F422902

General Info

Members Datasets Scaffolds Average Seq Length
363 214 362 178

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_101162976|Ga0070665_1011629761
Length 210
Sequence MESHATVHIKKSVFGSLFDEAAQWKIKSMIAKPTKLSGAFIIEPEPFEDERGFFARSWSEQEFQALGVDGHFIEGNTSFNREAGTLRGMHYQAAPHAQAKLVRCTQGSIYDVGVDLRRDSETFRQWIGVELSATNRRMLYVAPGFAHGYLALMDNTEVHYQVTAAYAPKSAGGFRWNDPAFNIEWPAVETLKINQRDREYADFIIAHPSA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
170 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
191 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
192 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
193 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
194 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
195 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
200 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
201 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
202 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
203 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 1.65
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3480021 2162886007 Unclassified 978
2 Ga0065714_10064458 3300005288 Bacteria 67915
3 Ga0065704_10009619 3300005289 Bacteria 2692
4 Ga0065712_10000114 3300005290 Bacteria 191810
5 Ga0065715_10100967 3300005293 Unclassified 3240
6 Ga0065707_10328112 3300005295 Unclassified 954
7 Ga0070658_10070659 3300005327 Bacteria 2859
8 Ga0070676_10024908 3300005328 Bacteria 3376
9 Ga0070676_10063545 3300005328 Bacteria 2199
10 Ga0070690_100160500 3300005330 Bacteria 1540
11 Ga0070690_100204251 3300005330 Bacteria 1376
12 Ga0070670_100090696 3300005331 Unclassified 2626
13 Ga0070670_100479585 3300005331 Bacteria 1104
14 Ga0068869_100016883 3300005334 Bacteria 4934
15 Ga0070666_10056072 3300005335 Bacteria 2660
16 Ga0070666_10170318 3300005335 Bacteria 1525
17 Ga0070666_10887812 3300005335 Unclassified 659
18 Ga0070680_100150747 3300005336 Bacteria 1952
19 Ga0070680_100500230 3300005336 Bacteria 1040
20 Ga0070682_100264258 3300005337 Bacteria 1247
21 Ga0068868_100187625 3300005338 Bacteria 1718
22 Ga0068868_100674194 3300005338 Bacteria 923
23 Ga0070660_100946550 3300005339 Bacteria 727
24 Ga0070689_100048822 3300005340 Bacteria 3265
25 Ga0070689_100442991 3300005340 Bacteria 1104
26 Ga0070687_100040599 3300005343 Bacteria 2346
27 Ga0070661_100270567 3300005344 Bacteria 1316
28 Ga0070661_100488815 3300005344 Bacteria 984
29 Ga0070668_100382829 3300005347 Bacteria 1197
30 Ga0070669_100018732 3300005353 Unclassified 4948
31 Ga0070669_100066423 3300005353 Bacteria 2658
32 Ga0070671_100387060 3300005355 Bacteria 1195
33 Ga0070674_100039692 3300005356 Bacteria 3180
34 Ga0070673_100109227 3300005364 Bacteria 2291
35 Ga0070688_100134788 3300005365 Bacteria 1671
36 Ga0070701_10106686 3300005438 Bacteria 1559
37 Ga0070705_100203964 3300005440 Bacteria 1358
38 Ga0070700_100008904 3300005441 Bacteria 5488
39 Ga0070700_100045306 3300005441 Bacteria 2712
40 Ga0070700_100127922 3300005441 Bacteria 1710
41 Ga0070694_100066415 3300005444 Bacteria 2474
42 Ga0070694_100226174 3300005444 Bacteria 1406
43 Ga0070708_100071627 3300005445 Bacteria 3121
44 Ga0070663_100224992 3300005455 Bacteria 1475
45 Ga0070678_100085909 3300005456 Bacteria 2398
46 Ga0070678_101834291 3300005456 Bacteria 572
47 Ga0070662_100101665 3300005457 Bacteria 2176
48 Ga0070681_10127126 3300005458 Unclassified 2481
49 Ga0068867_100009119 3300005459 Bacteria 6998
50 Ga0070685_10149350 3300005466 Bacteria 1479
51 Ga0070706_100015221 3300005467 Bacteria 7100
52 Ga0070706_100194568 3300005467 Bacteria 1894
53 Ga0070707_100381056 3300005468 Bacteria 1370
54 Ga0070707_100459928 3300005468 Bacteria 1233
55 Ga0070707_100628925 3300005468 Bacteria 1036
56 Ga0070698_100000489 3300005471 Bacteria 42118
57 Ga0070698_100076233 3300005471 Bacteria 3356
58 Ga0070699_100002947 3300005518 Bacteria 15136
59 Ga0070699_100009886 3300005518 Bacteria 8261
60 Ga0070699_100042906 3300005518 Bacteria 3915
61 Ga0070699_100142799 3300005518 Bacteria 2115
62 Ga0070699_100913725 3300005518 Unclassified 804
63 Ga0070679_100130503 3300005530 Bacteria 2494
64 Ga0070684_100196954 3300005535 Bacteria 1834
65 Ga0070684_100928364 3300005535 Bacteria 816
66 Ga0070672_100139955 3300005543 Bacteria 1995
67 Ga0070672_100656910 3300005543 Unclassified 916
68 Ga0070695_100011816 3300005545 Bacteria 5226
69 Ga0070695_100213224 3300005545 Unclassified 1387
70 Ga0070695_100237187 3300005545 Bacteria 1321
71 Ga0070696_100026958 3300005546 Bacteria 3912
72 Ga0070693_100031858 3300005547 Bacteria 2894
73 Ga0070693_100333611 3300005547 Bacteria 1033
74 Ga0070665_101162976 3300005548 Unclassified 783
75 Ga0070704_100297122 3300005549 Bacteria 1344
76 Ga0070704_100347336 3300005549 Bacteria 1251
77 Ga0070704_100558869 3300005549 Bacteria 1001
78 Ga0070664_100178116 3300005564 Bacteria 1889
79 Ga0070664_100671274 3300005564 Bacteria 964
80 Ga0070664_100774089 3300005564 Bacteria 896
81 Ga0068857_100134905 3300005577 Bacteria 2229
82 Ga0068854_100122564 3300005578 Bacteria 1976
83 Ga0068854_100312199 3300005578 Bacteria 1275
84 Ga0068854_100595180 3300005578 Bacteria 943
85 Ga0068852_100257405 3300005616 Bacteria 1674
86 Ga0068859_100006946 3300005617 Bacteria 11497
87 Ga0068859_100017764 3300005617 Bacteria 7151
88 Ga0068859_100052539 3300005617 Unclassified 4097
89 Ga0068859_100060950 3300005617 Bacteria 3801
90 Ga0068859_100223599 3300005617 Bacteria 1970
91 Ga0068859_100293376 3300005617 Bacteria 1719
92 Ga0068859_100597194 3300005617 Bacteria 1197
93 Ga0068864_100236023 3300005618 Bacteria 1693
94 Ga0068864_100388339 3300005618 Bacteria 1324
95 Ga0068864_101106837 3300005618 Bacteria 788
96 Ga0068866_10067347 3300005718 Bacteria 1879
97 Ga0068861_100110472 3300005719 Bacteria 2202
98 Ga0068870_10011067 3300005840 Bacteria 4168
99 Ga0068863_100098994 3300005841 Bacteria 2770
100 Ga0068863_100246649 3300005841 Bacteria 1724
101 Ga0068863_100451477 3300005841 Bacteria 1262
102 Ga0068858_100052566 3300005842 Bacteria 3769
103 Ga0068860_100228374 3300005843 Unclassified 1808
104 Ga0068860_100250603 3300005843 Bacteria 1724
105 Ga0068860_100266956 3300005843 Bacteria 1669
106 Ga0068862_100032139 3300005844 Bacteria 4433
107 Ga0068862_100075721 3300005844 Bacteria 2911
108 Ga0068862_100230524 3300005844 Bacteria 1680
109 Ga0068862_100317239 3300005844 Bacteria 1438
110 Ga0081455_10240192 3300005937 Bacteria 1332
111 Ga0070717_11060182 3300006028 Bacteria 738
112 Ga0070716_100069774 3300006173 Bacteria 2061
113 Ga0070716_100467776 3300006173 Unclassified 923
114 Ga0070716_100731465 3300006173 Unclassified 759
115 Ga0075367_10126425 3300006178 Bacteria 1578
116 Ga0075427_10021328 3300006194 Bacteria 1030
117 Ga0075366_10296927 3300006195 Unclassified 988
118 Ga0097621_100036691 3300006237 Bacteria 3922
119 Ga0097621_100160563 3300006237 Unclassified 1932
120 Ga0075428_100005777 3300006844 Bacteria 13737
121 Ga0075428_100406023 3300006844 Bacteria 1460
122 Ga0075431_100002720 3300006847 Bacteria 17160
123 Ga0075431_100340240 3300006847 Bacteria 1510
124 Ga0075433_10044375 3300006852 Bacteria 3862
125 Ga0075433_10293313 3300006852 Bacteria 1440
126 Ga0075434_100009468 3300006871 Bacteria 9082
127 Ga0075434_100051494 3300006871 Bacteria 4093
128 Ga0075429_100001411 3300006880 Bacteria 19674
129 Ga0068865_100049571 3300006881 Bacteria 2895
130 Ga0068865_100912755 3300006881 Unclassified 764
131 Ga0068865_101025338 3300006881 Bacteria 724
132 Ga0097620_100006946 3300006931 Bacteria 11497
133 Ga0097620_100017764 3300006931 Bacteria 7151
134 Ga0097620_100052538 3300006931 Unclassified 4097
135 Ga0097620_100060949 3300006931 Bacteria 3801
136 Ga0097620_100223607 3300006931 Bacteria 1970
137 Ga0097620_100293398 3300006931 Bacteria 1719
138 Ga0097620_100597240 3300006931 Bacteria 1197
139 Ga0075435_100191990 3300007076 Bacteria 1729
140 Ga0111539_10009993 3300009094 Bacteria 11959
141 Ga0111539_10142620 3300009094 Bacteria 2804
142 Ga0111539_10896698 3300009094 Bacteria 1031
143 Ga0105245_10056374 3300009098 Bacteria 3532
144 Ga0105247_10028014 3300009101 Bacteria 3407
145 Ga0105247_10046376 3300009101 Unclassified 2667
146 Ga0114129_10004404 3300009147 Bacteria 19866
147 Ga0114129_10026788 3300009147 Bacteria 8163
148 Ga0114129_10072951 3300009147 Bacteria 4783
149 Ga0114129_10258593 3300009147 Bacteria 2335
150 Ga0105243_10024643 3300009148 Bacteria 4590
151 Ga0105243_10232700 3300009148 Bacteria 1635
152 Ga0105243_10723968 3300009148 Bacteria 973
153 Ga0105241_10053454 3300009174 Unclassified 3088
154 Ga0105242_10038101 3300009176 Bacteria 3864
155 Ga0105242_10200120 3300009176 Bacteria 1774
156 Ga0105242_11051578 3300009176 Unclassified 825
157 Ga0105248_10015153 3300009177 Bacteria 8494
158 Ga0105248_10025720 3300009177 Bacteria 6547
159 Ga0105248_10494451 3300009177 Bacteria 1379
160 Ga0105248_11561861 3300009177 Unclassified 747
161 Ga0105248_11831150 3300009177 Unclassified 688
162 Ga0105237_10510050 3300009545 Bacteria 1209
163 Ga0105237_10658017 3300009545 Bacteria 1054
164 Ga0105249_10000030 3300009553 Bacteria 221992
165 Ga0105249_10003166 3300009553 Bacteria 14235
166 Ga0105249_10003352 3300009553 Bacteria 13865
167 Ga0105249_10176313 3300009553 Bacteria 2076
168 Ga0105249_10773998 3300009553 Bacteria 1023
169 Ga0105249_10987722 3300009553 Bacteria 910
170 Ga0105246_10025777 3300011119 Unclassified 3833
171 Ga0105246_10059914 3300011119 Bacteria 2643
172 Ga0105246_10069431 3300011119 Bacteria 2475
173 Ga0157374_10326967 3300013296 Bacteria 1520
174 Ga0157378_10097566 3300013297 Bacteria 2679
175 Ga0163162_10000002 3300013306 Bacteria 717331
176 Ga0163162_10079716 3300013306 Unclassified 3340
177 Ga0163162_10144646 3300013306 Bacteria 2493
178 Ga0163162_10388275 3300013306 Bacteria 1529
179 Ga0163162_10447120 3300013306 Bacteria 1424
180 Ga0163162_11038825 3300013306 Unclassified 927
181 Ga0157375_11794929 3300013308 Archaea 727
182 Ga0163163_10104027 3300014325 Bacteria 2864
183 Ga0163163_10410346 3300014325 Bacteria 1413
184 Ga0163163_10704811 3300014325 Unclassified 1073
185 Ga0157380_10000240 3300014326 Bacteria 32944
186 Ga0157380_10024196 3300014326 Bacteria 4593
187 Ga0157380_10352881 3300014326 Bacteria 1377
188 Ga0157380_11562430 3300014326 Bacteria 714
189 Ga0157379_10139790 3300014968 Bacteria 2183
190 Ga0157379_10952538 3300014968 Bacteria 816
191 Ga0157376_10099240 3300014969 Bacteria 2540
192 Ga0163161_10094382 3300017792 Bacteria 2218
193 Ga0213876_10000076 3300021384 Bacteria 116109
194 Ga0213875_10289292 3300021388 Unclassified 774
195 Ga0207682_10002935 3300025893 Bacteria 7513
196 Ga0207642_10026821 3300025899 Bacteria 2350
197 Ga0207680_10098468 3300025903 Bacteria 1874
198 Ga0207680_10491732 3300025903 Bacteria 873
199 Ga0207645_10017779 3300025907 Bacteria 4687
200 Ga0207645_10020343 3300025907 Bacteria 4345
201 Ga0207645_10266187 3300025907 Bacteria 1136
202 Ga0207645_10286942 3300025907 Bacteria 1094
203 Ga0207643_10008083 3300025908 Bacteria 5643
204 Ga0207705_10045624 3300025909 Bacteria 3149
205 Ga0207684_10003603 3300025910 Bacteria 15075
206 Ga0207684_10013934 3300025910 Bacteria 6946
207 Ga0207684_10428674 3300025910 Bacteria 1136
208 Ga0207654_10044246 3300025911 Bacteria 2528
209 Ga0207707_10033486 3300025912 Bacteria 4496
210 Ga0207662_10008774 3300025918 Bacteria 5544
211 Ga0207652_10165859 3300025921 Unclassified 1981
212 Ga0207646_10000679 3300025922 Bacteria 44119
213 Ga0207681_10027463 3300025923 Unclassified 3680
214 Ga0207681_10070686 3300025923 Bacteria 2431
215 Ga0207650_10000001 3300025925 Bacteria 1545726
216 Ga0207650_10015113 3300025925 Bacteria 5371
217 Ga0207650_10170831 3300025925 Bacteria 1728
218 Ga0207650_10325068 3300025925 Bacteria 1260
219 Ga0207659_11231371 3300025926 Unclassified 643
220 Ga0207687_10420614 3300025927 Bacteria 1103
221 Ga0207690_10054505 3300025932 Bacteria 2689
222 Ga0207706_10061949 3300025933 Bacteria 3295
223 Ga0207706_10660965 3300025933 Unclassified 895
224 Ga0207686_10341908 3300025934 Unclassified 1124
225 Ga0207670_10131027 3300025936 Bacteria 1837
226 Ga0207670_10371828 3300025936 Unclassified 1136
227 Ga0207669_10033428 3300025937 Bacteria 2902
228 Ga0207704_10406329 3300025938 Unclassified 1076
229 Ga0207704_10714193 3300025938 Unclassified 831
230 Ga0207665_10760180 3300025939 Bacteria 764
231 Ga0207691_10087418 3300025940 Bacteria 2796
232 Ga0207711_10070768 3300025941 Bacteria 3025
233 Ga0207711_10108723 3300025941 Bacteria 2463
234 Ga0207711_10159162 3300025941 Bacteria 2042
235 Ga0207711_10258759 3300025941 Bacteria 1599
236 Ga0207711_10648576 3300025941 Bacteria 985
237 Ga0207689_10005962 3300025942 Bacteria 10782
238 Ga0207689_10015958 3300025942 Bacteria 6357
239 Ga0207661_10102146 3300025944 Bacteria 2410
240 Ga0207679_10057967 3300025945 Bacteria 2867
241 Ga0207667_10417640 3300025949 Bacteria 1365
242 Ga0207651_10436641 3300025960 Bacteria 1121
243 Ga0207651_10827794 3300025960 Bacteria 822
244 Ga0207712_10000041 3300025961 Bacteria 180000
245 Ga0207712_10010164 3300025961 Bacteria 5967
246 Ga0207712_10516903 3300025961 Bacteria 1023
247 Ga0207712_11080117 3300025961 Bacteria 714
248 Ga0207668_10000939 3300025972 Bacteria 17544
249 Ga0207668_10092119 3300025972 Bacteria 2230
250 Ga0207668_10198965 3300025972 Bacteria 1594
251 Ga0207640_10046027 3300025981 Bacteria 2805
252 Ga0207677_10618667 3300026023 Bacteria 952
253 Ga0207677_10632814 3300026023 Bacteria 942
254 Ga0207703_10390397 3300026035 Bacteria 1289
255 Ga0207639_10368593 3300026041 Bacteria 1287
256 Ga0207678_10774408 3300026067 Unclassified 846
257 Ga0207708_10011552 3300026075 Bacteria 6579
258 Ga0207708_10012904 3300026075 Bacteria 6230
259 Ga0207708_10050992 3300026075 Unclassified 3150
260 Ga0207702_10051577 3300026078 Bacteria 3478
261 Ga0207641_10217370 3300026088 Unclassified 1770
262 Ga0207641_10602200 3300026088 Unclassified 1076
263 Ga0207648_10004801 3300026089 Bacteria 13799
264 Ga0207648_10198175 3300026089 Unclassified 1781
265 Ga0207676_10019394 3300026095 Bacteria 4961
266 Ga0207674_10034011 3300026116 Bacteria 5332
267 Ga0207674_10097935 3300026116 Bacteria 2917
268 Ga0207675_100034053 3300026118 Bacteria 4747
269 Ga0207675_100098949 3300026118 Bacteria 2747
270 Ga0207675_100331128 3300026118 Bacteria 1489
271 Ga0207683_10014856 3300026121 Bacteria 6630
272 Ga0207428_10494160 3300027907 Bacteria 889
273 Ga0268265_10022276 3300028380 Bacteria 4449
274 Ga0268265_10853297 3300028380 Bacteria 891
275 Ga0268264_10160911 3300028381 Unclassified 2022
276 Ga0268264_10210210 3300028381 Unclassified 1786
277 Ga0268264_10225186 3300028381 Bacteria 1729
278 Ga0268264_10400816 3300028381 Bacteria 1318
279 Ga0268264_10555221 3300028381 Unclassified 1127
280 Ga0265318_10014747 3300028577 Bacteria 3272
281 Ga0265338_10033340 3300028800 Bacteria 5000
282 Ga0265338_10395444 3300028800 Bacteria 986
283 Ga0265330_10019618 3300031235 Bacteria 3095
284 Ga0265328_10016244 3300031239 Bacteria 2899
285 Ga0265320_10065927 3300031240 Bacteria 1717
286 Ga0265331_10021778 3300031250 Bacteria 3275
287 Ga0265316_10068682 3300031344 Bacteria 2736
288 Ga0265316_10090287 3300031344 Bacteria 2338
289 Ga0307513_10002055 3300031456 Bacteria 28306
290 Ga0265314_10010826 3300031711 Bacteria 7583
291 Ga0265342_10047885 3300031712 Bacteria 2564
292 Ga0307410_10785554 3300031852 Bacteria 809
293 Ga0307416_101545938 3300032002 Bacteria 769
294 Ga0307411_10630277 3300032005 Unclassified 926
295 Ga0307415_100491009 3300032126 Bacteria 1071
296 Ga0373949_0073956 3300035090 Unclassified 897
297 Ga0373956_0215718 3300035119 Bacteria 911
298 Ga0373942_0111731 3300035207 Bacteria 846
299 Ga0373961_0127010 3300035241 Unclassified 850
300 Ga0436364_0842144 3300037853 Bacteria 23644
301 Ga0400488_41977 3300038741 Bacteria 1302
302 Ga0436365_0949013 3300039437 Bacteria 39626
303 Ga0439451_009047 3300042009 Bacteria 2018
304 Ga0439454_000689 3300042011 Bacteria 2864
305 Ga0439460_0197071 3300042461 Unclassified 685
306 Ga0466963_0212382 3300044694 Bacteria 1354
307 Ga0466963_0304475 3300044694 Bacteria 1121
308 Ga0466960_0304227 3300044901 Bacteria 899
309 Ga0451576_0536418 3300045051 Bacteria 1229
310 Ga0466967_0029585 3300045976 Unclassified 4586
311 Ga0466967_0071072 3300045976 Bacteria 3115
312 Ga0495608_0254100 3300046511 Bacteria 1095
313 Ga0495642_0058078 3300046528 Bacteria 1601
314 Ga0495586_0099358 3300046535 Bacteria 1614
315 Ga0495625_0137884 3300046660 Bacteria 1647
316 Ga0495658_0078122 3300046683 Bacteria 1937
317 Ga0495669_0000141 3300046684 Bacteria 45672
318 Ga0495669_0095488 3300046684 Bacteria 1377
319 Ga0495604_0254657 3300047317 Bacteria 1195
320 Ga0495674_0784381 3300047319 Bacteria 742
321 Ga0495602_0250838 3300048088 Bacteria 1319
322 Ga0496104_0784741 3300048907 Bacteria 859
323 Ga0496110_0064644 3300048913 Bacteria 3234
324 Ga0496110_0259755 3300048913 Bacteria 1581
325 Ga0496112_0259057 3300048915 Bacteria 1689
326 Ga0496112_0580194 3300048915 Bacteria 1054
327 Ga0496112_0713935 3300048915 Unclassified 930
328 Ga0501046_0153607 3300049580 Bacteria 1735
329 Ga0501068_0637862 3300049584 Bacteria 695
330 Ga0501223_002776 3300049663 Bacteria 3839
331 Ga0501224_012791 3300049664 Bacteria 1238
332 Ga0501227_022591 3300049665 Bacteria 1457
333 Ga0501233_113873 3300049668 Bacteria 725
334 Ga0501236_088850 3300049670 Bacteria 591
335 Ga0501249_007419 3300049679 Bacteria 2266
336 Ga0501257_035351 3300049686 Bacteria 1215
337 Ga0501221_081124 3300049704 Bacteria 781
338 Ga0501225_0015736 3300049705 Bacteria 2103
339 Ga0501229_014131 3300049706 Bacteria 1027
340 Ga0501234_030768 3300049707 Bacteria 867
341 Ga0501268_025773 3300049765 Bacteria 1035
342 Ga0501273_029573 3300049770 Bacteria 774
343 Ga0501280_025613 3300049776 Bacteria 900
344 nmdc:mga05p37_134583_c1 3300050507 Bacteria 3032
345 nmdc:mga05p37_19695_c1 3300050507 Bacteria 8162
346 nmdc:mga05p37_300371_c1 3300050507 Bacteria 1908
347 nmdc:mga0qj67_20123_c1 3300050509 Bacteria 5109
348 nmdc:mga06r32_1349300_c1 3300050510 Bacteria 656
349 nmdc:mga06r32_13633_c1 3300050510 Bacteria 7370
350 nmdc:mga06r32_411202_c1 3300050510 Bacteria 1334
351 nmdc:mga08y16_29294_c1 3300050511 Bacteria 5800
352 nmdc:mga08y16_31458_c1 3300050511 Bacteria 5581
353 nmdc:mga08y16_43269_c1 3300050511 Bacteria 4719
354 nmdc:mga08y16_54840_c1 3300050511 Bacteria 4165
355 nmdc:mga0n895_2877_c1 3300050512 Bacteria 13655
356 nmdc:mga0rr50_13249_c1 3300050513 Bacteria 5361
357 nmdc:mga0rr50_81263_c1 3300050513 Bacteria 2500
358 nmdc:mga0a205_14715_c1 3300050515 Bacteria 7299
359 Ga0500562_027227 3300053108 Bacteria 1499
360 Ga0500622_0003125 3300053156 Bacteria 11383
361 Ga0500645_105375 3300053730 Bacteria 793
362 Ga0530510_0374920 3300061734 Bacteria 1071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10296927 Ga0075366_102969271 147
2 3300014325 Ga0163163_10704811 Ga0163163_107048112 164
3 3300006844 Ga0075428_100005777 Ga0075428_1000057778 166
4 3300006847 Ga0075431_100340240 Ga0075431_1003402402 166
5 3300009147 Ga0114129_10258593 Ga0114129_102585933 166
6 3300009177 Ga0105248_10015153 Ga0105248_100151539 166
7 3300025941 Ga0207711_10108723 Ga0207711_101087234 166
8 3300050510 nmdc:mga06r32_411202_c1 nmdc:mga06r32_411202_c1_691_1230 166
9 3300050511 nmdc:mga08y16_43269_c1 nmdc:mga08y16_43269_c1_492_1031 166
10 3300005617 Ga0068859_100293376 Ga0068859_1002933762 167
11 3300006931 Ga0097620_100293398 Ga0097620_1002933982 167
12 3300025960 Ga0207651_10827794 Ga0207651_108277942 168
13 3300005467 Ga0070706_100194568 Ga0070706_1001945681 170
14 3300025910 Ga0207684_10428674 Ga0207684_104286742 170
15 3300006844 Ga0075428_100406023 Ga0075428_1004060232 171
16 iso_pu_bacteria 2896184354 2896186560 172
17 3300005327 Ga0070658_10070659 Ga0070658_100706592 174
18 3300005328 Ga0070676_10024908 Ga0070676_100249083 174
19 3300005330 Ga0070690_100160500 Ga0070690_1001605002 174
20 3300005335 Ga0070666_10170318 Ga0070666_101703182 174
21 3300005344 Ga0070661_100488815 Ga0070661_1004888152 174
22 3300006194 Ga0075427_10021328 Ga0075427_100213282 174
23 3300006852 Ga0075433_10293313 Ga0075433_102933132 174
24 3300009147 Ga0114129_10072951 Ga0114129_100729515 174
25 3300025903 Ga0207680_10098468 Ga0207680_100984682 174
26 3300025907 Ga0207645_10020343 Ga0207645_100203433 174
27 3300025909 Ga0207705_10045624 Ga0207705_100456243 174
28 3300050507 nmdc:mga05p37_300371_c1 nmdc:mga05p37_300371_c1_481_1005 174
29 3300005471 Ga0070698_100000489 Ga0070698_1000004896 175
30 3300005518 Ga0070699_100042906 Ga0070699_1000429064 175
31 3300028800 Ga0265338_10033340 Ga0265338_100333402 175
32 3300005328 Ga0070676_10063545 Ga0070676_100635452 176
33 3300005331 Ga0070670_100479585 Ga0070670_1004795852 176
34 3300005335 Ga0070666_10056072 Ga0070666_100560723 176
35 3300005335 Ga0070666_10887812 Ga0070666_108878121 176
36 3300005336 Ga0070680_100150747 Ga0070680_1001507472 176
37 3300005338 Ga0068868_100187625 Ga0068868_1001876252 176
38 3300005339 Ga0070660_100946550 Ga0070660_1009465501 176
39 3300005340 Ga0070689_100048822 Ga0070689_1000488224 176
40 3300005340 Ga0070689_100442991 Ga0070689_1004429912 176
41 3300005343 Ga0070687_100040599 Ga0070687_1000405993 176
42 3300005344 Ga0070661_100270567 Ga0070661_1002705672 176
43 3300005347 Ga0070668_100382829 Ga0070668_1003828292 176
44 3300005355 Ga0070671_100387060 Ga0070671_1003870602 176
45 3300005356 Ga0070674_100039692 Ga0070674_1000396923 176
46 3300005364 Ga0070673_100109227 Ga0070673_1001092272 176
47 3300005365 Ga0070688_100134788 Ga0070688_1001347882 176
48 3300005440 Ga0070705_100203964 Ga0070705_1002039642 176
49 3300005441 Ga0070700_100127922 Ga0070700_1001279222 176
50 3300005444 Ga0070694_100226174 Ga0070694_1002261742 176
51 3300005456 Ga0070678_100085909 Ga0070678_1000859091 176
52 3300005457 Ga0070662_100101665 Ga0070662_1001016652 176
53 3300005458 Ga0070681_10127126 Ga0070681_101271262 176
54 3300005459 Ga0068867_100009119 Ga0068867_1000091198 176
55 3300005466 Ga0070685_10149350 Ga0070685_101493502 176
56 3300005467 Ga0070706_100015221 Ga0070706_1000152216 176
57 3300005468 Ga0070707_100381056 Ga0070707_1003810562 176
58 3300005518 Ga0070699_100002947 Ga0070699_1000029477 176
59 3300005530 Ga0070679_100130503 Ga0070679_1001305031 176
60 3300005543 Ga0070672_100139955 Ga0070672_1001399552 176
61 3300005545 Ga0070695_100011816 Ga0070695_1000118163 176
62 3300005546 Ga0070696_100026958 Ga0070696_1000269582 176
63 3300005547 Ga0070693_100031858 Ga0070693_1000318583 176
64 3300005549 Ga0070704_100297122 Ga0070704_1002971222 176
65 3300005549 Ga0070704_100347336 Ga0070704_1003473362 176
66 3300005564 Ga0070664_100671274 Ga0070664_1006712742 176
67 3300005564 Ga0070664_100774089 Ga0070664_1007740892 176
68 3300005577 Ga0068857_100134905 Ga0068857_1001349053 176
69 3300005578 Ga0068854_100595180 Ga0068854_1005951801 176
70 3300005617 Ga0068859_100060950 Ga0068859_1000609502 176
71 3300005618 Ga0068864_100388339 Ga0068864_1003883392 176
72 3300005618 Ga0068864_101106837 Ga0068864_1011068372 176
73 3300005718 Ga0068866_10067347 Ga0068866_100673473 176
74 3300005840 Ga0068870_10011067 Ga0068870_100110672 176
75 3300005841 Ga0068863_100246649 Ga0068863_1002466492 176
76 3300005842 Ga0068858_100052566 Ga0068858_1000525663 176
77 3300005843 Ga0068860_100250603 Ga0068860_1002506032 176
78 3300005844 Ga0068862_100075721 Ga0068862_1000757213 176
79 3300005844 Ga0068862_100230524 Ga0068862_1002305242 176
80 3300006028 Ga0070717_11060182 Ga0070717_110601821 176
81 3300006173 Ga0070716_100069774 Ga0070716_1000697742 176
82 3300006173 Ga0070716_100731465 Ga0070716_1007314652 176
83 3300006178 Ga0075367_10126425 Ga0075367_101264252 176
84 3300006237 Ga0097621_100036691 Ga0097621_1000366912 176
85 3300006847 Ga0075431_100002720 Ga0075431_1000027204 176
86 3300006852 Ga0075433_10044375 Ga0075433_100443752 176
87 3300006871 Ga0075434_100009468 Ga0075434_1000094688 176
88 3300006871 Ga0075434_100051494 Ga0075434_1000514943 176
89 3300006880 Ga0075429_100001411 Ga0075429_10000141113 176
90 3300006881 Ga0068865_100049571 Ga0068865_1000495713 176
91 3300006931 Ga0097620_100060949 Ga0097620_1000609492 176
92 3300007076 Ga0075435_100191990 Ga0075435_1001919902 176
93 3300009094 Ga0111539_10009993 Ga0111539_100099933 176
94 3300009094 Ga0111539_10142620 Ga0111539_101426202 176
95 3300009094 Ga0111539_10896698 Ga0111539_108966982 176
96 3300009098 Ga0105245_10056374 Ga0105245_100563742 176
97 3300009101 Ga0105247_10028014 Ga0105247_100280142 176
98 3300009147 Ga0114129_10004404 Ga0114129_1000440414 176
99 3300009147 Ga0114129_10026788 Ga0114129_100267882 176
100 3300009148 Ga0105243_10024643 Ga0105243_100246432 176
101 3300009176 Ga0105242_10200120 Ga0105242_102001201 176
102 3300009177 Ga0105248_11831150 Ga0105248_118311501 176
103 3300009545 Ga0105237_10658017 Ga0105237_106580171 176
104 3300009553 Ga0105249_10000030 Ga0105249_1000003048 176
105 3300009553 Ga0105249_10176313 Ga0105249_101763132 176
106 3300009553 Ga0105249_10773998 Ga0105249_107739982 176
107 3300011119 Ga0105246_10025777 Ga0105246_100257772 176
108 3300011119 Ga0105246_10069431 Ga0105246_100694312 176
109 3300013296 Ga0157374_10326967 Ga0157374_103269672 176
110 3300013297 Ga0157378_10097566 Ga0157378_100975662 176
111 3300013306 Ga0163162_10000002 Ga0163162_1000000248 176
112 3300013306 Ga0163162_10388275 Ga0163162_103882752 176
113 3300013308 Ga0157375_11794929 Ga0157375_117949292 176
114 3300014325 Ga0163163_10410346 Ga0163163_104103462 176
115 3300014326 Ga0157380_10024196 Ga0157380_100241963 176
116 3300014326 Ga0157380_10352881 Ga0157380_103528812 176
117 3300014326 Ga0157380_11562430 Ga0157380_115624302 176
118 3300014968 Ga0157379_10139790 Ga0157379_101397902 176
119 3300014969 Ga0157376_10099240 Ga0157376_100992403 176
120 3300017792 Ga0163161_10094382 Ga0163161_100943822 176
121 3300021388 Ga0213875_10289292 Ga0213875_102892922 176
122 3300025893 Ga0207682_10002935 Ga0207682_100029357 176
123 3300025899 Ga0207642_10026821 Ga0207642_100268213 176
124 3300025903 Ga0207680_10491732 Ga0207680_104917322 176
125 3300025907 Ga0207645_10017779 Ga0207645_100177794 176
126 3300025908 Ga0207643_10008083 Ga0207643_100080832 176
127 3300025910 Ga0207684_10013934 Ga0207684_100139343 176
128 3300025912 Ga0207707_10033486 Ga0207707_100334865 176
129 3300025918 Ga0207662_10008774 Ga0207662_100087747 176
130 3300025921 Ga0207652_10165859 Ga0207652_101658591 176
131 3300025925 Ga0207650_10015113 Ga0207650_100151132 176
132 3300025925 Ga0207650_10170831 Ga0207650_101708312 176
133 3300025927 Ga0207687_10420614 Ga0207687_104206142 176
134 3300025932 Ga0207690_10054505 Ga0207690_100545052 176
135 3300025933 Ga0207706_10061949 Ga0207706_100619493 176
136 3300025936 Ga0207670_10131027 Ga0207670_101310272 176
137 3300025937 Ga0207669_10033428 Ga0207669_100334284 176
138 3300025939 Ga0207665_10760180 Ga0207665_107601801 176
139 3300025940 Ga0207691_10087418 Ga0207691_100874182 176
140 3300025941 Ga0207711_10159162 Ga0207711_101591622 176
141 3300025942 Ga0207689_10015958 Ga0207689_100159585 176
142 3300025949 Ga0207667_10417640 Ga0207667_104176402 176
143 3300025961 Ga0207712_10000041 Ga0207712_100000415 176
144 3300025961 Ga0207712_10516903 Ga0207712_105169031 176
145 3300025972 Ga0207668_10000939 Ga0207668_100009394 176
146 3300025972 Ga0207668_10092119 Ga0207668_100921193 176
147 3300026023 Ga0207677_10632814 Ga0207677_106328142 176
148 3300026035 Ga0207703_10390397 Ga0207703_103903972 176
149 3300026041 Ga0207639_10368593 Ga0207639_103685932 176
150 3300026075 Ga0207708_10012904 Ga0207708_100129043 176
151 3300026089 Ga0207648_10004801 Ga0207648_1000480111 176
152 3300026095 Ga0207676_10019394 Ga0207676_100193942 176
153 3300026116 Ga0207674_10034011 Ga0207674_100340114 176
154 3300026118 Ga0207675_100034053 Ga0207675_1000340534 176
155 3300026121 Ga0207683_10014856 Ga0207683_100148563 176
156 3300027907 Ga0207428_10494160 Ga0207428_104941602 176
157 3300028381 Ga0268264_10400816 Ga0268264_104008162 176
158 3300028577 Ga0265318_10014747 Ga0265318_100147473 176
159 3300028800 Ga0265338_10395444 Ga0265338_103954442 176
160 3300031235 Ga0265330_10019618 Ga0265330_100196183 176
161 3300031239 Ga0265328_10016244 Ga0265328_100162443 176
162 3300031240 Ga0265320_10065927 Ga0265320_100659272 176
163 3300031250 Ga0265331_10021778 Ga0265331_100217783 176
164 3300031344 Ga0265316_10068682 Ga0265316_100686822 176
165 3300031711 Ga0265314_10010826 Ga0265314_100108267 176
166 3300031712 Ga0265342_10047885 Ga0265342_100478853 176
167 3300032005 Ga0307411_10630277 Ga0307411_106302771 176
168 3300032126 Ga0307415_100491009 Ga0307415_1004910091 176
169 3300035090 Ga0373949_0073956 Ga0373949_0073956_104_646 176
170 3300035207 Ga0373942_0111731 Ga0373942_0111731_14_547 176
171 3300035241 Ga0373961_0127010 Ga0373961_0127010_211_759 176
172 3300037853 Ga0436364_0842144 Ga0436364_0842144_17231_17761 176
173 3300042461 Ga0439460_0197071 Ga0439460_0197071_19_549 176
174 3300045051 Ga0451576_0536418 Ga0451576_0536418_94_627 176
175 3300046528 Ga0495642_0058078 Ga0495642_0058078_285_815 176
176 3300046535 Ga0495586_0099358 Ga0495586_0099358_64_594 176
177 3300046660 Ga0495625_0137884 Ga0495625_0137884_11_541 176
178 3300046683 Ga0495658_0078122 Ga0495658_0078122_263_793 176
179 3300046684 Ga0495669_0000141 Ga0495669_0000141_7135_7665 176
180 3300046684 Ga0495669_0095488 Ga0495669_0095488_799_1329 176
181 3300047319 Ga0495674_0784381 Ga0495674_0784381_83_613 176
182 3300048907 Ga0496104_0784741 Ga0496104_0784741_206_736 176
183 3300048913 Ga0496110_0064644 Ga0496110_0064644_1723_2253 176
184 3300048913 Ga0496110_0259755 Ga0496110_0259755_292_822 176
185 3300048915 Ga0496112_0259057 Ga0496112_0259057_167_697 176
186 3300048915 Ga0496112_0713935 Ga0496112_0713935_352_894 176
187 3300049580 Ga0501046_0153607 Ga0501046_0153607_723_1286 176
188 3300049584 Ga0501068_0637862 Ga0501068_0637862_85_615 176
189 3300050507 nmdc:mga05p37_134583_c1 nmdc:mga05p37_134583_c1_2280_2810 176
190 3300050507 nmdc:mga05p37_19695_c1 nmdc:mga05p37_19695_c1_3984_4514 176
191 3300050509 nmdc:mga0qj67_20123_c1 nmdc:mga0qj67_20123_c1_401_931 176
192 3300050510 nmdc:mga06r32_1349300_c1 nmdc:mga06r32_1349300_c1_35_571 176
193 3300050510 nmdc:mga06r32_13633_c1 nmdc:mga06r32_13633_c1_2089_2619 176
194 3300050511 nmdc:mga08y16_29294_c1 nmdc:mga08y16_29294_c1_2561_3094 176
195 3300050511 nmdc:mga08y16_54840_c1 nmdc:mga08y16_54840_c1_1007_1537 176
196 3300050512 nmdc:mga0n895_2877_c1 nmdc:mga0n895_2877_c1_8068_8598 176
197 3300050513 nmdc:mga0rr50_13249_c1 nmdc:mga0rr50_13249_c1_3613_4143 176
198 3300050513 nmdc:mga0rr50_81263_c1 nmdc:mga0rr50_81263_c1_909_1442 176
199 3300050515 nmdc:mga0a205_14715_c1 nmdc:mga0a205_14715_c1_5801_6331 176
200 3300053108 Ga0500562_027227 Ga0500562_027227_16_552 176
201 3300053156 Ga0500622_0003125 Ga0500622_0003125_7941_8477 176
202 3300053730 Ga0500645_105375 Ga0500645_105375_193_729 176
203 3300061734 Ga0530510_0374920 Ga0530510_0374920_311_841 176
204 2162886007 SwRhRL2b_contig_3480021 SwRhRL2b_0420.00006980 177
205 3300005288 Ga0065714_10064458 Ga0065714_1006445817 177
206 3300005289 Ga0065704_10009619 Ga0065704_100096192 177
207 3300005290 Ga0065712_10000114 Ga0065712_1000011472 177
208 3300005293 Ga0065715_10100967 Ga0065715_101009673 177
209 3300005295 Ga0065707_10328112 Ga0065707_103281121 177
210 3300005330 Ga0070690_100204251 Ga0070690_1002042512 177
211 3300005331 Ga0070670_100090696 Ga0070670_1000906963 177
212 3300005334 Ga0068869_100016883 Ga0068869_1000168831 177
213 3300005336 Ga0070680_100500230 Ga0070680_1005002301 177
214 3300005337 Ga0070682_100264258 Ga0070682_1002642582 177
215 3300005338 Ga0068868_100674194 Ga0068868_1006741942 177
216 3300005353 Ga0070669_100018732 Ga0070669_1000187322 177
217 3300005353 Ga0070669_100066423 Ga0070669_1000664231 177
218 3300005438 Ga0070701_10106686 Ga0070701_101066861 177
219 3300005441 Ga0070700_100008904 Ga0070700_1000089044 177
220 3300005441 Ga0070700_100045306 Ga0070700_1000453062 177
221 3300005444 Ga0070694_100066415 Ga0070694_1000664153 177
222 3300005445 Ga0070708_100071627 Ga0070708_1000716274 177
223 3300005455 Ga0070663_100224992 Ga0070663_1002249922 177
224 3300005456 Ga0070678_101834291 Ga0070678_1018342911 177
225 3300005468 Ga0070707_100459928 Ga0070707_1004599282 177
226 3300005468 Ga0070707_100628925 Ga0070707_1006289251 177
227 3300005471 Ga0070698_100076233 Ga0070698_1000762332 177
228 3300005518 Ga0070699_100009886 Ga0070699_1000098868 177
229 3300005518 Ga0070699_100142799 Ga0070699_1001427992 177
230 3300005518 Ga0070699_100913725 Ga0070699_1009137252 177
231 3300005535 Ga0070684_100196954 Ga0070684_1001969542 177
232 3300005535 Ga0070684_100928364 Ga0070684_1009283642 177
233 3300005543 Ga0070672_100656910 Ga0070672_1006569102 177
234 3300005545 Ga0070695_100213224 Ga0070695_1002132242 177
235 3300005545 Ga0070695_100237187 Ga0070695_1002371872 177
236 3300005547 Ga0070693_100333611 Ga0070693_1003336111 177
237 3300005548 Ga0070665_101162976 Ga0070665_1011629761 177
238 3300005549 Ga0070704_100558869 Ga0070704_1005588692 177
239 3300005564 Ga0070664_100178116 Ga0070664_1001781162 177
240 3300005578 Ga0068854_100122564 Ga0068854_1001225643 177
241 3300005578 Ga0068854_100312199 Ga0068854_1003121991 177
242 3300005616 Ga0068852_100257405 Ga0068852_1002574052 177
243 3300005617 Ga0068859_100006946 Ga0068859_10000694610 177
244 3300005617 Ga0068859_100017764 Ga0068859_1000177645 177
245 3300005617 Ga0068859_100052539 Ga0068859_1000525391 177
246 3300005617 Ga0068859_100223599 Ga0068859_1002235993 177
247 3300005617 Ga0068859_100597194 Ga0068859_1005971941 177
248 3300005618 Ga0068864_100236023 Ga0068864_1002360232 177
249 3300005719 Ga0068861_100110472 Ga0068861_1001104722 177
250 3300005841 Ga0068863_100098994 Ga0068863_1000989943 177
251 3300005841 Ga0068863_100451477 Ga0068863_1004514772 177
252 3300005843 Ga0068860_100228374 Ga0068860_1002283742 177
253 3300005843 Ga0068860_100266956 Ga0068860_1002669561 177
254 3300005844 Ga0068862_100032139 Ga0068862_1000321395 177
255 3300005844 Ga0068862_100317239 Ga0068862_1003172392 177
256 3300005937 Ga0081455_10240192 Ga0081455_102401921 177
257 3300006173 Ga0070716_100467776 Ga0070716_1004677762 177
258 3300006237 Ga0097621_100160563 Ga0097621_1001605633 177
259 3300006881 Ga0068865_100912755 Ga0068865_1009127552 177
260 3300006881 Ga0068865_101025338 Ga0068865_1010253381 177
261 3300006931 Ga0097620_100006946 Ga0097620_10000694610 177
262 3300006931 Ga0097620_100017764 Ga0097620_1000177645 177
263 3300006931 Ga0097620_100052538 Ga0097620_1000525381 177
264 3300006931 Ga0097620_100223607 Ga0097620_1002236073 177
265 3300006931 Ga0097620_100597240 Ga0097620_1005972401 177
266 3300009101 Ga0105247_10046376 Ga0105247_100463763 177
267 3300009148 Ga0105243_10232700 Ga0105243_102327002 177
268 3300009148 Ga0105243_10723968 Ga0105243_107239682 177
269 3300009174 Ga0105241_10053454 Ga0105241_100534543 177
270 3300009176 Ga0105242_10038101 Ga0105242_100381013 177
271 3300009176 Ga0105242_11051578 Ga0105242_110515781 177
272 3300009177 Ga0105248_10025720 Ga0105248_100257203 177
273 3300009177 Ga0105248_10494451 Ga0105248_104944512 177
274 3300009177 Ga0105248_11561861 Ga0105248_115618611 177
275 3300009545 Ga0105237_10510050 Ga0105237_105100502 177
276 3300009553 Ga0105249_10003166 Ga0105249_100031663 177
277 3300009553 Ga0105249_10003352 Ga0105249_1000335210 177
278 3300009553 Ga0105249_10987722 Ga0105249_109877222 177
279 3300011119 Ga0105246_10059914 Ga0105246_100599143 177
280 3300013306 Ga0163162_10079716 Ga0163162_100797163 177
281 3300013306 Ga0163162_10144646 Ga0163162_101446462 177
282 3300013306 Ga0163162_10447120 Ga0163162_104471202 177
283 3300013306 Ga0163162_11038825 Ga0163162_110388251 177
284 3300014325 Ga0163163_10104027 Ga0163163_101040272 177
285 3300014326 Ga0157380_10000240 Ga0157380_1000024012 177
286 3300014968 Ga0157379_10952538 Ga0157379_109525381 177
287 3300021384 Ga0213876_10000076 Ga0213876_1000007693 177
288 3300025907 Ga0207645_10266187 Ga0207645_102661871 177
289 3300025907 Ga0207645_10286942 Ga0207645_102869422 177
290 3300025910 Ga0207684_10003603 Ga0207684_100036036 177
291 3300025911 Ga0207654_10044246 Ga0207654_100442463 177
292 3300025922 Ga0207646_10000679 Ga0207646_1000067934 177
293 3300025923 Ga0207681_10027463 Ga0207681_100274632 177
294 3300025923 Ga0207681_10070686 Ga0207681_100706863 177
295 3300025925 Ga0207650_10000001 Ga0207650_10000001792 177
296 3300025925 Ga0207650_10325068 Ga0207650_103250681 177
297 3300025926 Ga0207659_11231371 Ga0207659_112313711 177
298 3300025933 Ga0207706_10660965 Ga0207706_106609652 177
299 3300025934 Ga0207686_10341908 Ga0207686_103419082 177
300 3300025936 Ga0207670_10371828 Ga0207670_103718282 177
301 3300025938 Ga0207704_10406329 Ga0207704_104063291 177
302 3300025938 Ga0207704_10714193 Ga0207704_107141932 177
303 3300025941 Ga0207711_10070768 Ga0207711_100707683 177
304 3300025941 Ga0207711_10258759 Ga0207711_102587592 177
305 3300025941 Ga0207711_10648576 Ga0207711_106485762 177
306 3300025942 Ga0207689_10005962 Ga0207689_100059626 177
307 3300025944 Ga0207661_10102146 Ga0207661_101021462 177
308 3300025945 Ga0207679_10057967 Ga0207679_100579673 177
309 3300025960 Ga0207651_10436641 Ga0207651_104366412 177
310 3300025961 Ga0207712_10010164 Ga0207712_100101642 177
311 3300025961 Ga0207712_11080117 Ga0207712_110801171 177
312 3300025972 Ga0207668_10198965 Ga0207668_101989652 177
313 3300025981 Ga0207640_10046027 Ga0207640_100460274 177
314 3300026023 Ga0207677_10618667 Ga0207677_106186672 177
315 3300026067 Ga0207678_10774408 Ga0207678_107744081 177
316 3300026075 Ga0207708_10011552 Ga0207708_100115525 177
317 3300026075 Ga0207708_10050992 Ga0207708_100509922 177
318 3300026078 Ga0207702_10051577 Ga0207702_100515774 177
319 3300026088 Ga0207641_10217370 Ga0207641_102173701 177
320 3300026088 Ga0207641_10602200 Ga0207641_106022001 177
321 3300026089 Ga0207648_10198175 Ga0207648_101981751 177
322 3300026116 Ga0207674_10097935 Ga0207674_100979354 177
323 3300026118 Ga0207675_100098949 Ga0207675_1000989491 177
324 3300026118 Ga0207675_100331128 Ga0207675_1003311282 177
325 3300028380 Ga0268265_10022276 Ga0268265_100222765 177
326 3300028380 Ga0268265_10853297 Ga0268265_108532972 177
327 3300028381 Ga0268264_10160911 Ga0268264_101609111 177
328 3300028381 Ga0268264_10210210 Ga0268264_102102102 177
329 3300028381 Ga0268264_10225186 Ga0268264_102251862 177
330 3300028381 Ga0268264_10555221 Ga0268264_105552211 177
331 3300031344 Ga0265316_10090287 Ga0265316_100902873 177
332 3300031456 Ga0307513_10002055 Ga0307513_1000205520 177
333 3300031852 Ga0307410_10785554 Ga0307410_107855542 177
334 3300032002 Ga0307416_101545938 Ga0307416_1015459382 177
335 3300035119 Ga0373956_0215718 Ga0373956_0215718_137_694 177
336 3300038741 Ga0400488_41977 Ga0400488_41977_592_1125 177
337 3300039437 Ga0436365_0949013 Ga0436365_0949013_1690_2223 177
338 3300042009 Ga0439451_009047 Ga0439451_009047_682_1230 177
339 3300042011 Ga0439454_000689 Ga0439454_000689_1124_1672 177
340 3300044694 Ga0466963_0212382 Ga0466963_0212382_559_1122 177
341 3300044694 Ga0466963_0304475 Ga0466963_0304475_351_905 177
342 3300044901 Ga0466960_0304227 Ga0466960_0304227_214_753 177
343 3300045976 Ga0466967_0029585 Ga0466967_0029585_870_1403 177
344 3300045976 Ga0466967_0071072 Ga0466967_0071072_663_1202 177
345 3300046511 Ga0495608_0254100 Ga0495608_0254100_90_647 177
346 3300047317 Ga0495604_0254657 Ga0495604_0254657_367_924 177
347 3300048088 Ga0495602_0250838 Ga0495602_0250838_20_577 177
348 3300048915 Ga0496112_0580194 Ga0496112_0580194_468_1001 177
349 3300049663 Ga0501223_002776 Ga0501223_002776_265_798 177
350 3300049664 Ga0501224_012791 Ga0501224_012791_625_1158 177
351 3300049665 Ga0501227_022591 Ga0501227_022591_591_1124 177
352 3300049668 Ga0501233_113873 Ga0501233_113873_27_560 177
353 3300049670 Ga0501236_088850 Ga0501236_088850_35_568 177
354 3300049679 Ga0501249_007419 Ga0501249_007419_1654_2187 177
355 3300049686 Ga0501257_035351 Ga0501257_035351_446_979 177
356 3300049704 Ga0501221_081124 Ga0501221_081124_176_709 177
357 3300049705 Ga0501225_0015736 Ga0501225_0015736_406_939 177
358 3300049706 Ga0501229_014131 Ga0501229_014131_92_625 177
359 3300049707 Ga0501234_030768 Ga0501234_030768_238_771 177
360 3300049765 Ga0501268_025773 Ga0501268_025773_103_636 177
361 3300049770 Ga0501273_029573 Ga0501273_029573_136_669 177
362 3300049776 Ga0501280_025613 Ga0501280_025613_128_661 177
363 3300050511 nmdc:mga08y16_31458_c1 nmdc:mga08y16_31458_c1_13_546 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

33

204

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9713 1 175
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9633 1 175
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9564 2 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9555 2 174
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9552 1 175
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9446 2 175 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9396 1 174 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9382 1 174 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9379 2 174 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9361 2 175 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1Q6VP32-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9906 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7W0PX11-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9875 1 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q7ZKS2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9851 1 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7X7HZJ1-F1-model_v4 dTDP-4-keto-6-deoxy-D-glucose epimerase 0.9842 2 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q6VP32-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9838 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
95.71 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map