 Bacteria 4726
318 Ga0496105_0024799 3300048908 Bacteria 4875
319 Ga0496107_0230202 3300048910 Bacteria 1379
320 Ga0496108_0304307 3300048911 Bacteria 1389
321 Ga0496109_0229320 3300048912 Bacteria 1747
322 Ga0496109_0455874 3300048912 Bacteria 1208
323 Ga0496110_0000454 3300048913 Bacteria 27858
324 Ga0496110_0248272 3300048913 Bacteria 1620
325 Ga0496110_1371646 3300048913 Bacteria 616
326 Ga0496111_0029894 3300048914 Bacteria 3872
327 Ga0496112_1417849 3300048915 Bacteria 609
328 Ga0496113_0037548 3300048916 Bacteria 3556
329 Ga0496115_0040367 3300048918 Bacteria 3710
330 Ga0496117_0044917 3300048920 Bacteria 3196
331 Ga0496118_0001363 3300048921 Bacteria 36814
332 Ga0496119_0000158 3300048922 Bacteria 93884
333 Ga0496120_0000268 3300048923 Bacteria 86899
334 Ga0496121_0086607 3300048924 Bacteria 2461
335 Ga0496121_0169800 3300048924 Bacteria 1586
336 Ga0496122_0002477 3300048925 Bacteria 26088
337 Ga0496123_0045843 3300048926 Bacteria 2973
338 Ga0496123_0203334 3300048926 Bacteria 1013
339 Ga0496124_0004271 3300048927 Bacteria 16806
340 Ga0496124_0079365 3300048927 Bacteria 2703
341 Ga0496124_0091461 3300048927 Bacteria 2479
342 Ga0496124_0123863 3300048927 Bacteria 2062
343 Ga0496124_0128108 3300048927 Bacteria 2020
344 Ga0496125_0190755 3300048928 Bacteria 1353
345 Ga0496125_0287098 3300048928 Bacteria 1015
346 Ga0495678_000194 3300049459 Bacteria 71366
347 Ga0495678_010953 3300049459 Bacteria 4369
348 Ga0495678_186395 3300049459 Bacteria 647
349 Ga0495682_0007313 3300049460 Bacteria 4404
350 Ga0501227_006447 3300049665 Bacteria 2523
351 Ga0501263_008537 3300049760 Bacteria 1225
352 nmdc:mga06r32_127624_c1 3300050510 Bacteria 2513
353 nmdc:mga06r32_228629_c1 3300050510 Unclassified 1848
354 Ga0500646_0036255 3300053090 Bacteria 1373
355 Ga0500651_0704104 3300053093 Bacteria 540
356 Ga0500618_009739 3300053125 Bacteria 2612
357 Ga0500586_005495 3300053145 Bacteria 3212
358 Ga0500661_029912 3300055283 Unclassified 961
359 Ga0466962_0203579 3300061719 Bacteria 967

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221554 2643787556 103
2 iso_pu_bacteria 2643221638 2644213581 103
3 iso_pu_bacteria 2808606418 2809147320 103
4 3300026035 Ga0207703_11091577 Ga0207703_110915772 104
5 iso_pu_bacteria 2593339239 2595449572 105
6 3300005327 Ga0070658_10000546 Ga0070658_1000054623 106
7 3300005335 Ga0070666_10000034 Ga0070666_10000034117 106
8 3300005344 Ga0070661_100029530 Ga0070661_1000295302 106
9 3300005347 Ga0070668_100367777 Ga0070668_1003677772 106
10 3300005367 Ga0070667_100011325 Ga0070667_1000113255 106
11 3300005455 Ga0070663_100460895 Ga0070663_1004608952 106
12 3300005466 Ga0070685_10393211 Ga0070685_103932111 106
13 3300005548 Ga0070665_100099630 Ga0070665_1000996305 106
14 3300005842 Ga0068858_101356559 Ga0068858_1013565592 106
15 3300005844 Ga0068862_100370425 Ga0068862_1003704252 106
16 3300025903 Ga0207680_10000005 Ga0207680_10000005241 106
17 3300025924 Ga0207694_10001082 Ga0207694_1000108214 106
18 3300025972 Ga0207668_10335481 Ga0207668_103354812 106
19 3300025986 Ga0207658_10022917 Ga0207658_100229176 106
20 3300028379 Ga0268266_10000004 Ga0268266_100000041284 106
21 3300028380 Ga0268265_10630740 Ga0268265_106307402 106
22 3300028381 Ga0268264_10077667 Ga0268264_100776672 106
23 3300033180 Ga0307510_10001111 Ga0307510_1000111119 106
24 3300053090 Ga0500646_0036255 Ga0500646_0036255_264_593 106
25 3300002987 JGI25159J45721_1000552 JGI25159J45721_10005527 107
26 3300003320 rootH2_10122097 rootH2_101220974 107
27 3300003374 JGI25161J50226_1000465 JGI25161J50226_100046519 107
28 3300003759 Ga0055525_1000074 Ga0055525_100007478 107
29 3300003771 Ga0055526_1005722 Ga0055526_10057227 107
30 3300003773 Ga0055537_1005650 Ga0055537_10056507 107
31 3300003773 Ga0055537_1008145 Ga0055537_10081453 107
32 3300003775 Ga0055524_1000716 Ga0055524_100071619 107
33 3300003775 Ga0055524_1001141 Ga0055524_100114114 107
34 3300003775 Ga0055524_1001903 Ga0055524_100190310 107
35 3300003791 Ga0055530_10001313 Ga0055530_100013135 107
36 3300003791 Ga0055530_10001696 Ga0055530_100016963 107
37 3300004625 Ga0055543_1000222 Ga0055543_100022225 107
38 3300005262 Ga0065165_1000710 Ga0065165_100071024 107
39 3300005262 Ga0065165_1001411 Ga0065165_100141112 107
40 3300005262 Ga0065165_1041145 Ga0065165_10411451 107
41 3300005530 Ga0070679_100346375 Ga0070679_1003463752 107
42 3300005563 Ga0068855_100634945 Ga0068855_1006349452 107
43 3300013306 Ga0163162_10320135 Ga0163162_103201352 107
44 3300013307 Ga0157372_10704521 Ga0157372_107045212 107
45 3300025208 Ga0209436_100375 Ga0209436_1003759 107
46 3300025230 Ga0209563_100003 Ga0209563_10000376 107
47 3300025263 Ga0209565_1002163 Ga0209565_10021632 107
48 3300025263 Ga0209565_1005249 Ga0209565_10052492 107
49 3300025263 Ga0209565_1014369 Ga0209565_10143692 107
50 3300025273 Ga0209673_1111532 Ga0209673_11115321 107
51 3300025284 Ga0209130_1000474 Ga0209130_100047425 107
52 3300025291 Ga0209675_1001523 Ga0209675_10015234 107
53 3300025295 Ga0209564_1000134 Ga0209564_100013458 107
54 3300025298 Ga0209050_1000092 Ga0209050_100009258 107
55 3300025299 Ga0209256_1000706 Ga0209256_100070615 107
56 3300025909 Ga0207705_10755738 Ga0207705_107557381 107
57 3300025949 Ga0207667_11313046 Ga0207667_113130462 107
58 3300031548 Ga0307408_100000094 Ga0307408_10000009432 107
59 3300031548 Ga0307408_100008980 Ga0307408_1000089804 107
60 3300031548 Ga0307408_100031037 Ga0307408_1000310372 107
61 3300037312 Ga0395899_0020607 Ga0395899_0020607_1460_1783 107
62 3300037418 Ga0395900_0006527 Ga0395900_0006527_5705_6028 107
63 3300037466 Ga0395898_0365455 Ga0395898_0365455_498_821 107
64 3300037471 Ga0395905_0000111 Ga0395905_0000111_78131_78454 107
65 3300037471 Ga0395905_0268348 Ga0395905_0268348_893_1216 107
66 3300038443 Ga0395901_0480951 Ga0395901_0480951_536_859 107
67 3300038443 Ga0395901_0698251 Ga0395901_0698251_598_921 107
68 3300038443 Ga0395901_2003967 Ga0395901_2003967_108_431 107
69 3300044683 Ga0466965_0170210 Ga0466965_0170210_698_1114 107
70 3300044684 Ga0466966_0005816 Ga0466966_0005816_2338_2661 107
71 3300044693 Ga0466961_0121628 Ga0466961_0121628_987_1310 107
72 3300044719 Ga0466971_0105700 Ga0466971_0105700_141_464 107
73 3300046452 Ga0495617_015864 Ga0495617_015864_959_1282 107
74 3300046455 Ga0495603_0080820 Ga0495603_0080820_1003_1326 107
75 3300046457 Ga0495590_0000179 Ga0495590_0000179_14031_14354 107
76 3300046457 Ga0495590_0193470 Ga0495590_0193470_101_427 107
77 3300046457 Ga0495590_0284631 Ga0495590_0284631_47_370 107
78 3300046458 Ga0495591_000127 Ga0495591_000127_22974_23297 107
79 3300046459 Ga0495629_0019974 Ga0495629_0019974_46_369 107
80 3300046471 Ga0495650_0002151 Ga0495650_0002151_12322_12678 107
81 3300046471 Ga0495650_0011779 Ga0495650_0011779_2844_3167 107
82 3300046471 Ga0495650_0058859 Ga0495650_0058859_102_425 107
83 3300046473 Ga0495582_0013147 Ga0495582_0013147_2735_3058 107
84 3300046474 Ga0495605_0000022 Ga0495605_0000022_106182_106505 107
85 3300046474 Ga0495605_0008843 Ga0495605_0008843_4012_4335 107
86 3300046474 Ga0495605_0009786 Ga0495605_0009786_3016_3339 107
87 3300046474 Ga0495605_0012496 Ga0495605_0012496_1972_2295 107
88 3300046474 Ga0495605_0037504 Ga0495605_0037504_325_648 107
89 3300046491 Ga0495584_0000606 Ga0495584_0000606_20671_20994 107
90 3300046491 Ga0495584_0009755 Ga0495584_0009755_3273_3596 107
91 3300046491 Ga0495584_0065109 Ga0495584_0065109_705_1031 107
92 3300046491 Ga0495584_0068960 Ga0495584_0068960_549_872 107
93 3300046491 Ga0495584_0473455 Ga0495584_0473455_146_469 107
94 3300046492 Ga0495585_0004177 Ga0495585_0004177_5815_6138 107
95 3300046492 Ga0495585_0020935 Ga0495585_0020935_2092_2415 107
96 3300046492 Ga0495585_0066692 Ga0495585_0066692_445_768 107
97 3300046492 Ga0495585_0152442 Ga0495585_0152442_75_437 107
98 3300046492 Ga0495585_0167100 Ga0495585_0167100_393_719 107
99 3300046499 Ga0495594_0056351 Ga0495594_0056351_1003_1326 107
100 3300046500 Ga0495596_0000526 Ga0495596_0000526_18337_18660 107
101 3300046500 Ga0495596_0022201 Ga0495596_0022201_975_1298 107
102 3300046500 Ga0495596_0031295 Ga0495596_0031295_897_1220 107
103 3300046500 Ga0495596_0033697 Ga0495596_0033697_1702_2025 107
104 3300046500 Ga0495596_0040285 Ga0495596_0040285_460_783 107
105 3300046501 Ga0495607_0004232 Ga0495607_0004232_9163_9546 107
106 3300046501 Ga0495607_0006406 Ga0495607_0006406_2357_2680 107
107 3300046501 Ga0495607_0007881 Ga0495607_0007881_3632_3955 107
108 3300046501 Ga0495607_0008031 Ga0495607_0008031_954_1277 107
109 3300046501 Ga0495607_0027290 Ga0495607_0027290_2834_3157 107
110 3300046501 Ga0495607_0027424 Ga0495607_0027424_2391_2714 107
111 3300046506 Ga0495583_0000816 Ga0495583_0000816_3005_3328 107
112 3300046506 Ga0495583_0001071 Ga0495583_0001071_4823_5146 107
113 3300046506 Ga0495583_0036460 Ga0495583_0036460_233_595 107
114 3300046506 Ga0495583_0253260 Ga0495583_0253260_266_589 107
115 3300046507 Ga0495606_0062113 Ga0495606_0062113_136_459 107
116 3300046512 Ga0495610_0000004 Ga0495610_0000004_525170_525526 107
117 3300046512 Ga0495610_0000452 Ga0495610_0000452_14316_14639 107
118 3300046513 Ga0495616_0007535 Ga0495616_0007535_500_883 107
119 3300046513 Ga0495616_0008838 Ga0495616_0008838_2500_2823 107
120 3300046513 Ga0495616_0037729 Ga0495616_0037729_677_1000 107
121 3300046513 Ga0495616_0039360 Ga0495616_0039360_756_1079 107
122 3300046513 Ga0495616_0049674 Ga0495616_0049674_874_1197 107
123 3300046518 Ga0495631_0001363 Ga0495631_0001363_11440_11763 107
124 3300046518 Ga0495631_0018774 Ga0495631_0018774_2034_2357 107
125 3300046518 Ga0495631_0053241 Ga0495631_0053241_601_924 107
126 3300046518 Ga0495631_0058684 Ga0495631_0058684_890_1213 107
127 3300046519 Ga0495632_0002044 Ga0495632_0002044_6570_6953 107
128 3300046519 Ga0495632_0014318 Ga0495632_0014318_3814_4137 107
129 3300046519 Ga0495632_0023752 Ga0495632_0023752_381_704 107
130 3300046520 Ga0495637_0000029 Ga0495637_0000029_23415_23738 107
131 3300046522 Ga0495643_0005182 Ga0495643_0005182_2910_3233 107
132 3300046522 Ga0495643_0011635 Ga0495643_0011635_3939_4262 107
133 3300046522 Ga0495643_0037101 Ga0495643_0037101_1899_2222 107
134 3300046523 Ga0495644_0006552 Ga0495644_0006552_1386_1709 107
135 3300046523 Ga0495644_0008139 Ga0495644_0008139_3334_3657 107
136 3300046523 Ga0495644_0085021 Ga0495644_0085021_46_369 107
137 3300046524 Ga0495648_0005153 Ga0495648_0005153_2480_2803 107
138 3300046524 Ga0495648_0006062 Ga0495648_0006062_1230_1586 107
139 3300046528 Ga0495642_0006484 Ga0495642_0006484_1014_1337 107
140 3300046528 Ga0495642_0014315 Ga0495642_0014315_1716_2039 107
141 3300046528 Ga0495642_0015678 Ga0495642_0015678_339_662 107
142 3300046528 Ga0495642_0424523 Ga0495642_0424523_62_385 107
143 3300046530 Ga0495654_0016289 Ga0495654_0016289_2624_2947 107
144 3300046530 Ga0495654_0186886 Ga0495654_0186886_421_744 107
145 3300046538 Ga0495609_0052589 Ga0495609_0052589_1160_1483 107
146 3300046538 Ga0495609_0070287 Ga0495609_0070287_479_805 107
147 3300046538 Ga0495609_0126426 Ga0495609_0126426_265_588 107
148 3300046542 Ga0495597_0001116 Ga0495597_0001116_19191_19514 107
149 3300046542 Ga0495597_0006469 Ga0495597_0006469_1168_1491 107
150 3300046557 Ga0495622_0145193 Ga0495622_0145193_46_369 107
151 3300046558 Ga0495633_0002345 Ga0495633_0002345_8845_9168 107
152 3300046558 Ga0495633_0009595 Ga0495633_0009595_2804_3127 107
153 3300046558 Ga0495633_0072997 Ga0495633_0072997_434_757 107
154 3300046558 Ga0495633_0110965 Ga0495633_0110965_713_1036 107
155 3300046558 Ga0495633_0210177 Ga0495633_0210177_220_582 107
156 3300046558 Ga0495633_0341911 Ga0495633_0341911_335_658 107
157 3300046615 Ga0495656_0660039 Ga0495656_0660039_74_397 107
158 3300046616 Ga0495668_0000617 Ga0495668_0000617_5906_6262 107
159 3300046616 Ga0495668_0011340 Ga0495668_0011340_1884_2207 107
160 3300046616 Ga0495668_0012044 Ga0495668_0012044_4694_5017 107
161 3300046616 Ga0495668_0020486 Ga0495668_0020486_1098_1421 107
162 3300046616 Ga0495668_0027212 Ga0495668_0027212_1613_1936 107
163 3300046616 Ga0495668_0230371 Ga0495668_0230371_332_655 107
164 3300046648 Ga0495611_0000913 Ga0495611_0000913_3109_3432 107
165 3300046648 Ga0495611_0005791 Ga0495611_0005791_2826_3149 107
166 3300046648 Ga0495611_0083498 Ga0495611_0083498_1011_1334 107
167 3300046660 Ga0495625_0175773 Ga0495625_0175773_515_838 107
168 3300046660 Ga0495625_0227592 Ga0495625_0227592_117_473 107
169 3300046660 Ga0495625_0502083 Ga0495625_0502083_185_508 107
170 3300046665 Ga0495661_0007189 Ga0495661_0007189_3010_3333 107
171 3300046665 Ga0495661_0010783 Ga0495661_0010783_5057_5440 107
172 3300046665 Ga0495661_0015541 Ga0495661_0015541_1693_2016 107
173 3300046665 Ga0495661_0046874 Ga0495661_0046874_1470_1793 107
174 3300046665 Ga0495661_0052312 Ga0495661_0052312_105_428 107
175 3300046665 Ga0495661_0073877 Ga0495661_0073877_814_1137 107
176 3300046665 Ga0495661_0235653 Ga0495661_0235653_110_433 107
177 3300046665 Ga0495661_0250403 Ga0495661_0250403_145_468 107
178 3300046665 Ga0495661_0376444 Ga0495661_0376444_44_400 107
179 3300046674 Ga0495588_0098175 Ga0495588_0098175_856_1179 107
180 3300046674 Ga0495588_0163637 Ga0495588_0163637_405_728 107
181 3300046684 Ga0495669_0014048 Ga0495669_0014048_2889_3212 107
182 3300046684 Ga0495669_0072365 Ga0495669_0072365_80_403 107
183 3300046684 Ga0495669_0213339 Ga0495669_0213339_303_626 107
184 3300046689 Ga0495613_0362001 Ga0495613_0362001_146_469 107
185 3300046691 Ga0495670_0014215 Ga0495670_0014215_2124_2447 107
186 3300046691 Ga0495670_0032321 Ga0495670_0032321_110_433 107
187 3300046691 Ga0495670_0044471 Ga0495670_0044471_1226_1549 107
188 3300046692 Ga0495671_0006970 Ga0495671_0006970_5522_5845 107
189 3300046692 Ga0495671_0007895 Ga0495671_0007895_889_1212 107
190 3300046692 Ga0495671_0063855 Ga0495671_0063855_392_748 107
191 3300046692 Ga0495671_0149616 Ga0495671_0149616_128_451 107
192 3300046694 Ga0495649_0000243 Ga0495649_0000243_43250_43573 107
193 3300046694 Ga0495649_0001732 Ga0495649_0001732_11723_12046 107
194 3300046694 Ga0495649_0013755 Ga0495649_0013755_4114_4437 107
195 3300046694 Ga0495649_0093249 Ga0495649_0093249_183_506 107
196 3300046694 Ga0495649_0208838 Ga0495649_0208838_208_531 107
197 3300046794 Ga0495589_0001411 Ga0495589_0001411_10496_10819 107
198 3300046794 Ga0495589_0005145 Ga0495589_0005145_5163_5486 107
199 3300046794 Ga0495589_0013837 Ga0495589_0013837_825_1148 107
200 3300046794 Ga0495589_0043927 Ga0495589_0043927_600_923 107
201 3300046810 Ga0495660_0004430 Ga0495660_0004430_291_647 107
202 3300046810 Ga0495660_0008583 Ga0495660_0008583_4519_4842 107
203 3300046810 Ga0495660_0027189 Ga0495660_0027189_2039_2362 107
204 3300046810 Ga0495660_0249292 Ga0495660_0249292_221_544 107
205 3300047315 Ga0495581_0049624 Ga0495581_0049624_1540_1863 107
206 3300047320 Ga0495672_0000175 Ga0495672_0000175_22903_23226 107
207 3300047320 Ga0495672_0004423 Ga0495672_0004423_2685_3008 107
208 3300047320 Ga0495672_0129208 Ga0495672_0129208_214_537 107
209 3300047323 Ga0495683_0000379 Ga0495683_0000379_13581_13904 107
210 3300047323 Ga0495683_0025030 Ga0495683_0025030_1099_1422 107
211 3300047323 Ga0495683_0219140 Ga0495683_0219140_133_456 107
212 3300047443 Ga0495687_207131 Ga0495687_207131_120_446 107
213 3300047445 Ga0495677_0000159 Ga0495677_0000159_13866_14189 107
214 3300047445 Ga0495677_0000788 Ga0495677_0000788_7555_7878 107
215 3300047445 Ga0495677_0008007 Ga0495677_0008007_1333_1656 107
216 3300047445 Ga0495677_0009108 Ga0495677_0009108_738_1061 107
217 3300047446 Ga0495679_006720 Ga0495679_006720_3509_3832 107
218 3300047446 Ga0495679_012864 Ga0495679_012864_2775_3098 107
219 3300047446 Ga0495679_052927 Ga0495679_052927_530_853 107
220 3300047447 Ga0495685_109868 Ga0495685_109868_222_545 107
221 3300047447 Ga0495685_212197 Ga0495685_212197_87_410 107
222 3300047469 Ga0495673_0000017 Ga0495673_0000017_195137_195493 107
223 3300047470 Ga0495681_0001208 Ga0495681_0001208_4399_4722 107
224 3300047470 Ga0495681_0002749 Ga0495681_0002749_7086_7409 107
225 3300047470 Ga0495681_0008789 Ga0495681_0008789_39_362 107
226 3300047470 Ga0495681_0011118 Ga0495681_0011118_3145_3468 107
227 3300047470 Ga0495681_0034154 Ga0495681_0034154_71_394 107
228 3300047470 Ga0495681_0039822 Ga0495681_0039822_469_792 107
229 3300047470 Ga0495681_0278799 Ga0495681_0278799_206_529 107
230 3300047472 Ga0495686_0007527 Ga0495686_0007527_4927_5250 107
231 3300047472 Ga0495686_0215748 Ga0495686_0215748_369_692 107
232 3300048089 Ga0495614_0005443 Ga0495614_0005443_3145_3468 107
233 3300048091 Ga0495626_0000003 Ga0495626_0000003_203853_204176 107
234 3300048091 Ga0495626_0020586 Ga0495626_0020586_1296_1619 107
235 3300048091 Ga0495626_0030025 Ga0495626_0030025_376_699 107
236 3300048091 Ga0495626_0039825 Ga0495626_0039825_1029_1352 107
237 3300048091 Ga0495626_0101528 Ga0495626_0101528_545_868 107
238 3300048905 Ga0496102_0100742 Ga0496102_0100742_361_684 107
239 3300048905 Ga0496102_0405951 Ga0496102_0405951_753_1076 107
240 3300048905 Ga0496102_1193474 Ga0496102_1193474_14_337 107
241 3300048906 Ga0496103_0161412 Ga0496103_0161412_636_959 107
242 3300048910 Ga0496107_0230202 Ga0496107_0230202_748_1071 107
243 3300048911 Ga0496108_0304307 Ga0496108_0304307_490_813 107
244 3300048912 Ga0496109_0229320 Ga0496109_0229320_1367_1690 107
245 3300048912 Ga0496109_0455874 Ga0496109_0455874_488_811 107
246 3300048913 Ga0496110_0000454 Ga0496110_0000454_17449_17772 107
247 3300048913 Ga0496110_0248272 Ga0496110_0248272_199_522 107
248 3300048914 Ga0496111_0029894 Ga0496111_0029894_35_358 107
249 3300048915 Ga0496112_1417849 Ga0496112_1417849_170_493 107
250 3300048916 Ga0496113_0037548 Ga0496113_0037548_1425_1748 107
251 3300048918 Ga0496115_0040367 Ga0496115_0040367_488_811 107
252 3300048925 Ga0496122_0002477 Ga0496122_0002477_16224_16547 107
253 3300048926 Ga0496123_0045843 Ga0496123_0045843_1146_1469 107
254 3300048926 Ga0496123_0203334 Ga0496123_0203334_495_818 107
255 3300048927 Ga0496124_0004271 Ga0496124_0004271_4244_4567 107
256 3300048927 Ga0496124_0091461 Ga0496124_0091461_1618_1941 107
257 3300048927 Ga0496124_0123863 Ga0496124_0123863_1569_1892 107
258 3300048927 Ga0496124_0128108 Ga0496124_0128108_136_459 107
259 3300048928 Ga0496125_0190755 Ga0496125_0190755_421_744 107
260 3300048928 Ga0496125_0287098 Ga0496125_0287098_231_554 107
261 3300049459 Ga0495678_000194 Ga0495678_000194_3909_4232 107
262 3300049459 Ga0495678_010953 Ga0495678_010953_178_501 107
263 3300049460 Ga0495682_0007313 Ga0495682_0007313_3021_3344 107
264 3300049665 Ga0501227_006447 Ga0501227_006447_2083_2406 107
265 3300053145 Ga0500586_005495 Ga0500586_005495_2737_3093 107
266 3300061719 Ga0466962_0203579 Ga0466962_0203579_121_444 107
267 3300039447 Ga0436361_0633983 Ga0436361_0633983_145_471 108
268 3300046453 Ga0495627_210894 Ga0495627_210894_62_406 108
269 3300046491 Ga0495584_0021778 Ga0495584_0021778_2763_3128 108
270 3300046492 Ga0495585_0007441 Ga0495585_0007441_4768_5112 108
271 3300046518 Ga0495631_0063784 Ga0495631_0063784_1018_1362 108
272 3300046523 Ga0495644_0208599 Ga0495644_0208599_246_590 108
273 3300046528 Ga0495642_0113800 Ga0495642_0113800_352_696 108
274 3300046615 Ga0495656_0180058 Ga0495656_0180058_330_674 108
275 3300046616 Ga0495668_0009515 Ga0495668_0009515_710_1054 108
276 3300046648 Ga0495611_0022624 Ga0495611_0022624_813_1157 108
277 3300046691 Ga0495670_0224853 Ga0495670_0224853_553_879 108
278 3300046691 Ga0495670_0272405 Ga0495670_0272405_136_474 108
279 3300046692 Ga0495671_0116039 Ga0495671_0116039_334_678 108
280 3300047445 Ga0495677_0052763 Ga0495677_0052763_505_849 108
281 3300047470 Ga0495681_0058307 Ga0495681_0058307_1148_1492 108
282 3300002774 JGI25150J39212_1001605 JGI25150J39212_10016055 109
283 3300002987 JGI25159J45721_1006092 JGI25159J45721_10060923 109
284 3300003354 JGI25160J50197_1009803 JGI25160J50197_10098032 109
285 3300003374 JGI25161J50226_1003566 JGI25161J50226_10035663 109
286 3300003771 Ga0055526_1000018 Ga0055526_1000018160 109
287 3300003771 Ga0055526_1006256 Ga0055526_10062564 109
288 3300003775 Ga0055524_1014094 Ga0055524_10140942 109
289 3300003784 Ga0055534_1007349 Ga0055534_10073494 109
290 3300003791 Ga0055530_10005572 Ga0055530_100055725 109
291 3300003794 Ga0055531_10001761 Ga0055531_1000176110 109
292 3300003794 Ga0055531_10020505 Ga0055531_100205053 109
293 3300005341 Ga0070691_10531389 Ga0070691_105313891 109
294 3300005353 Ga0070669_100447301 Ga0070669_1004473012 109
295 3300005457 Ga0070662_100435045 Ga0070662_1004350451 109
296 3300005615 Ga0070702_101124253 Ga0070702_1011242531 109
297 3300006847 Ga0075431_100332420 Ga0075431_1003324202 109
298 3300006847 Ga0075431_100456231 Ga0075431_1004562312 109
299 3300009093 Ga0105240_10000127 Ga0105240_1000012758 109
300 3300010375 Ga0105239_10000056 Ga0105239_10000056123 109
301 3300012512 Ga0157327_1055861 Ga0157327_10558611 109
302 3300025226 Ga0209674_104736 Ga0209674_1047362 109
303 3300025245 Ga0207425_1056933 Ga0207425_10569332 109
304 3300025253 Ga0209677_109073 Ga0209677_1090732 109
305 3300025258 Ga0209129_1000583 Ga0209129_10005832 109
306 3300025258 Ga0209129_1042005 Ga0209129_10420052 109
307 3300025291 Ga0209675_1011107 Ga0209675_10111072 109
308 3300025292 Ga0209676_1000472 Ga0209676_10004725 109
309 3300025294 Ga0209025_1044308 Ga0209025_10443083 109
310 3300025295 Ga0209564_1000068 Ga0209564_1000068266 109
311 3300025297 Ga0209758_1030442 Ga0209758_10304422 109
312 3300025304 Ga0209257_1002123 Ga0209257_10021237 109
313 3300025304 Ga0209257_1005053 Ga0209257_10050535 109
314 3300025910 Ga0207684_11579823 Ga0207684_115798231 109
315 3300025913 Ga0207695_10000243 Ga0207695_1000024382 109
316 3300025920 Ga0207649_10541036 Ga0207649_105410362 109
317 3300025923 Ga0207681_10062027 Ga0207681_100620272 109
318 3300025933 Ga0207706_10260289 Ga0207706_102602892 109
319 3300031548 Ga0307408_100000961 Ga0307408_10000096118 109
320 3300032002 Ga0307416_102108701 Ga0307416_1021087012 109
321 3300037418 Ga0395900_0613668 Ga0395900_0613668_96_428 109
322 3300044658 Ga0466972_0000073 Ga0466972_0000073_122_451 109
323 3300046457 Ga0495590_0000006 Ga0495590_0000006_217180_217515 109
324 3300046491 Ga0495584_0009106 Ga0495584_0009106_3114_3443 109
325 3300046491 Ga0495584_0018020 Ga0495584_0018020_2022_2351 109
326 3300046492 Ga0495585_0006790 Ga0495585_0006790_881_1228 109
327 3300046492 Ga0495585_0431232 Ga0495585_0431232_164_496 109
328 3300046507 Ga0495606_0004520 Ga0495606_0004520_3914_4243 109
329 3300046528 Ga0495642_0073336 Ga0495642_0073336_431_760 109
330 3300046558 Ga0495633_0006109 Ga0495633_0006109_1908_2255 109
331 3300046558 Ga0495633_0243830 Ga0495633_0243830_234_566 109
332 3300046615 Ga0495656_0536501 Ga0495656_0536501_101_433 109
333 3300046616 Ga0495668_0000243 Ga0495668_0000243_48910_49245 109
334 3300046616 Ga0495668_0000536 Ga0495668_0000536_25453_25788 109
335 3300046660 Ga0495625_0061703 Ga0495625_0061703_1205_1537 109
336 3300046665 Ga0495661_0012739 Ga0495661_0012739_1093_1440 109
337 3300046665 Ga0495661_0023434 Ga0495661_0023434_2010_2342 109
338 3300046691 Ga0495670_0007485 Ga0495670_0007485_304_651 109
339 3300046691 Ga0495670_0020263 Ga0495670_0020263_1715_2053 109
340 3300046691 Ga0495670_0170361 Ga0495670_0170361_750_1085 109
341 3300046692 Ga0495671_0018698 Ga0495671_0018698_2246_2578 109
342 3300046694 Ga0495649_0028285 Ga0495649_0028285_1814_2146 109
343 3300047323 Ga0495683_0001668 Ga0495683_0001668_13622_13951 109
344 3300047443 Ga0495687_204280 Ga0495687_204280_162_497 109
345 3300047472 Ga0495686_0008204 Ga0495686_0008204_1581_1910 109
346 3300048905 Ga0496102_0024270 Ga0496102_0024270_4316_4645 109
347 3300048907 Ga0496104_0034394 Ga0496104_0034394_1788_2120 109
348 3300048908 Ga0496105_0024799 Ga0496105_0024799_674_1006 109
349 3300048913 Ga0496110_1371646 Ga0496110_1371646_171_509 109
350 3300048920 Ga0496117_0044917 Ga0496117_0044917_2496_2828 109
351 3300048921 Ga0496118_0001363 Ga0496118_0001363_33226_33558 109
352 3300048922 Ga0496119_0000158 Ga0496119_0000158_56573_56905 109
353 3300048923 Ga0496120_0000268 Ga0496120_0000268_36980_37312 109
354 3300048924 Ga0496121_0086607 Ga0496121_0086607_879_1208 109
355 3300048924 Ga0496121_0169800 Ga0496121_0169800_941_1270 109
356 3300048927 Ga0496124_0079365 Ga0496124_0079365_2093_2422 109
357 3300049459 Ga0495678_186395 Ga0495678_186395_123_458 109
358 3300049760 Ga0501263_008537 Ga0501263_008537_370_699 109
359 3300050510 nmdc:mga06r32_127624_c1 nmdc:mga06r32_127624_c1_266_595 109
360 3300050510 nmdc:mga06r32_228629_c1 nmdc:mga06r32_228629_c1_633_971 109
361 3300053093 Ga0500651_0704104 Ga0500651_0704104_34_378 109
362 3300053125 Ga0500618_009739 Ga0500618_009739_397_738 109
363 3300055283 Ga0500661_029912 Ga0500661_029912_10_339 109

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pnt-assembly1.cif.gz_A crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution 0.8161 1 108
7dhf-assembly2.cif.gz_B vibrio vulnificus wzb in complex with benzylphosphonate 0.8089 2 109
6y2v-assembly1.cif.gz_A crystal structure of the double mutant l13r i16k of low molecular weight protein tyrosine phosphatase (lmw-ptp) 0.8083 1 108
7dhe-assembly4.cif.gz_D vibrio vulnificus wzb in complex with benzylphosphonate 0.8039 2 109
1pnt-assembly1.cif.gz_A crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution 0.8025 1 108
ID Description Score Start End Superfamily
2wjaB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.799 2 105 3.40.50.2300
af_A7WK41_4_164_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7978 2 106 3.40.50.2300
5gotA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7976 1 106 3.40.50.2300
2cwdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7742 1 106 3.40.50.2300
5gotA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7715 1 106 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2R7PTH3-F1-model_v4 deleted 1.002 1 57
AF-A0A841VHZ0-F1-model_v4 Phosphotyrosine protein phosphatase 0.9997 1 84
AF-A0A6M8FRA9-F1-model_v4 Phosphotyrosine protein phosphatase 0.9989 1 107 GO:0004726
GO:0030946
GO:0140793
AF-A0A244C1W3-F1-model_v4 deleted 0.998 1 48
AF-A0A5X6P2R1-F1-model_v4 Phosphotyrosine protein phosphatase 0.9948 3 70 GO:0004726
GO:0030946
GO:0140793

Feature Viewer

pLDDT pTM Quality
93.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map