F422919

General Info

Members Datasets Scaffolds Average Seq Length
363 234 344 190

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10135514|Ga0075364_101355142
Length 227
Sequence MQLRSKGTTTMTEPVSESGILSPRYPVAPGSNFTTVPFGQTPSQTVGPYLHIGLPWPDGPDVVPVGTEGAVDISVTVVDGHRTPLADAMIETWQADASGRFDHADDPRGRRSPTPAGFRGFGRAVADHTGTATIHTVKPGALPAENDLVEAPHIDIGIFARGVLERLVTRLYFPDETEANASDPVLSQLNDRQAAKLVATATPTGYHLNVVLQDEDPNGDETPFFEL

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2643221569 Achromobacter sp. Root565 Isolate Unclassified
5 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
6 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
7 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
8 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
9 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
10 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
11 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
12 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
13 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
14 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
15 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
16 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
17 2941479691
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
234 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 1.1
Rhizoplane 3.31
Rhizosphere 76.03
Stem 0
Stem Tuber 0
Unclassified 9.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000690 3300003187 Bacteria 28428
2 JGI25151J46595_10003444 3300003187 Bacteria 8750
3 JGI25151J46595_10112151 3300003187 Bacteria 711
4 Ga0055526_1000741 3300003771 Bacteria 24589
5 Ga0055526_1000837 3300003771 Bacteria 23010
6 Ga0055526_1017141 3300003771 Bacteria 2788
7 Ga0055537_1008499 3300003773 Bacteria 2363
8 Ga0055524_1008163 3300003775 Bacteria 4374
9 Ga0055524_1035055 3300003775 Bacteria 1375
10 Ga0055536_1000054 3300003781 Bacteria 108849
11 Ga0055534_1000324 3300003784 Bacteria 31661
12 Ga0055534_1002698 3300003784 Bacteria 5991
13 Ga0070660_100079014 3300005339 Bacteria 2580
14 Ga0070691_10097712 3300005341 Bacteria 1455
15 Ga0070691_10462586 3300005341 Bacteria 726
16 Ga0070673_100554933 3300005364 Bacteria 1044
17 Ga0070688_100948517 3300005365 Unclassified 681
18 Ga0070701_10121195 3300005438 Bacteria 1474
19 Ga0070711_100312324 3300005439 Bacteria 1253
20 Ga0070705_100290125 3300005440 Bacteria 1167
21 Ga0070694_100324047 3300005444 Bacteria 1187
22 Ga0070694_100333275 3300005444 Bacteria 1171
23 Ga0070681_10047709 3300005458 Bacteria 4282
24 Ga0070681_10690853 3300005458 Bacteria 936
25 Ga0070699_101240570 3300005518 Bacteria 684
26 Ga0070697_100630621 3300005536 Bacteria 943
27 Ga0070686_100180333 3300005544 Bacteria 1500
28 Ga0070695_100029963 3300005545 Bacteria 3385
29 Ga0070695_100151455 3300005545 Bacteria 1619
30 Ga0070696_100140140 3300005546 Bacteria 1767
31 Ga0068855_100022092 3300005563 Bacteria 7627
32 Ga0068855_100375796 3300005563 Bacteria 1561
33 Ga0068856_101728127 3300005614 Bacteria 638
34 Ga0070702_100933287 3300005615 Bacteria 682
35 Ga0068864_100349370 3300005618 Bacteria 1395
36 Ga0068870_10322095 3300005840 Bacteria 982
37 Ga0081455_10000017 3300005937 Bacteria 174550
38 Ga0081455_10094707 3300005937 Bacteria 2411
39 Ga0081540_1000059 3300005983 Bacteria 120226
40 Ga0081539_10010740 3300005985 Bacteria 7379
41 Ga0075364_10006298 3300006051 Bacteria 6968
42 Ga0075364_10135514 3300006051 Bacteria 1654
43 Ga0075428_100013384 3300006844 Bacteria 9125
44 Ga0075428_100017151 3300006844 Bacteria 7999
45 Ga0075428_100107062 3300006844 Bacteria 3047
46 Ga0075428_100110742 3300006844 Bacteria 2991
47 Ga0075430_100010560 3300006846 Bacteria 7818
48 Ga0075430_100013055 3300006846 Bacteria 7078
49 Ga0075430_100220802 3300006846 Bacteria 1572
50 Ga0075430_100292132 3300006846 Bacteria 1348
51 Ga0075431_100146564 3300006847 Bacteria 2433
52 Ga0075431_100196264 3300006847 Bacteria 2066
53 Ga0075431_100429156 3300006847 Bacteria 1320
54 Ga0075431_100559526 3300006847 Bacteria 1130
55 Ga0075433_10023924 3300006852 Bacteria 5149
56 Ga0075433_10233311 3300006852 Bacteria 1634
57 Ga0075433_10421129 3300006852 Bacteria 1178
58 Ga0075433_10660750 3300006852 Bacteria 916
59 Ga0075433_10865234 3300006852 Bacteria 789
60 Ga0075434_100000011 3300006871 Bacteria 86261
61 Ga0075434_100029058 3300006871 Bacteria 5437
62 Ga0075434_100144720 3300006871 Bacteria 2397
63 Ga0075434_100848336 3300006871 Bacteria 929
64 Ga0075429_100019449 3300006880 Bacteria 5883
65 Ga0075429_100190961 3300006880 Bacteria 1794
66 Ga0075429_100519377 3300006880 Bacteria 1043
67 Ga0068865_100396537 3300006881 Bacteria 1129
68 Ga0075436_100088926 3300006914 Bacteria 2146
69 Ga0075436_100174451 3300006914 Bacteria 1518
70 Ga0099826_10000036 3300006948 Bacteria 104982
71 Ga0075435_100006635 3300007076 Bacteria 8200
72 Ga0075435_100163929 3300007076 Bacteria 1874
73 Ga0105251_10020078 3300009011 Bacteria 3516
74 Ga0111539_10149263 3300009094 Bacteria 2736
75 Ga0111539_10300608 3300009094 Bacteria 1868
76 Ga0105245_10048738 3300009098 Bacteria 3790
77 Ga0105245_10213503 3300009098 Bacteria 1858
78 Ga0114129_10051456 3300009147 Bacteria 5782
79 Ga0114129_10636836 3300009147 Bacteria 1377
80 Ga0114129_10684080 3300009147 Bacteria 1320
81 Ga0114129_10823214 3300009147 Bacteria 1182
82 Ga0114129_11521898 3300009147 Bacteria 821
83 Ga0105243_10651064 3300009148 Bacteria 1021
84 Ga0105248_12074564 3300009177 Bacteria 646
85 Ga0105249_10216529 3300009553 Bacteria 1882
86 Ga0157370_10028833 3300013104 Bacteria 5457
87 Ga0157370_10055304 3300013104 Bacteria 3781
88 Ga0157369_11122309 3300013105 Bacteria 803
89 Ga0157374_11375326 3300013296 Bacteria 728
90 Ga0157375_10103422 3300013308 Bacteria 2935
91 Ga0163163_11042688 3300014325 Bacteria 881
92 Ga0157380_10106536 3300014326 Bacteria 2346
93 Ga0157380_10587454 3300014326 Bacteria 1099
94 Ga0157379_10236894 3300014968 Bacteria 1655
95 Ga0209026_1005874 3300025250 Bacteria 3163
96 Ga0209565_1000156 3300025263 Bacteria 91427
97 Ga0209565_1001983 3300025263 Bacteria 7986
98 Ga0209130_1020525 3300025284 Bacteria 1510
99 Ga0209675_1000063 3300025291 Bacteria 177603
100 Ga0209675_1014549 3300025291 Bacteria 2389
101 Ga0209676_1000044 3300025292 Bacteria 416215
102 Ga0209025_1000210 3300025294 Bacteria 139745
103 Ga0209025_1000822 3300025294 Bacteria 49588
104 Ga0209025_1002038 3300025294 Bacteria 23035
105 Ga0209025_1014575 3300025294 Bacteria 4818
106 Ga0209025_1029663 3300025294 Bacteria 2640
107 Ga0209564_1000216 3300025295 Bacteria 132523
108 Ga0209564_1000312 3300025295 Bacteria 95547
109 Ga0209564_1000779 3300025295 Bacteria 44233
110 Ga0209758_1005417 3300025297 Bacteria 9845
111 Ga0209050_1005033 3300025298 Bacteria 8570
112 Ga0209256_1000486 3300025299 Bacteria 58822
113 Ga0209256_1000906 3300025299 Bacteria 36323
114 Ga0209051_1005346 3300025303 Bacteria 7543
115 Ga0207653_10118993 3300025885 Bacteria 949
116 Ga0207685_10516959 3300025905 Bacteria 630
117 Ga0207707_10206421 3300025912 Bacteria 1712
118 Ga0207663_10211519 3300025916 Bacteria 1406
119 Ga0207660_10425029 3300025917 Bacteria 1072
120 Ga0207652_10191547 3300025921 Bacteria 1839
121 Ga0207652_10500651 3300025921 Bacteria 1094
122 Ga0207690_10217756 3300025932 Bacteria 1459
123 Ga0207670_10426273 3300025936 Bacteria 1065
124 Ga0207704_10642224 3300025938 Bacteria 873
125 Ga0207711_10552520 3300025941 Bacteria 1074
126 Ga0207667_10335874 3300025949 Bacteria 1542
127 Ga0207667_11421983 3300025949 Bacteria 667
128 Ga0207651_10223836 3300025960 Bacteria 1523
129 Ga0207639_10154199 3300026041 Bacteria 1927
130 Ga0207708_10250923 3300026075 Bacteria 1426
131 Ga0207708_10312581 3300026075 Bacteria 1280
132 Ga0207708_10939573 3300026075 Bacteria 750
133 Ga0207702_10600140 3300026078 Bacteria 1080
134 Ga0207676_10207208 3300026095 Bacteria 1737
135 Ga0209282_1000098 3300027666 Bacteria 59778
136 Ga0207428_10058781 3300027907 Bacteria 3050
137 Ga0307517_10241515 3300028786 Bacteria 1071
138 Ga0307511_10000489 3300030521 Bacteria 42801
139 Ga0307511_10207976 3300030521 Bacteria 1004
140 Ga0307408_100106281 3300031548 Bacteria 2147
141 Ga0307413_10407448 3300031824 Bacteria 1067
142 Ga0307410_10083973 3300031852 Bacteria 2244
143 Ga0307406_10907871 3300031901 Bacteria 750
144 Ga0307412_10000235 3300031911 Bacteria 36152
145 Ga0307409_100229021 3300031995 Bacteria 1683
146 Ga0307416_100091653 3300032002 Bacteria 2611
147 Ga0307414_10859852 3300032004 Bacteria 830
148 Ga0307411_10376814 3300032005 Bacteria 1166
149 Ga0307411_10645984 3300032005 Bacteria 915
150 Ga0307415_100030121 3300032126 Bacteria 3478
151 Ga0307415_100048505 3300032126 Bacteria 2866
152 Ga0373950_0027596 3300034818 Bacteria 1036
153 Ga0373939_0009197 3300035114 Bacteria 2445
154 Ga0373961_0014607 3300035241 Bacteria 1996
155 Ga0373931_0011996 3300035691 Bacteria 4193
156 Ga0373931_0509461 3300035691 Bacteria 777
157 Ga0373935_0342414 3300035692 Bacteria 1065
158 Ga0373937_0019780 3300036401 Bacteria 6030
159 Ga0373925_0080887 3300037068 Bacteria 2470
160 Ga0373925_0432944 3300037068 Bacteria 1076
161 Ga0395905_0333300 3300037471 Bacteria 1408
162 Ga0439436_0036212 3300041404 Bacteria 1424
163 Ga0466969_0000729 3300044656 Bacteria 17780
164 Ga0466966_0003315 3300044684 Bacteria 10609
165 Ga0466961_0010333 3300044693 Bacteria 5951
166 Ga0466970_0008722 3300044765 Bacteria 5107
167 Ga0466970_0053166 3300044765 Bacteria 2163
168 Ga0466959_0001482 3300045049 Bacteria 14384
169 Ga0495592_0005076 3300046454 Bacteria 9694
170 Ga0495590_0140618 3300046457 Bacteria 871
171 Ga0495653_0040526 3300046463 Bacteria 3640
172 Ga0495582_0165886 3300046473 Bacteria 1257
173 Ga0495605_0002172 3300046474 Bacteria 12251
174 Ga0495639_0151720 3300046475 Bacteria 1118
175 Ga0495662_0005504 3300046476 Bacteria 6340
176 Ga0495664_0216863 3300046477 Bacteria 1159
177 Ga0495584_0028285 3300046491 Bacteria 2840
178 Ga0495596_0000145 3300046500 Bacteria 48986
179 Ga0495607_0000021 3300046501 Bacteria 164571
180 Ga0495607_0003718 3300046501 Bacteria 11564
181 Ga0495608_0000913 3300046511 Bacteria 20720
182 Ga0495610_0000358 3300046512 Bacteria 47626
183 Ga0495616_0010431 3300046513 Bacteria 5377
184 Ga0495618_0013286 3300046514 Bacteria 5012
185 Ga0495628_0033080 3300046516 Bacteria 4169
186 Ga0495630_0007100 3300046517 Bacteria 7979
187 Ga0495643_0331743 3300046522 Bacteria 685
188 Ga0495648_0024963 3300046524 Bacteria 4057
189 Ga0495642_0097442 3300046528 Bacteria 1249
190 Ga0495640_0001515 3300046533 Bacteria 18292
191 Ga0495640_0239484 3300046533 Bacteria 1139
192 Ga0495586_0001426 3300046535 Bacteria 13223
193 Ga0495586_0051535 3300046535 Bacteria 2228
194 Ga0495587_0010381 3300046536 Bacteria 5930
195 Ga0495609_0009934 3300046538 Bacteria 4585
196 Ga0495597_0053502 3300046542 Bacteria 1775
197 Ga0495645_0058901 3300046543 Bacteria 2786
198 Ga0495645_0060958 3300046543 Bacteria 2734
199 Ga0495667_0004252 3300046559 Bacteria 9648
200 Ga0495634_0010794 3300046642 Bacteria 6683
201 Ga0495635_0032448 3300046663 Bacteria 3623
202 Ga0495661_0011823 3300046665 Bacteria 5912
203 Ga0495599_0013253 3300046678 Bacteria 5094
204 Ga0495658_0520231 3300046683 Bacteria 762
205 Ga0495613_0004991 3300046689 Bacteria 9966
206 Ga0495624_0064833 3300046690 Bacteria 2283
207 Ga0495671_0006024 3300046692 Bacteria 7046
208 Ga0495649_0009020 3300046694 Bacteria 5955
209 Ga0495600_0155310 3300046809 Bacteria 1480
210 Ga0495604_0006837 3300047317 Bacteria 9036
211 Ga0495636_0021466 3300047318 Bacteria 2607
212 Ga0495674_0625994 3300047319 Bacteria 850
213 Ga0495672_0003805 3300047320 Bacteria 12705
214 Ga0495680_0001187 3300047322 Bacteria 28585
215 Ga0495687_039283 3300047443 Bacteria 2095
216 Ga0495685_002240 3300047447 Bacteria 6026
217 Ga0495673_0081574 3300047469 Bacteria 1339
218 Ga0495614_0168027 3300048089 Bacteria 983
219 Ga0496102_0135756 3300048905 Bacteria 2305
220 Ga0496102_0376611 3300048905 Bacteria 1336
221 Ga0496104_0013167 3300048907 Bacteria 7457
222 Ga0496106_0588689 3300048909 Bacteria 891
223 Ga0496108_0047099 3300048911 Bacteria 3604
224 Ga0496108_0393190 3300048911 Bacteria 1211
225 Ga0496110_0206739 3300048913 Bacteria 1784
226 Ga0496111_0495537 3300048914 Bacteria 899
227 Ga0496112_0062223 3300048915 Bacteria 3681
228 Ga0496112_0579850 3300048915 Bacteria 1054
229 Ga0496115_0005378 3300048918 Bacteria 9315
230 Ga0496116_0003697 3300048919 Bacteria 14980
231 Ga0496116_0009306 3300048919 Bacteria 8393
232 Ga0496116_0013463 3300048919 Bacteria 6593
233 Ga0496116_0026738 3300048919 Bacteria 4209
234 Ga0496116_0085644 3300048919 Bacteria 1936
235 Ga0496119_0059557 3300048922 Bacteria 2293
236 Ga0496121_0000444 3300048924 Bacteria 81596
237 Ga0496121_0023152 3300048924 Bacteria 5996
238 Ga0496121_0302204 3300048924 Bacteria 1085
239 Ga0496122_0000214 3300048925 Bacteria 129132
240 Ga0496122_0006772 3300048925 Bacteria 13028
241 Ga0496122_0061760 3300048925 Bacteria 2748
242 Ga0496123_0000289 3300048926 Bacteria 98253
243 Ga0496123_0001730 3300048926 Bacteria 28930
244 Ga0496123_0022278 3300048926 Bacteria 4889
245 Ga0496124_0038248 3300048927 Bacteria 4168
246 Ga0496124_0040417 3300048927 Bacteria 4033
247 Ga0496124_0199476 3300048927 Bacteria 1523
248 Ga0496124_0429603 3300048927 Bacteria 907
249 Ga0496125_0033963 3300048928 Bacteria 4504
250 Ga0496126_0127385 3300048929 Bacteria 2202
251 Ga0501031_0051723 3300049568 Bacteria 2676
252 Ga0501032_0536423 3300049569 Bacteria 746
253 Ga0501033_0137216 3300049570 Bacteria 1770
254 Ga0501033_0178187 3300049570 Bacteria 1524
255 Ga0501033_0236093 3300049570 Unclassified 1298
256 Ga0501034_0001290 3300049571 Bacteria 33888
257 Ga0501034_0061632 3300049571 Bacteria 3766
258 Ga0501036_0051168 3300049572 Bacteria 3498
259 Ga0501036_0418332 3300049572 Bacteria 1117
260 Ga0501037_0162188 3300049573 Bacteria 1593
261 Ga0501038_0174398 3300049574 Bacteria 1738
262 Ga0501038_0194556 3300049574 Bacteria 1630
263 Ga0501039_0006861 3300049575 Bacteria 8663
264 Ga0501039_0184216 3300049575 Bacteria 1642
265 Ga0501040_0000259 3300049576 Bacteria 30940
266 Ga0501040_0405290 3300049576 Bacteria 979
267 Ga0501041_0000491 3300049577 Bacteria 20231
268 Ga0501041_0069671 3300049577 Bacteria 2158
269 Ga0501042_0001520 3300049578 Bacteria 13731
270 Ga0501042_0145776 3300049578 Bacteria 1707
271 Ga0501043_0015672 3300049579 Bacteria 5941
272 Ga0501043_0239863 3300049579 Bacteria 1398
273 Ga0501043_0513823 3300049579 Bacteria 893
274 Ga0501046_0073253 3300049580 Bacteria 2658
275 Ga0501046_0185135 3300049580 Bacteria 1555
276 Ga0501047_0091361 3300049581 Bacteria 2922
277 Ga0501047_0569066 3300049581 Bacteria 956
278 Ga0501047_1011309 3300049581 Bacteria 644
279 Ga0501048_0002303 3300049582 Bacteria 14567
280 Ga0501048_0589234 3300049582 Unclassified 798
281 Ga0501067_0009023 3300049583 Bacteria 5526
282 Ga0501068_0071819 3300049584 Bacteria 2113
283 Ga0501069_0151222 3300049585 Bacteria 1334
284 Ga0501071_0017040 3300049587 Bacteria 5004
285 Ga0501071_0119999 3300049587 Bacteria 1949
286 Ga0501072_0012113 3300049588 Bacteria 6587
287 Ga0501072_0425523 3300049588 Bacteria 1052
288 Ga0501074_0119546 3300049590 Bacteria 1884
289 Ga0501075_0000854 3300049591 Bacteria 19222
290 Ga0501075_0163269 3300049591 Bacteria 1699
291 Ga0501076_0001606 3300049592 Bacteria 15222
292 Ga0501076_0703143 3300049592 Unclassified 834
293 Ga0501077_0036972 3300049593 Bacteria 3110
294 Ga0501077_0190996 3300049593 Bacteria 1301
295 Ga0501079_0000169 3300049741 Bacteria 36466
296 Ga0501079_0052100 3300049741 Bacteria 3160
297 Ga0501079_0229917 3300049741 Bacteria 1449
298 Ga0501080_0046817 3300049742 Bacteria 4026
299 Ga0501080_0589796 3300049742 Bacteria 987
300 Ga0501081_0000098 3300049743 Bacteria 36248
301 Ga0501083_0000224 3300049744 Bacteria 36571
302 Ga0501083_0335608 3300049744 Bacteria 983
303 Ga0501035_0180022 3300049822 Bacteria 1821
304 Ga0501035_0430247 3300049822 Bacteria 1094
305 Ga0501044_0678284 3300049823 Bacteria 917
306 Ga0501045_0000786 3300049824 Bacteria 20411
307 Ga0501045_0950127 3300049824 Bacteria 631
308 nmdc:mga00v17_13961_c1 3300050491 Bacteria 4472
309 nmdc:mga00v17_153670_c1 3300050491 Bacteria 1479
310 nmdc:mga05p37_58920_c1 3300050507 Bacteria 4729
311 nmdc:mga05p37_854960_c1 3300050507 Bacteria 987
312 nmdc:mga09592_30572_c1 3300050508 Bacteria 4482
313 nmdc:mga09592_436154_c1 3300050508 Bacteria 1131
314 nmdc:mga09592_73652_c1 3300050508 Bacteria 2902
315 nmdc:mga0qj67_210904_c1 3300050509 Bacteria 1578
316 nmdc:mga0qj67_232628_c1 3300050509 Bacteria 1495
317 nmdc:mga0qj67_7968_c1 3300050509 Bacteria 7832
318 nmdc:mga0qj67_8652_c1 3300050509 Bacteria 7552
319 nmdc:mga06r32_11919_c1 3300050510 Bacteria 7832
320 nmdc:mga06r32_141748_c1 3300050510 Bacteria 2380
321 nmdc:mga06r32_325081_c1 3300050510 Bacteria 1523
322 nmdc:mga08y16_246637_c1 3300050511 Bacteria 1845
323 nmdc:mga0n895_10050_c1 3300050512 Bacteria 8328
324 nmdc:mga0n895_1060997_c1 3300050512 Bacteria 789
325 nmdc:mga0n895_17928_c1 3300050512 Bacteria 6542
326 nmdc:mga0n895_327768_c1 3300050512 Bacteria 1551
327 nmdc:mga0n895_75248_c1 3300050512 Bacteria 3356
328 nmdc:mga0rr50_4606_c1 3300050513 Bacteria 8122
329 nmdc:mga08x19_239898_c1 3300050514 Bacteria 1249
330 nmdc:mga08x19_46022_c1 3300050514 Bacteria 2789
331 nmdc:mga0a205_10447_c1 3300050515 Bacteria 8528
332 nmdc:mga0a205_145417_c1 3300050515 Bacteria 2270
333 nmdc:mga0a205_365472_c1 3300050515 Bacteria 1309
334 nmdc:mga0a205_783956_c1 3300050515 Bacteria 801
335 Ga0495619_0031854 3300053085 Bacteria 3418
336 Ga0495619_0129262 3300053085 Bacteria 1735
337 Ga0501084_0006102 3300054114 Bacteria 9907
338 Ga0501084_0214170 3300054114 Bacteria 1625
339 Ga0501084_0218734 3300054114 Bacteria 1607
340 Ga0501084_0279694 3300054114 Bacteria 1409
341 Ga0501082_0001871 3300060353 Bacteria 18521
342 Ga0501082_0198944 3300060353 Bacteria 1743
343 Ga0501082_0802601 3300060353 Bacteria 823
344 Ga0530510_0339036 3300061734 Bacteria 1128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100312324 Ga0070711_1003123242 165
2 3300025916 Ga0207663_10211519 Ga0207663_102115192 165
3 3300046543 Ga0495645_0058901 Ga0495645_0058901_1208_1822 165
4 3300046528 Ga0495642_0097442 Ga0495642_0097442_537_1049 170
5 3300005444 Ga0070694_100324047 Ga0070694_1003240472 177
6 3300049569 Ga0501032_0536423 Ga0501032_0536423_63_614 177
7 3300049570 Ga0501033_0178187 Ga0501033_0178187_288_839 177
8 3300049571 Ga0501034_0061632 Ga0501034_0061632_938_1489 177
9 3300049572 Ga0501036_0418332 Ga0501036_0418332_553_1104 177
10 3300049573 Ga0501037_0162188 Ga0501037_0162188_612_1163 177
11 3300049574 Ga0501038_0174398 Ga0501038_0174398_786_1337 177
12 3300049575 Ga0501039_0184216 Ga0501039_0184216_164_715 177
13 3300049579 Ga0501043_0239863 Ga0501043_0239863_823_1374 177
14 3300049579 Ga0501043_0513823 Ga0501043_0513823_174_725 177
15 3300049580 Ga0501046_0185135 Ga0501046_0185135_144_695 177
16 3300049581 Ga0501047_0091361 Ga0501047_0091361_1722_2273 177
17 3300049581 Ga0501047_0569066 Ga0501047_0569066_338_889 177
18 3300049581 Ga0501047_1011309 Ga0501047_1011309_28_579 177
19 3300049583 Ga0501067_0009023 Ga0501067_0009023_4749_5300 177
20 3300049590 Ga0501074_0119546 Ga0501074_0119546_407_958 177
21 3300049742 Ga0501080_0589796 Ga0501080_0589796_73_624 177
22 3300049744 Ga0501083_0000224 Ga0501083_0000224_27215_27766 177
23 3300049822 Ga0501035_0180022 Ga0501035_0180022_239_790 177
24 3300049822 Ga0501035_0430247 Ga0501035_0430247_523_1074 177
25 3300049823 Ga0501044_0678284 Ga0501044_0678284_303_854 177
26 3300054114 Ga0501084_0214170 Ga0501084_0214170_1048_1599 177
27 3300060353 Ga0501082_0802601 Ga0501082_0802601_199_750 177
28 3300050507 nmdc:mga05p37_58920_c1 nmdc:mga05p37_58920_c1_467_1051 178
29 iso_pu_bacteria 2558860280 2559425300 178
30 3300049568 Ga0501031_0051723 Ga0501031_0051723_1015_1575 180
31 3300049570 Ga0501033_0137216 Ga0501033_0137216_14_574 180
32 3300049572 Ga0501036_0051168 Ga0501036_0051168_2426_2986 180
33 3300049574 Ga0501038_0194556 Ga0501038_0194556_1016_1576 180
34 3300049575 Ga0501039_0006861 Ga0501039_0006861_5702_6262 180
35 3300049576 Ga0501040_0000259 Ga0501040_0000259_30340_30900 180
36 3300049577 Ga0501041_0000491 Ga0501041_0000491_5570_6130 180
37 3300049578 Ga0501042_0001520 Ga0501042_0001520_7638_8198 180
38 3300049579 Ga0501043_0015672 Ga0501043_0015672_1534_2094 180
39 3300049582 Ga0501048_0002303 Ga0501048_0002303_8314_8874 180
40 3300049584 Ga0501068_0071819 Ga0501068_0071819_456_1016 180
41 3300049587 Ga0501071_0017040 Ga0501071_0017040_169_729 180
42 3300049588 Ga0501072_0012113 Ga0501072_0012113_486_1046 180
43 3300049591 Ga0501075_0000854 Ga0501075_0000854_3448_4008 180
44 3300049592 Ga0501076_0001606 Ga0501076_0001606_5546_6106 180
45 3300049593 Ga0501077_0036972 Ga0501077_0036972_248_808 180
46 3300049741 Ga0501079_0000169 Ga0501079_0000169_30358_30918 180
47 3300049742 Ga0501080_0046817 Ga0501080_0046817_11_571 180
48 3300049743 Ga0501081_0000098 Ga0501081_0000098_5379_5939 180
49 3300049824 Ga0501045_0000786 Ga0501045_0000786_5678_6238 180
50 3300054114 Ga0501084_0006102 Ga0501084_0006102_8761_9321 180
51 3300060353 Ga0501082_0001871 Ga0501082_0001871_5475_6035 180
52 3300061734 Ga0530510_0339036 Ga0530510_0339036_271_831 180
53 3300031824 Ga0307413_10407448 Ga0307413_104074482 181
54 3300031852 Ga0307410_10083973 Ga0307410_100839732 181
55 3300031995 Ga0307409_100229021 Ga0307409_1002290212 181
56 3300032002 Ga0307416_100091653 Ga0307416_1000916533 181
57 3300032004 Ga0307414_10859852 Ga0307414_108598522 181
58 3300032005 Ga0307411_10645984 Ga0307411_106459842 181
59 3300032126 Ga0307415_100030121 Ga0307415_1000301212 181
60 3300032126 Ga0307415_100048505 Ga0307415_1000485053 181
61 3300005563 Ga0068855_100375796 Ga0068855_1003757961 182
62 3300005614 Ga0068856_101728127 Ga0068856_1017281271 182
63 3300005840 Ga0068870_10322095 Ga0068870_103220952 182
64 3300009098 Ga0105245_10048738 Ga0105245_100487382 182
65 3300009553 Ga0105249_10216529 Ga0105249_102165292 182
66 3300013105 Ga0157369_11122309 Ga0157369_111223092 182
67 3300025949 Ga0207667_11421983 Ga0207667_114219831 182
68 3300026041 Ga0207639_10154199 Ga0207639_101541992 182
69 3300026078 Ga0207702_10600140 Ga0207702_106001402 182
70 3300028786 Ga0307517_10241515 Ga0307517_102415151 182
71 3300030521 Ga0307511_10000489 Ga0307511_1000048916 182
72 3300030521 Ga0307511_10207976 Ga0307511_102079761 182
73 3300032005 Ga0307411_10376814 Ga0307411_103768142 182
74 3300037068 Ga0373925_0080887 Ga0373925_0080887_1632_2186 182
75 3300044656 Ga0466969_0000729 Ga0466969_0000729_5246_5800 182
76 3300044684 Ga0466966_0003315 Ga0466966_0003315_4683_5237 182
77 3300044693 Ga0466961_0010333 Ga0466961_0010333_1182_1736 182
78 3300044765 Ga0466970_0008722 Ga0466970_0008722_3737_4291 182
79 3300044765 Ga0466970_0053166 Ga0466970_0053166_1483_2037 182
80 3300045049 Ga0466959_0001482 Ga0466959_0001482_7800_8354 182
81 3300048919 Ga0496116_0026738 Ga0496116_0026738_1010_1615 182
82 iso_pu_bacteria 2738543034 2739363793 182
83 iso_pu_bacteria 2772190715 2772642079 182
84 iso_pu_bacteria 2866065130 2866068752 182
85 iso_pu_bacteria 2880489317 2880490456 182
86 iso_pu_bacteria 2880495981 2880502062 182
87 iso_pu_bacteria 2904765812 2904769577 182
88 iso_pu_bacteria 2904770941 2904773143 182
89 iso_pu_bacteria 2908811453 2908814025 182
90 iso_pu_bacteria 2919420072 2919422500 182
91 iso_pu_bacteria 2919432681 2919435247 182
92 iso_pu_bacteria 8003870546 8003873708 182
93 iso_pu_bacteria 8054727385 8054734100 182
94 3300047443 Ga0495687_039283 Ga0495687_039283_612_1187 183
95 3300005339 Ga0070660_100079014 Ga0070660_1000790142 184
96 3300005341 Ga0070691_10462586 Ga0070691_104625861 184
97 3300005444 Ga0070694_100333275 Ga0070694_1003332752 184
98 3300005536 Ga0070697_100630621 Ga0070697_1006306212 184
99 3300005544 Ga0070686_100180333 Ga0070686_1001803331 184
100 3300005545 Ga0070695_100151455 Ga0070695_1001514552 184
101 3300005937 Ga0081455_10000017 Ga0081455_10000017123 184
102 3300005983 Ga0081540_1000059 Ga0081540_100005972 184
103 3300005985 Ga0081539_10010740 Ga0081539_100107402 184
104 3300006844 Ga0075428_100013384 Ga0075428_1000133843 184
105 3300006844 Ga0075428_100017151 Ga0075428_1000171519 184
106 3300006844 Ga0075428_100107062 Ga0075428_1001070622 184
107 3300006844 Ga0075428_100110742 Ga0075428_1001107422 184
108 3300006846 Ga0075430_100010560 Ga0075430_10001056010 184
109 3300006846 Ga0075430_100220802 Ga0075430_1002208022 184
110 3300006846 Ga0075430_100292132 Ga0075430_1002921322 184
111 3300006847 Ga0075431_100196264 Ga0075431_1001962642 184
112 3300006847 Ga0075431_100429156 Ga0075431_1004291561 184
113 3300006847 Ga0075431_100559526 Ga0075431_1005595262 184
114 3300006852 Ga0075433_10023924 Ga0075433_100239246 184
115 3300006852 Ga0075433_10421129 Ga0075433_104211292 184
116 3300006852 Ga0075433_10660750 Ga0075433_106607501 184
117 3300006871 Ga0075434_100029058 Ga0075434_1000290586 184
118 3300006871 Ga0075434_100144720 Ga0075434_1001447202 184
119 3300006871 Ga0075434_100848336 Ga0075434_1008483362 184
120 3300006880 Ga0075429_100019449 Ga0075429_1000194492 184
121 3300006880 Ga0075429_100519377 Ga0075429_1005193772 184
122 3300006881 Ga0068865_100396537 Ga0068865_1003965372 184
123 3300006914 Ga0075436_100174451 Ga0075436_1001744512 184
124 3300009094 Ga0111539_10149263 Ga0111539_101492633 184
125 3300009094 Ga0111539_10300608 Ga0111539_103006082 184
126 3300009098 Ga0105245_10213503 Ga0105245_102135032 184
127 3300009147 Ga0114129_10051456 Ga0114129_100514565 184
128 3300009147 Ga0114129_10684080 Ga0114129_106840802 184
129 3300009147 Ga0114129_10823214 Ga0114129_108232142 184
130 3300009147 Ga0114129_11521898 Ga0114129_115218982 184
131 3300009148 Ga0105243_10651064 Ga0105243_106510641 184
132 3300013104 Ga0157370_10055304 Ga0157370_100553043 184
133 3300013296 Ga0157374_11375326 Ga0157374_113753262 184
134 3300013308 Ga0157375_10103422 Ga0157375_101034223 184
135 3300014325 Ga0163163_11042688 Ga0163163_110426881 184
136 3300014326 Ga0157380_10106536 Ga0157380_101065364 184
137 3300014326 Ga0157380_10587454 Ga0157380_105874542 184
138 3300014968 Ga0157379_10236894 Ga0157379_102368943 184
139 3300025250 Ga0209026_1005874 Ga0209026_10058742 184
140 3300025885 Ga0207653_10118993 Ga0207653_101189932 184
141 3300025921 Ga0207652_10500651 Ga0207652_105006512 184
142 3300025941 Ga0207711_10552520 Ga0207711_105525202 184
143 3300026075 Ga0207708_10250923 Ga0207708_102509232 184
144 3300026075 Ga0207708_10312581 Ga0207708_103125812 184
145 3300027907 Ga0207428_10058781 Ga0207428_100587812 184
146 3300031901 Ga0307406_10907871 Ga0307406_109078711 184
147 3300034818 Ga0373950_0027596 Ga0373950_0027596_402_986 184
148 3300035114 Ga0373939_0009197 Ga0373939_0009197_1642_2226 184
149 3300035241 Ga0373961_0014607 Ga0373961_0014607_361_945 184
150 3300035691 Ga0373931_0011996 Ga0373931_0011996_2457_3041 184
151 3300035691 Ga0373931_0509461 Ga0373931_0509461_107_691 184
152 3300035692 Ga0373935_0342414 Ga0373935_0342414_436_1020 184
153 3300037068 Ga0373925_0432944 Ga0373925_0432944_188_772 184
154 3300048905 Ga0496102_0376611 Ga0496102_0376611_175_768 184
155 3300048907 Ga0496104_0013167 Ga0496104_0013167_898_1491 184
156 3300048909 Ga0496106_0588689 Ga0496106_0588689_43_627 184
157 3300048911 Ga0496108_0047099 Ga0496108_0047099_1174_1767 184
158 3300048911 Ga0496108_0393190 Ga0496108_0393190_351_935 184
159 3300048913 Ga0496110_0206739 Ga0496110_0206739_754_1338 184
160 3300048914 Ga0496111_0495537 Ga0496111_0495537_86_679 184
161 3300048915 Ga0496112_0062223 Ga0496112_0062223_29_622 184
162 3300048918 Ga0496115_0005378 Ga0496115_0005378_5824_6417 184
163 3300049570 Ga0501033_0236093 Ga0501033_0236093_187_771 184
164 3300049576 Ga0501040_0405290 Ga0501040_0405290_63_647 184
165 3300049577 Ga0501041_0069671 Ga0501041_0069671_1160_1744 184
166 3300049578 Ga0501042_0145776 Ga0501042_0145776_494_1078 184
167 3300049580 Ga0501046_0073253 Ga0501046_0073253_1977_2561 184
168 3300049582 Ga0501048_0589234 Ga0501048_0589234_78_662 184
169 3300049585 Ga0501069_0151222 Ga0501069_0151222_392_976 184
170 3300049587 Ga0501071_0119999 Ga0501071_0119999_591_1175 184
171 3300049588 Ga0501072_0425523 Ga0501072_0425523_65_649 184
172 3300049591 Ga0501075_0163269 Ga0501075_0163269_836_1420 184
173 3300049592 Ga0501076_0703143 Ga0501076_0703143_57_641 184
174 3300049593 Ga0501077_0190996 Ga0501077_0190996_703_1287 184
175 3300049741 Ga0501079_0052100 Ga0501079_0052100_1256_1840 184
176 3300049741 Ga0501079_0229917 Ga0501079_0229917_530_1114 184
177 3300049744 Ga0501083_0335608 Ga0501083_0335608_135_719 184
178 3300049824 Ga0501045_0950127 Ga0501045_0950127_16_600 184
179 3300050507 nmdc:mga05p37_854960_c1 nmdc:mga05p37_854960_c1_150_734 184
180 3300050508 nmdc:mga09592_30572_c1 nmdc:mga09592_30572_c1_3459_4043 184
181 3300050508 nmdc:mga09592_436154_c1 nmdc:mga09592_436154_c1_219_812 184
182 3300050509 nmdc:mga0qj67_210904_c1 nmdc:mga0qj67_210904_c1_534_1118 184
183 3300050509 nmdc:mga0qj67_232628_c1 nmdc:mga0qj67_232628_c1_193_777 184
184 3300050509 nmdc:mga0qj67_7968_c1 nmdc:mga0qj67_7968_c1_468_1052 184
185 3300050510 nmdc:mga06r32_11919_c1 nmdc:mga06r32_11919_c1_468_1052 184
186 3300050510 nmdc:mga06r32_325081_c1 nmdc:mga06r32_325081_c1_808_1392 184
187 3300050511 nmdc:mga08y16_246637_c1 nmdc:mga08y16_246637_c1_421_1005 184
188 3300050512 nmdc:mga0n895_1060997_c1 nmdc:mga0n895_1060997_c1_74_640 184
189 3300050512 nmdc:mga0n895_17928_c1 nmdc:mga0n895_17928_c1_4476_5060 184
190 3300050512 nmdc:mga0n895_327768_c1 nmdc:mga0n895_327768_c1_188_772 184
191 3300050512 nmdc:mga0n895_75248_c1 nmdc:mga0n895_75248_c1_665_1249 184
192 3300050514 nmdc:mga08x19_239898_c1 nmdc:mga08x19_239898_c1_650_1234 184
193 3300050515 nmdc:mga0a205_10447_c1 nmdc:mga0a205_10447_c1_6210_6794 184
194 3300050515 nmdc:mga0a205_145417_c1 nmdc:mga0a205_145417_c1_1456_2040 184
195 3300053085 Ga0495619_0031854 Ga0495619_0031854_677_1261 184
196 3300054114 Ga0501084_0218734 Ga0501084_0218734_347_931 184
197 3300054114 Ga0501084_0279694 Ga0501084_0279694_149_733 184
198 3300060353 Ga0501082_0198944 Ga0501082_0198944_447_1031 184
199 3300005937 Ga0081455_10094707 Ga0081455_100947073 185
200 3300006051 Ga0075364_10006298 Ga0075364_100062984 185
201 3300006051 Ga0075364_10135514 Ga0075364_101355142 185
202 3300050491 nmdc:mga00v17_13961_c1 nmdc:mga00v17_13961_c1_1976_2629 185
203 3300050491 nmdc:mga00v17_153670_c1 nmdc:mga00v17_153670_c1_416_1069 185
204 iso_pu_bacteria 2513237165 2514042914 185
205 iso_pu_bacteria 2599185292 2599905846 185
206 iso_pu_bacteria 2643221569 2643860744 185
207 iso_pu_bacteria 2857537821 2857540353 185
208 iso_pu_bacteria 2901300506 2901303804 185
209 iso_pu_bacteria 2941479691 2941482697 185
210 3300005341 Ga0070691_10097712 Ga0070691_100977122 186
211 3300005364 Ga0070673_100554933 Ga0070673_1005549332 186
212 3300005365 Ga0070688_100948517 Ga0070688_1009485171 186
213 3300005438 Ga0070701_10121195 Ga0070701_101211952 186
214 3300005440 Ga0070705_100290125 Ga0070705_1002901252 186
215 3300005458 Ga0070681_10047709 Ga0070681_100477095 186
216 3300005458 Ga0070681_10690853 Ga0070681_106908532 186
217 3300005518 Ga0070699_101240570 Ga0070699_1012405701 186
218 3300005545 Ga0070695_100029963 Ga0070695_1000299632 186
219 3300005546 Ga0070696_100140140 Ga0070696_1001401402 186
220 3300005563 Ga0068855_100022092 Ga0068855_1000220927 186
221 3300005615 Ga0070702_100933287 Ga0070702_1009332871 186
222 3300005618 Ga0068864_100349370 Ga0068864_1003493702 186
223 3300006846 Ga0075430_100013055 Ga0075430_1000130553 186
224 3300006847 Ga0075431_100146564 Ga0075431_1001465644 186
225 3300006852 Ga0075433_10233311 Ga0075433_102333112 186
226 3300006852 Ga0075433_10865234 Ga0075433_108652341 186
227 3300006871 Ga0075434_100000011 Ga0075434_1000000114 186
228 3300006880 Ga0075429_100190961 Ga0075429_1001909611 186
229 3300006914 Ga0075436_100088926 Ga0075436_1000889263 186
230 3300007076 Ga0075435_100006635 Ga0075435_1000066356 186
231 3300007076 Ga0075435_100163929 Ga0075435_1001639292 186
232 3300009147 Ga0114129_10636836 Ga0114129_106368362 186
233 3300009177 Ga0105248_12074564 Ga0105248_120745641 186
234 3300013104 Ga0157370_10028833 Ga0157370_100288332 186
235 3300025905 Ga0207685_10516959 Ga0207685_105169591 186
236 3300025912 Ga0207707_10206421 Ga0207707_102064212 186
237 3300025917 Ga0207660_10425029 Ga0207660_104250291 186
238 3300025921 Ga0207652_10191547 Ga0207652_101915472 186
239 3300025932 Ga0207690_10217756 Ga0207690_102177561 186
240 3300025936 Ga0207670_10426273 Ga0207670_104262732 186
241 3300025938 Ga0207704_10642224 Ga0207704_106422242 186
242 3300025949 Ga0207667_10335874 Ga0207667_103358742 186
243 3300025960 Ga0207651_10223836 Ga0207651_102238362 186
244 3300026075 Ga0207708_10939573 Ga0207708_109395731 186
245 3300026095 Ga0207676_10207208 Ga0207676_102072082 186
246 3300031548 Ga0307408_100106281 Ga0307408_1001062812 186
247 3300036401 Ga0373937_0019780 Ga0373937_0019780_1062_1625 186
248 3300046454 Ga0495592_0005076 Ga0495592_0005076_6152_6715 186
249 3300046463 Ga0495653_0040526 Ga0495653_0040526_1511_2074 186
250 3300046473 Ga0495582_0165886 Ga0495582_0165886_182_745 186
251 3300046475 Ga0495639_0151720 Ga0495639_0151720_15_578 186
252 3300046476 Ga0495662_0005504 Ga0495662_0005504_2000_2563 186
253 3300046477 Ga0495664_0216863 Ga0495664_0216863_319_882 186
254 3300046511 Ga0495608_0000913 Ga0495608_0000913_14704_15267 186
255 3300046514 Ga0495618_0013286 Ga0495618_0013286_3240_3803 186
256 3300046516 Ga0495628_0033080 Ga0495628_0033080_2197_2760 186
257 3300046517 Ga0495630_0007100 Ga0495630_0007100_179_742 186
258 3300046533 Ga0495640_0001515 Ga0495640_0001515_12106_12669 186
259 3300046533 Ga0495640_0239484 Ga0495640_0239484_209_772 186
260 3300046535 Ga0495586_0001426 Ga0495586_0001426_11784_12347 186
261 3300046535 Ga0495586_0051535 Ga0495586_0051535_1538_2101 186
262 3300046536 Ga0495587_0010381 Ga0495587_0010381_2504_3067 186
263 3300046543 Ga0495645_0060958 Ga0495645_0060958_589_1152 186
264 3300046559 Ga0495667_0004252 Ga0495667_0004252_4823_5386 186
265 3300046642 Ga0495634_0010794 Ga0495634_0010794_1015_1578 186
266 3300046663 Ga0495635_0032448 Ga0495635_0032448_2887_3450 186
267 3300046678 Ga0495599_0013253 Ga0495599_0013253_266_829 186
268 3300046683 Ga0495658_0520231 Ga0495658_0520231_74_637 186
269 3300046689 Ga0495613_0004991 Ga0495613_0004991_5270_5833 186
270 3300046690 Ga0495624_0064833 Ga0495624_0064833_1636_2199 186
271 3300046809 Ga0495600_0155310 Ga0495600_0155310_350_913 186
272 3300047317 Ga0495604_0006837 Ga0495604_0006837_877_1440 186
273 3300047319 Ga0495674_0625994 Ga0495674_0625994_16_579 186
274 3300047322 Ga0495680_0001187 Ga0495680_0001187_16040_16603 186
275 3300048089 Ga0495614_0168027 Ga0495614_0168027_224_787 186
276 3300050508 nmdc:mga09592_73652_c1 nmdc:mga09592_73652_c1_1507_2070 186
277 3300050509 nmdc:mga0qj67_8652_c1 nmdc:mga0qj67_8652_c1_5228_5791 186
278 3300050510 nmdc:mga06r32_141748_c1 nmdc:mga06r32_141748_c1_1607_2170 186
279 3300050512 nmdc:mga0n895_10050_c1 nmdc:mga0n895_10050_c1_7502_8065 186
280 3300050513 nmdc:mga0rr50_4606_c1 nmdc:mga0rr50_4606_c1_6557_7120 186
281 3300050514 nmdc:mga08x19_46022_c1 nmdc:mga08x19_46022_c1_330_893 186
282 3300050515 nmdc:mga0a205_365472_c1 nmdc:mga0a205_365472_c1_298_861 186
283 3300050515 nmdc:mga0a205_783956_c1 nmdc:mga0a205_783956_c1_170_733 186
284 3300053085 Ga0495619_0129262 Ga0495619_0129262_877_1440 186
285 3300003775 Ga0055524_1035055 Ga0055524_10350551 187
286 3300025263 Ga0209565_1001983 Ga0209565_10019837 187
287 3300025294 Ga0209025_1002038 Ga0209025_100203811 187
288 3300025299 Ga0209256_1000486 Ga0209256_100048662 187
289 3300025303 Ga0209051_1005346 Ga0209051_10053464 187
290 3300003187 JGI25151J46595_10000690 JGI25151J46595_1000069020 189
291 3300003187 JGI25151J46595_10003444 JGI25151J46595_100034448 189
292 3300003187 JGI25151J46595_10112151 JGI25151J46595_101121511 189
293 3300003771 Ga0055526_1000741 Ga0055526_100074121 189
294 3300003771 Ga0055526_1000837 Ga0055526_10008371 189
295 3300003771 Ga0055526_1017141 Ga0055526_10171413 189
296 3300003773 Ga0055537_1008499 Ga0055537_10084992 189
297 3300003775 Ga0055524_1008163 Ga0055524_10081634 189
298 3300003781 Ga0055536_1000054 Ga0055536_100005478 189
299 3300003784 Ga0055534_1000324 Ga0055534_10003244 189
300 3300003784 Ga0055534_1002698 Ga0055534_10026985 189
301 3300006948 Ga0099826_10000036 Ga0099826_1000003657 189
302 3300009011 Ga0105251_10020078 Ga0105251_100200783 189
303 3300025263 Ga0209565_1000156 Ga0209565_100015617 189
304 3300025284 Ga0209130_1020525 Ga0209130_10205252 189
305 3300025291 Ga0209675_1000063 Ga0209675_100006335 189
306 3300025291 Ga0209675_1014549 Ga0209675_10145493 189
307 3300025292 Ga0209676_1000044 Ga0209676_1000044332 189
308 3300025294 Ga0209025_1000210 Ga0209025_100021091 189
309 3300025294 Ga0209025_1000822 Ga0209025_100082239 189
310 3300025294 Ga0209025_1014575 Ga0209025_10145752 189
311 3300025294 Ga0209025_1029663 Ga0209025_10296632 189
312 3300025295 Ga0209564_1000216 Ga0209564_100021687 189
313 3300025295 Ga0209564_1000312 Ga0209564_100031254 189
314 3300025295 Ga0209564_1000779 Ga0209564_100077932 189
315 3300025297 Ga0209758_1005417 Ga0209758_10054176 189
316 3300025298 Ga0209050_1005033 Ga0209050_10050335 189
317 3300025299 Ga0209256_1000906 Ga0209256_100090629 189
318 3300027666 Ga0209282_1000098 Ga0209282_100009823 189
319 3300031911 Ga0307412_10000235 Ga0307412_1000023529 189
320 3300037471 Ga0395905_0333300 Ga0395905_0333300_524_1093 189
321 3300041404 Ga0439436_0036212 Ga0439436_0036212_70_648 189
322 3300046457 Ga0495590_0140618 Ga0495590_0140618_105_674 189
323 3300046474 Ga0495605_0002172 Ga0495605_0002172_6410_6979 189
324 3300046491 Ga0495584_0028285 Ga0495584_0028285_1621_2190 189
325 3300046500 Ga0495596_0000145 Ga0495596_0000145_11877_12446 189
326 3300046501 Ga0495607_0000021 Ga0495607_0000021_144416_144994 189
327 3300046501 Ga0495607_0003718 Ga0495607_0003718_8574_9143 189
328 3300046512 Ga0495610_0000358 Ga0495610_0000358_3460_4029 189
329 3300046513 Ga0495616_0010431 Ga0495616_0010431_2989_3558 189
330 3300046522 Ga0495643_0331743 Ga0495643_0331743_56_625 189
331 3300046524 Ga0495648_0024963 Ga0495648_0024963_1788_2357 189
332 3300046538 Ga0495609_0009934 Ga0495609_0009934_1820_2389 189
333 3300046542 Ga0495597_0053502 Ga0495597_0053502_763_1332 189
334 3300046665 Ga0495661_0011823 Ga0495661_0011823_2381_2950 189
335 3300046692 Ga0495671_0006024 Ga0495671_0006024_4408_4977 189
336 3300046694 Ga0495649_0009020 Ga0495649_0009020_3938_4507 189
337 3300047318 Ga0495636_0021466 Ga0495636_0021466_1419_1988 189
338 3300047320 Ga0495672_0003805 Ga0495672_0003805_8575_9144 189
339 3300047447 Ga0495685_002240 Ga0495685_002240_4356_4925 189
340 3300047469 Ga0495673_0081574 Ga0495673_0081574_109_678 189
341 3300048905 Ga0496102_0135756 Ga0496102_0135756_1185_1754 189
342 3300048915 Ga0496112_0579850 Ga0496112_0579850_84_653 189
343 3300048919 Ga0496116_0003697 Ga0496116_0003697_10041_10610 189
344 3300048919 Ga0496116_0009306 Ga0496116_0009306_3342_3911 189
345 3300048919 Ga0496116_0013463 Ga0496116_0013463_4845_5423 189
346 3300048919 Ga0496116_0085644 Ga0496116_0085644_1133_1711 189
347 3300048922 Ga0496119_0059557 Ga0496119_0059557_71_649 189
348 3300048924 Ga0496121_0000444 Ga0496121_0000444_37885_38463 189
349 3300048924 Ga0496121_0023152 Ga0496121_0023152_3113_3682 189
350 3300048924 Ga0496121_0302204 Ga0496121_0302204_487_1065 189
351 3300048925 Ga0496122_0000214 Ga0496122_0000214_88963_89541 189
352 3300048925 Ga0496122_0006772 Ga0496122_0006772_1274_1843 189
353 3300048925 Ga0496122_0061760 Ga0496122_0061760_69_647 189
354 3300048926 Ga0496123_0000289 Ga0496123_0000289_8713_9291 189
355 3300048926 Ga0496123_0001730 Ga0496123_0001730_16858_17427 189
356 3300048926 Ga0496123_0022278 Ga0496123_0022278_4289_4867 189
357 3300048927 Ga0496124_0038248 Ga0496124_0038248_1819_2397 189
358 3300048927 Ga0496124_0040417 Ga0496124_0040417_1630_2208 189
359 3300048927 Ga0496124_0199476 Ga0496124_0199476_723_1292 189
360 3300048927 Ga0496124_0429603 Ga0496124_0429603_319_897 189
361 3300048928 Ga0496125_0033963 Ga0496125_0033963_781_1359 189
362 3300048929 Ga0496126_0127385 Ga0496126_0127385_864_1433 189
363 3300049571 Ga0501034_0001290 Ga0501034_0001290_23672_24241 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

63

214

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcd-assembly1.cif.gz_N-2 structure of protocatechuate 3,4-dioxygenase from pseudomonas aeruginosa at 2.15 angstroms resolution 0.9218 36 177
1ykp-assembly1.cif.gz_D protocatechuate 3,4-dioxygenase y408h mutant bound to dhb 0.9164 36 177
3pcd-assembly1.cif.gz_M protocatechuate 3,4-dioxygenase y447h mutant 0.9067 36 177
3mfl-assembly1.cif.gz_M axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase 0.9001 36 177
3lkt-assembly1.cif.gz_M tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.8995 36 177
ID Description Score Start End Superfamily
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8373 24 188 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8103 22 185 2.60.130.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7814 1 189 2.60.130.10
af_P42787_763_851_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7778 40 177 2.60.40.1120
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7774 1 189 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A2V8GH05-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9685 36 189 GO:0008199
GO:0009056
GO:0018578
AF-F8UVH2-F1-model_v4 Putative protocatechuate 3,4-dioxygenase alpha chain 0.9634 37 145 GO:0008199
GO:0009056
GO:0018578
AF-A0A7Z9IWB5-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.9627 36 109 GO:0008199
GO:0016702
AF-A0A521FSL9-F1-model_v4 Protocatechuate 3,4-dioxygenase, alpha subunit 0.9558 62 189 GO:0005506
GO:0009056
GO:0018578
AF-A0A536YB89-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9535 36 189 GO:0008199
GO:0018578

Feature Viewer

pLDDT pTM Quality
88.65 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map