F422873

General Info

Members Datasets Scaffolds Average Seq Length
363 215 726 135

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100184481|Ga0070671_1001844812
Length 151
Sequence MFKEFKEFVMRGNVLDLAIAVIIGAAFGAIVTSLVNDVLMPPIGLAMGKVDFKDLFISLNGQTYPTLALAKAAAAPVIAYGLFANTVINFLIVAFVVFLVVKQVNRFKKPAPAAAAPSTKECGFCASTIPLKAMRCPQCTSDLGAAARMGS

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
210 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
211 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
212 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
213 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 3.03
Rhizosphere 94.49
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100184481 3300005355 Bacteria 1767
2 Ga0065714_10170607 3300005288 Bacteria 1006
3 Ga0065712_10093308 3300005290 Bacteria 2297
4 Ga0065715_10098392 3300005293 Bacteria 3555
5 Ga0065715_10339393 3300005293 Bacteria 969
6 Ga0065715_10382883 3300005293 Bacteria 905
7 Ga0065715_10432786 3300005293 Bacteria 845
8 Ga0065707_10171277 3300005295 Bacteria 1482
9 Ga0065707_10229857 3300005295 Bacteria 1193
10 Ga0070658_10118037 3300005327 Unclassified 2203
11 Ga0070676_10209420 3300005328 Bacteria 1282
12 Ga0070676_10488706 3300005328 Bacteria 872
13 Ga0070683_100014957 3300005329 Bacteria 6805
14 Ga0070683_100062534 3300005329 Bacteria 3462
15 Ga0070683_100266855 3300005329 Bacteria 1628
16 Ga0070690_100031196 3300005330 Bacteria 3318
17 Ga0070690_100713256 3300005330 Bacteria 771
18 Ga0070670_100005464 3300005331 Bacteria 10720
19 Ga0068869_100230624 3300005334 Bacteria 1471
20 Ga0068869_100622159 3300005334 Bacteria 914
21 Ga0068869_100636908 3300005334 Unclassified 904
22 Ga0068869_101839639 3300005334 Bacteria 542
23 Ga0070666_11036692 3300005335 Bacteria 609
24 Ga0070682_101349431 3300005337 Bacteria 608
25 Ga0070660_100465378 3300005339 Unclassified 1050
26 Ga0070661_100242414 3300005344 Bacteria 1388
27 Ga0070661_100959280 3300005344 Bacteria 708
28 Ga0070661_100982645 3300005344 Bacteria 700
29 Ga0070669_100026789 3300005353 Bacteria 4147
30 Ga0070669_101235527 3300005353 Bacteria 646
31 Ga0070675_100029180 3300005354 Bacteria 4447
32 Ga0070675_100185872 3300005354 Bacteria 1798
33 Ga0070675_100195982 3300005354 Bacteria 1752
34 Ga0070671_100063069 3300005355 Bacteria 3086
35 Ga0070671_100073496 3300005355 Bacteria 2856
36 Ga0070674_101405567 3300005356 Bacteria 625
37 Ga0070673_100008747 3300005364 Bacteria 6758
38 Ga0070673_100274784 3300005364 Bacteria 1476
39 Ga0070688_100062782 3300005365 Bacteria 2352
40 Ga0070688_100150125 3300005365 Bacteria 1592
41 Ga0070688_101601192 3300005365 Bacteria 532
42 Ga0070659_100095697 3300005366 Bacteria 2385
43 Ga0070667_100085490 3300005367 Bacteria 2705
44 Ga0070667_100128957 3300005367 Bacteria 2206
45 Ga0070667_100308370 3300005367 Bacteria 1426
46 Ga0070667_101633786 3300005367 Bacteria 606
47 Ga0070705_100874936 3300005440 Bacteria 721
48 Ga0070700_100110745 3300005441 Bacteria 1825
49 Ga0070694_101864059 3300005444 Bacteria 513
50 Ga0070663_100426188 3300005455 Bacteria 1089
51 Ga0070663_101382639 3300005455 Bacteria 623
52 Ga0070678_100148440 3300005456 Bacteria 1885
53 Ga0070662_100242968 3300005457 Bacteria 1445
54 Ga0070681_10033561 3300005458 Bacteria 5152
55 Ga0068867_100143014 3300005459 Bacteria 1871
56 Ga0070685_10267207 3300005466 Bacteria 1140
57 Ga0070707_100012614 3300005468 Bacteria 7892
58 Ga0070707_100653361 3300005468 Unclassified 1014
59 Ga0070699_100083073 3300005518 Bacteria 2793
60 Ga0070684_100000118 3300005535 Bacteria 51534
61 Ga0070684_100021149 3300005535 Bacteria 5407
62 Ga0070684_100760255 3300005535 Bacteria 905
63 Ga0070684_101248231 3300005535 Bacteria 699
64 Ga0070697_100798112 3300005536 Bacteria 835
65 Ga0070697_101321306 3300005536 Bacteria 643
66 Ga0068853_100052070 3300005539 Bacteria 3526
67 Ga0068853_100160882 3300005539 Bacteria 2026
68 Ga0068853_100568813 3300005539 Bacteria 1075
69 Ga0070672_100271572 3300005543 Bacteria 1432
70 Ga0070672_100307587 3300005543 Bacteria 1345
71 Ga0070672_101760304 3300005543 Bacteria 557
72 Ga0070686_100058291 3300005544 Bacteria 2484
73 Ga0070686_100246958 3300005544 Bacteria 1302
74 Ga0070696_100647808 3300005546 Bacteria 856
75 Ga0070693_100024001 3300005547 Bacteria 3266
76 Ga0068855_100050183 3300005563 Bacteria 4918
77 Ga0070664_100000696 3300005564 Bacteria 25658
78 Ga0070664_100020144 3300005564 Bacteria 5492
79 Ga0070664_100335343 3300005564 Bacteria 1373
80 Ga0068857_100006827 3300005577 Bacteria 9824
81 Ga0068857_100099860 3300005577 Bacteria 2604
82 Ga0068854_101458896 3300005578 Unclassified 620
83 Ga0068856_100182023 3300005614 Bacteria 2115
84 Ga0070702_100277092 3300005615 Bacteria 1150
85 Ga0068852_100618525 3300005616 Bacteria 1089
86 Ga0068852_101074941 3300005616 Bacteria 824
87 Ga0068859_100480214 3300005617 Unclassified 1338
88 Ga0068859_100706604 3300005617 Bacteria 1099
89 Ga0068859_100831825 3300005617 Unclassified 1010
90 Ga0068859_102800848 3300005617 Bacteria 535
91 Ga0068864_100103241 3300005618 Bacteria 2531
92 Ga0068864_100295254 3300005618 Unclassified 1516
93 Ga0068864_100410270 3300005618 Bacteria 1289
94 Ga0068864_101325072 3300005618 Bacteria 721
95 Ga0068864_101451088 3300005618 Bacteria 689
96 Ga0068863_100013859 3300005841 Bacteria 7771
97 Ga0068858_100032762 3300005842 Bacteria 4826
98 Ga0068858_100181227 3300005842 Bacteria 1989
99 Ga0068858_100481476 3300005842 Bacteria 1198
100 Ga0068858_100682652 3300005842 Bacteria 999
101 Ga0068858_101308547 3300005842 Unclassified 713
102 Ga0068860_100658070 3300005843 Unclassified 1056
103 Ga0068862_100011716 3300005844 Bacteria 7237
104 Ga0068862_101283051 3300005844 Bacteria 733
105 Ga0075364_10071459 3300006051 Bacteria 2286
106 Ga0097621_100847273 3300006237 Bacteria 849
107 Ga0068871_100492934 3300006358 Bacteria 1103
108 Ga0068871_101361517 3300006358 Unclassified 668
109 Ga0075431_100030535 3300006847 Bacteria 5551
110 Ga0075433_10044317 3300006852 Bacteria 3864
111 Ga0075433_10426829 3300006852 Bacteria 1169
112 Ga0075434_100322278 3300006871 Bacteria 1566
113 Ga0075434_100768631 3300006871 Bacteria 980
114 Ga0075429_100105065 3300006880 Bacteria 2467
115 Ga0075429_100187897 3300006880 Bacteria 1810
116 Ga0075429_100191246 3300006880 Bacteria 1793
117 Ga0068865_100131104 3300006881 Bacteria 1878
118 Ga0097620_100480200 3300006931 Unclassified 1338
119 Ga0097620_100706594 3300006931 Bacteria 1099
120 Ga0097620_100831686 3300006931 Unclassified 1010
121 Ga0097620_102800722 3300006931 Bacteria 535
122 Ga0075435_100608154 3300007076 Bacteria 948
123 Ga0075435_100674982 3300007076 Bacteria 897
124 Ga0075435_101243300 3300007076 Bacteria 652
125 Ga0105240_10166125 3300009093 Bacteria 2617
126 Ga0105240_10249225 3300009093 Bacteria 2055
127 Ga0111539_10001757 3300009094 Bacteria 28796
128 Ga0111539_10174904 3300009094 Bacteria 2508
129 Ga0111539_10218127 3300009094 Bacteria 2222
130 Ga0105245_10012418 3300009098 Bacteria 7412
131 Ga0105245_10384224 3300009098 Unclassified 1399
132 Ga0105245_10830368 3300009098 Bacteria 963
133 Ga0105245_11034467 3300009098 Unclassified 866
134 Ga0105247_10157756 3300009101 Unclassified 1500
135 Ga0114129_10028125 3300009147 Bacteria 7966
136 Ga0114129_10087271 3300009147 Bacteria 4326
137 Ga0114129_10114210 3300009147 Bacteria 3723
138 Ga0114129_10373826 3300009147 Bacteria 1883
139 Ga0114129_10733830 3300009147 Bacteria 1266
140 Ga0105243_11352369 3300009148 Unclassified 731
141 Ga0105241_10058980 3300009174 Bacteria 2949
142 Ga0105241_10106434 3300009174 Bacteria 2238
143 Ga0105241_10279275 3300009174 Bacteria 1426
144 Ga0105241_10284409 3300009174 Bacteria 1414
145 Ga0105242_10116464 3300009176 Bacteria 2286
146 Ga0105242_10231109 3300009176 Bacteria 1657
147 Ga0105242_10392602 3300009176 Bacteria 1293
148 Ga0105242_10466266 3300009176 Bacteria 1194
149 Ga0105242_10520243 3300009176 Bacteria 1135
150 Ga0105248_10059312 3300009177 Bacteria 4298
151 Ga0105248_10108060 3300009177 Bacteria 3137
152 Ga0105248_10112396 3300009177 Bacteria 3072
153 Ga0105248_10585274 3300009177 Bacteria 1259
154 Ga0105248_11709580 3300009177 Bacteria 713
155 Ga0105248_11932422 3300009177 Bacteria 670
156 Ga0105237_10018380 3300009545 Bacteria 7234
157 Ga0105237_10099544 3300009545 Bacteria 2899
158 Ga0105238_10011138 3300009551 Bacteria 9043
159 Ga0105238_10118751 3300009551 Bacteria 2624
160 Ga0105249_10003892 3300009553 Bacteria 12899
161 Ga0105249_10027872 3300009553 Bacteria 5098
162 Ga0105249_10058455 3300009553 Bacteria 3534
163 Ga0105249_10443372 3300009553 Bacteria 1336
164 Ga0105249_10699496 3300009553 Bacteria 1074
165 Ga0105249_11785276 3300009553 Unclassified 688
166 Ga0105239_10007301 3300010375 Bacteria 12690
167 Ga0105239_10149470 3300010375 Bacteria 2607
168 Ga0105239_10502029 3300010375 Bacteria 1379
169 Ga0105239_10551666 3300010375 Bacteria 1312
170 Ga0105239_10594912 3300010375 Bacteria 1261
171 Ga0105239_11563926 3300010375 Bacteria 762
172 Ga0105246_10416727 3300011119 Bacteria 1120
173 Ga0157373_10537950 3300013100 Unclassified 846
174 Ga0157371_10916547 3300013102 Bacteria 665
175 Ga0157370_10235750 3300013104 Bacteria 1693
176 Ga0157369_10278139 3300013105 Bacteria 1743
177 Ga0157374_10081376 3300013296 Bacteria 3073
178 Ga0157374_10206825 3300013296 Bacteria 1924
179 Ga0157374_10486100 3300013296 Bacteria 1238
180 Ga0157374_10686929 3300013296 Bacteria 1036
181 Ga0157378_10036340 3300013297 Bacteria 4359
182 Ga0157378_10096927 3300013297 Bacteria 2688
183 Ga0157378_10237909 3300013297 Bacteria 1738
184 Ga0157378_10479965 3300013297 Unclassified 1238
185 Ga0157378_11118020 3300013297 Bacteria 825
186 Ga0163162_10819679 3300013306 Bacteria 1047
187 Ga0157372_10087325 3300013307 Bacteria 3539
188 Ga0157375_10497890 3300013308 Bacteria 1383
189 Ga0157375_10592120 3300013308 Bacteria 1269
190 Ga0157375_10825647 3300013308 Bacteria 1075
191 Ga0163163_10369687 3300014325 Unclassified 1491
192 Ga0163163_10577273 3300014325 Bacteria 1187
193 Ga0163163_11584777 3300014325 Unclassified 716
194 Ga0157380_11135440 3300014326 Bacteria 822
195 Ga0157377_10454690 3300014745 Bacteria 885
196 Ga0157377_10730274 3300014745 Bacteria 722
197 Ga0157379_11046220 3300014968 Unclassified 780
198 Ga0157376_10178132 3300014969 Bacteria 1941
199 Ga0207697_10054000 3300025315 Bacteria 1664
200 Ga0207642_10320534 3300025899 Bacteria 905
201 Ga0207710_10173390 3300025900 Bacteria 1055
202 Ga0207680_10062526 3300025903 Bacteria 2275
203 Ga0207645_10142381 3300025907 Bacteria 1563
204 Ga0207645_10283607 3300025907 Bacteria 1100
205 Ga0207705_10231481 3300025909 Bacteria 1406
206 Ga0207707_11240740 3300025912 Bacteria 601
207 Ga0207695_10120373 3300025913 Bacteria 2594
208 Ga0207671_10037641 3300025914 Bacteria 3587
209 Ga0207671_10408302 3300025914 Bacteria 1080
210 Ga0207646_10042226 3300025922 Bacteria 4098
211 Ga0207681_10374481 3300025923 Bacteria 1145
212 Ga0207650_10035932 3300025925 Bacteria 3601
213 Ga0207659_10089390 3300025926 Bacteria 2297
214 Ga0207687_10002583 3300025927 Bacteria 12292
215 Ga0207687_10093281 3300025927 Bacteria 2200
216 Ga0207644_10187574 3300025931 Bacteria 1624
217 Ga0207644_10744537 3300025931 Bacteria 818
218 Ga0207686_10025276 3300025934 Bacteria 3452
219 Ga0207670_10179004 3300025936 Bacteria 1596
220 Ga0207704_10989021 3300025938 Bacteria 711
221 Ga0207691_10377727 3300025940 Bacteria 1210
222 Ga0207711_10079452 3300025941 Bacteria 2863
223 Ga0207711_10498792 3300025941 Bacteria 1134
224 Ga0207711_10676611 3300025941 Bacteria 963
225 Ga0207689_10146347 3300025942 Bacteria 1946
226 Ga0207689_10468109 3300025942 Bacteria 1054
227 Ga0207689_10632438 3300025942 Bacteria 901
228 Ga0207689_10760963 3300025942 Bacteria 817
229 Ga0207661_10005565 3300025944 Bacteria 8885
230 Ga0207661_10019196 3300025944 Bacteria 5092
231 Ga0207661_10243029 3300025944 Bacteria 1598
232 Ga0207661_10418249 3300025944 Bacteria 1217
233 Ga0207679_10032655 3300025945 Bacteria 3657
234 Ga0207679_10046356 3300025945 Bacteria 3151
235 Ga0207651_10240225 3300025960 Bacteria 1476
236 Ga0207651_10642968 3300025960 Bacteria 931
237 Ga0207712_10021390 3300025961 Bacteria 4247
238 Ga0207712_10082091 3300025961 Bacteria 2349
239 Ga0207668_10297007 3300025972 Bacteria 1332
240 Ga0207668_11088654 3300025972 Bacteria 716
241 Ga0207658_10080159 3300025986 Bacteria 2500
242 Ga0207658_10484661 3300025986 Bacteria 1099
243 Ga0207703_10040312 3300026035 Bacteria 3737
244 Ga0207703_10068063 3300026035 Bacteria 2933
245 Ga0207703_11130473 3300026035 Unclassified 753
246 Ga0207703_11640729 3300026035 Bacteria 618
247 Ga0207639_10675654 3300026041 Bacteria 957
248 Ga0207678_10101061 3300026067 Bacteria 2463
249 Ga0207678_11309946 3300026067 Bacteria 641
250 Ga0207641_10025635 3300026088 Bacteria 4861
251 Ga0207676_10077965 3300026095 Bacteria 2682
252 Ga0207676_11930841 3300026095 Bacteria 589
253 Ga0207674_10097965 3300026116 Bacteria 2916
254 Ga0207698_11044829 3300026142 Bacteria 828
255 Ga0207428_10018622 3300027907 Bacteria 5928
256 Ga0268265_10072204 3300028380 Bacteria 2691
257 Ga0307413_12116908 3300031824 Unclassified 509
258 Ga0307412_10632136 3300031911 Bacteria 911
259 Ga0307409_100846900 3300031995 Bacteria 925
260 Ga0307411_10170952 3300032005 Bacteria 1639
261 Ga0373954_0064218 3300035118 Bacteria 1736
262 Ga0373957_0016453 3300035120 Bacteria 2560
263 Ga0373946_0169724 3300035171 Unclassified 1029
264 Ga0373933_0946861 3300035724 Bacteria 567
265 Ga0373937_0156459 3300036401 Bacteria 2136
266 Ga0373925_0675872 3300037068 Bacteria 851
267 Ga0373925_1144246 3300037068 Bacteria 640
268 Ga0395905_0618538 3300037471 Unclassified 985
269 Ga0436364_0244742 3300037853 Unclassified 606
270 Ga0436364_0652262 3300037853 Bacteria 1403
271 Ga0395901_0121682 3300038443 Bacteria 2743
272 Ga0439462_0101755 3300042015 Bacteria 792
273 Ga0439434_0355813 3300042435 Bacteria 512
274 Ga0450916_022793 3300042530 Bacteria 870
275 Ga0453684_0007821 3300044712 Bacteria 19491
276 Ga0451576_0063172 3300045051 Bacteria 3860
277 Ga0451576_2367784 3300045051 Bacteria 544
278 Ga0495617_082888 3300046452 Bacteria 1050
279 Ga0495603_0016095 3300046455 Bacteria 4521
280 Ga0495603_0238673 3300046455 Bacteria 1047
281 Ga0495653_0438371 3300046463 Bacteria 824
282 Ga0495662_0025267 3300046476 Bacteria 2868
283 Ga0495594_0110102 3300046499 Bacteria 1553
284 Ga0495594_0477471 3300046499 Bacteria 709
285 Ga0495628_0530434 3300046516 Bacteria 847
286 Ga0495642_0091601 3300046528 Bacteria 1287
287 Ga0495665_0272577 3300046531 Bacteria 869
288 Ga0495598_0074641 3300046537 Bacteria 1075
289 Ga0495597_0109190 3300046542 Bacteria 1161
290 Ga0495667_0096065 3300046559 Bacteria 1918
291 Ga0495656_0075940 3300046615 Bacteria 1504
292 Ga0495668_0340179 3300046616 Bacteria 823
293 Ga0495634_0824969 3300046642 Bacteria 528
294 Ga0495635_0008525 3300046663 Bacteria 7161
295 Ga0495659_0431273 3300046664 Bacteria 572
296 Ga0495658_0036331 3300046683 Bacteria 2717
297 Ga0495658_1066037 3300046683 Bacteria 515
298 Ga0495613_0560054 3300046689 Bacteria 764
299 Ga0495624_0100112 3300046690 Bacteria 1785
300 Ga0495600_0338129 3300046809 Bacteria 944
301 Ga0495636_0076272 3300047318 Bacteria 1437
302 Ga0495672_0003854 3300047320 Bacteria 12613
303 Ga0495626_0098899 3300048091 Bacteria 1274
304 Ga0496102_0498341 3300048905 Bacteria 1140
305 Ga0496104_0002924 3300048907 Bacteria 14718
306 Ga0496104_0368980 3300048907 Bacteria 1348
307 Ga0496106_0175076 3300048909 Bacteria 1702
308 Ga0496107_1097137 3300048910 Bacteria 575
309 Ga0496108_0040628 3300048911 Bacteria 3879
310 Ga0496109_0048303 3300048912 Bacteria 3872
311 Ga0496110_0000616 3300048913 Bacteria 24547
312 Ga0496111_0009965 3300048914 Bacteria 6356
313 Ga0496112_0004201 3300048915 Bacteria 12144
314 Ga0496113_0220325 3300048916 Bacteria 1512
315 Ga0501309_087043 3300049129 Unclassified 529
316 Ga0501307_060032 3300049162 Bacteria 588
317 Ga0501311_057014 3300049527 Bacteria 624
318 Ga0501312_088814 3300049528 Bacteria 568
319 Ga0501320_031878 3300049536 Unclassified 659
320 Ga0501038_0285973 3300049574 Bacteria 1297
321 Ga0501039_0467720 3300049575 Bacteria 990
322 Ga0501039_0471973 3300049575 Bacteria 985
323 Ga0501040_0594363 3300049576 Bacteria 799
324 Ga0501041_0120439 3300049577 Bacteria 1631
325 Ga0501042_0769857 3300049578 Bacteria 700
326 Ga0501046_0207892 3300049580 Bacteria 1454
327 Ga0501047_0381995 3300049581 Bacteria 1243
328 Ga0501071_0080500 3300049587 Bacteria 2382
329 Ga0501072_0258589 3300049588 Bacteria 1386
330 Ga0501072_0338127 3300049588 Bacteria 1196
331 Ga0501074_0118330 3300049590 Bacteria 1895
332 Ga0501075_0054601 3300049591 Bacteria 3006
333 Ga0501077_0008738 3300049593 Bacteria 6286
334 Ga0501081_0101761 3300049743 Bacteria 2032
335 Ga0501035_0039386 3300049822 Bacteria 4277
336 Ga0501044_0307207 3300049823 Bacteria 1513
337 Ga0501045_0028942 3300049824 Bacteria 3999
338 nmdc:mga0yw44_246713_c1 3300050492 Bacteria 1188
339 nmdc:mga05p37_1690467_c1 3300050507 Bacteria 618
340 nmdc:mga05p37_249747_c1 3300050507 Bacteria 2128
341 nmdc:mga05p37_45041_c1 3300050507 Bacteria 5427
342 nmdc:mga05p37_810662_c1 3300050507 Bacteria 1023
343 nmdc:mga05p37_938289_c1 3300050507 Bacteria 928
344 nmdc:mga09592_180942_c1 3300050508 Bacteria 1824
345 nmdc:mga09592_338565_c1 3300050508 Bacteria 1302
346 nmdc:mga06r32_21171_c1 3300050510 Bacteria 6001
347 nmdc:mga08y16_109312_c1 3300050511 Bacteria 2879
348 nmdc:mga08y16_59506_c1 3300050511 Bacteria 3989
349 nmdc:mga0n895_116610_c1 3300050512 Bacteria 2689
350 nmdc:mga0n895_490103_c1 3300050512 Bacteria 1239
351 nmdc:mga0n895_882959_c1 3300050512 Bacteria 880
352 nmdc:mga0rr50_1177744_c1 3300050513 Bacteria 651
353 nmdc:mga0rr50_8497_c1 3300050513 Bacteria 6395
354 nmdc:mga0a205_3734_c1 3300050515 Bacteria 13635
355 nmdc:mga0a205_414639_c1 3300050515 Bacteria 1209
356 Ga0495601_0014627 3300053077 Bacteria 4730
357 Ga0500635_0103736 3300053080 Bacteria 1049
358 Ga0500646_0015270 3300053090 Bacteria 1999
359 Ga0500628_009732 3300053129 Bacteria 1702
360 Ga0500637_0049090 3300053178 Bacteria 2401
361 Ga0500656_004903 3300053732 Bacteria 1305
362 Ga0501084_0032326 3300054114 Bacteria 4377
363 Ga0501082_0003235 3300060353 Bacteria 14204
364 Ga0070671_100184481
365 Ga0065714_10170607
366 Ga0065712_10093308
367 Ga0065715_10098392
368 Ga0065715_10339393
369 Ga0065715_10382883
370 Ga0065715_10432786
371 Ga0065707_10171277
372 Ga0065707_10229857
373 Ga0070658_10118037
374 Ga0070676_10209420
375 Ga0070676_10488706
376 Ga0070683_100014957
377 Ga0070683_100062534
378 Ga0070683_100266855
379 Ga0070690_100031196
380 Ga0070690_100713256
381 Ga0070670_100005464
382 Ga0068869_100230624
383 Ga0068869_100622159
384 Ga0068869_100636908
385 Ga0068869_101839639
386 Ga0070666_11036692
387 Ga0070682_101349431
388 Ga0070660_100465378
389 Ga0070661_100242414
390 Ga0070661_100959280
391 Ga0070661_100982645
392 Ga0070669_100026789
393 Ga0070669_101235527
394 Ga0070675_100029180
395 Ga0070675_100185872
396 Ga0070675_100195982
397 Ga0070671_100063069
398 Ga0070671_100073496
399 Ga0070674_101405567
400 Ga0070673_100008747
401 Ga0070673_100274784
402 Ga0070688_100062782
403 Ga0070688_100150125
404 Ga0070688_101601192
405 Ga0070659_100095697
406 Ga0070667_100085490
407 Ga0070667_100128957
408 Ga0070667_100308370
409 Ga0070667_101633786
410 Ga0070705_100874936
411 Ga0070700_100110745
412 Ga0070694_101864059
413 Ga0070663_100426188
414 Ga0070663_101382639
415 Ga0070678_100148440
416 Ga0070662_100242968
417 Ga0070681_10033561
418 Ga0068867_100143014
419 Ga0070685_10267207
420 Ga0070707_100012614
421 Ga0070707_100653361
422 Ga0070699_100083073
423 Ga0070684_100000118
424 Ga0070684_100021149
425 Ga0070684_100760255
426 Ga0070684_101248231
427 Ga0070697_100798112
428 Ga0070697_101321306
429 Ga0068853_100052070
430 Ga0068853_100160882
431 Ga0068853_100568813
432 Ga0070672_100271572
433 Ga0070672_100307587
434 Ga0070672_101760304
435 Ga0070686_100058291
436 Ga0070686_100246958
437 Ga0070696_100647808
438 Ga0070693_100024001
439 Ga0068855_100050183
440 Ga0070664_100000696
441 Ga0070664_100020144
442 Ga0070664_100335343
443 Ga0068857_100006827
444 Ga0068857_100099860
445 Ga0068854_101458896
446 Ga0068856_100182023
447 Ga0070702_100277092
448 Ga0068852_100618525
449 Ga0068852_101074941
450 Ga0068859_100480214
451 Ga0068859_100706604
452 Ga0068859_100831825
453 Ga0068859_102800848
454 Ga0068864_100103241
455 Ga0068864_100295254
456 Ga0068864_100410270
457 Ga0068864_101325072
458 Ga0068864_101451088
459 Ga0068863_100013859
460 Ga0068858_100032762
461 Ga0068858_100181227
462 Ga0068858_100481476
463 Ga0068858_100682652
464 Ga0068858_101308547
465 Ga0068860_100658070
466 Ga0068862_100011716
467 Ga0068862_101283051
468 Ga0075364_10071459
469 Ga0097621_100847273
470 Ga0068871_100492934
471 Ga0068871_101361517
472 Ga0075431_100030535
473 Ga0075433_10044317
474 Ga0075433_10426829
475 Ga0075434_100322278
476 Ga0075434_100768631
477 Ga0075429_100105065
478 Ga0075429_100187897
479 Ga0075429_100191246
480 Ga0068865_100131104
481 Ga0097620_100480200
482 Ga0097620_100706594
483 Ga0097620_100831686
484 Ga0097620_102800722
485 Ga0075435_100608154
486 Ga0075435_100674982
487 Ga0075435_101243300
488 Ga0105240_10166125
489 Ga0105240_10249225
490 Ga0111539_10001757
491 Ga0111539_10174904
492 Ga0111539_10218127
493 Ga0105245_10012418
494 Ga0105245_10384224
495 Ga0105245_10830368
496 Ga0105245_11034467
497 Ga0105247_10157756
498 Ga0114129_10028125
499 Ga0114129_10087271
500 Ga0114129_10114210
501 Ga0114129_10373826
502 Ga0114129_10733830
503 Ga0105243_11352369
504 Ga0105241_10058980
505 Ga0105241_10106434
506 Ga0105241_10279275
507 Ga0105241_10284409
508 Ga0105242_10116464
509 Ga0105242_10231109
510 Ga0105242_10392602
511 Ga0105242_10466266
512 Ga0105242_10520243
513 Ga0105248_10059312
514 Ga0105248_10108060
515 Ga0105248_10112396
516 Ga0105248_10585274
517 Ga0105248_11709580
518 Ga0105248_11932422
519 Ga0105237_10018380
520 Ga0105237_10099544
521 Ga0105238_10011138
522 Ga0105238_10118751
523 Ga0105249_10003892
524 Ga0105249_10027872
525 Ga0105249_10058455
526 Ga0105249_10443372
527 Ga0105249_10699496
528 Ga0105249_11785276
529 Ga0105239_10007301
530 Ga0105239_10149470
531 Ga0105239_10502029
532 Ga0105239_10551666
533 Ga0105239_10594912
534 Ga0105239_11563926
535 Ga0105246_10416727
536 Ga0157373_10537950
537 Ga0157371_10916547
538 Ga0157370_10235750
539 Ga0157369_10278139
540 Ga0157374_10081376
541 Ga0157374_10206825
542 Ga0157374_10486100
543 Ga0157374_10686929
544 Ga0157378_10036340
545 Ga0157378_10096927
546 Ga0157378_10237909
547 Ga0157378_10479965
548 Ga0157378_11118020
549 Ga0163162_10819679
550 Ga0157372_10087325
551 Ga0157375_10497890
552 Ga0157375_10592120
553 Ga0157375_10825647
554 Ga0163163_10369687
555 Ga0163163_10577273
556 Ga0163163_11584777
557 Ga0157380_11135440
558 Ga0157377_10454690
559 Ga0157377_10730274
560 Ga0157379_11046220
561 Ga0157376_10178132
562 Ga0207697_10054000
563 Ga0207642_10320534
564 Ga0207710_10173390
565 Ga0207680_10062526
566 Ga0207645_10142381
567 Ga0207645_10283607
568 Ga0207705_10231481
569 Ga0207707_11240740
570 Ga0207695_10120373
571 Ga0207671_10037641
572 Ga0207671_10408302
573 Ga0207646_10042226
574 Ga0207681_10374481
575 Ga0207650_10035932
576 Ga0207659_10089390
577 Ga0207687_10002583
578 Ga0207687_10093281
579 Ga0207644_10187574
580 Ga0207644_10744537
581 Ga0207686_10025276
582 Ga0207670_10179004
583 Ga0207704_10989021
584 Ga0207691_10377727
585 Ga0207711_10079452
586 Ga0207711_10498792
587 Ga0207711_10676611
588 Ga0207689_10146347
589 Ga0207689_10468109
590 Ga0207689_10632438
591 Ga0207689_10760963
592 Ga0207661_10005565
593 Ga0207661_10019196
594 Ga0207661_10243029
595 Ga0207661_10418249
596 Ga0207679_10032655
597 Ga0207679_10046356
598 Ga0207651_10240225
599 Ga0207651_10642968
600 Ga0207712_10021390
601 Ga0207712_10082091
602 Ga0207668_10297007
603 Ga0207668_11088654
604 Ga0207658_10080159
605 Ga0207658_10484661
606 Ga0207703_10040312
607 Ga0207703_10068063
608 Ga0207703_11130473
609 Ga0207703_11640729
610 Ga0207639_10675654
611 Ga0207678_10101061
612 Ga0207678_11309946
613 Ga0207641_10025635
614 Ga0207676_10077965
615 Ga0207676_11930841
616 Ga0207674_10097965
617 Ga0207698_11044829
618 Ga0207428_10018622
619 Ga0268265_10072204
620 Ga0307413_12116908
621 Ga0307412_10632136
622 Ga0307409_100846900
623 Ga0307411_10170952
624 Ga0373954_0064218
625 Ga0373957_0016453
626 Ga0373946_0169724
627 Ga0373933_0946861
628 Ga0373937_0156459
629 Ga0373925_0675872
630 Ga0373925_1144246
631 Ga0395905_0618538
632 Ga0436364_0244742
633 Ga0436364_0652262
634 Ga0395901_0121682
635 Ga0439462_0101755
636 Ga0439434_0355813
637 Ga0450916_022793
638 Ga0453684_0007821
639 Ga0451576_0063172
640 Ga0451576_2367784
641 Ga0495617_082888
642 Ga0495603_0016095
643 Ga0495603_0238673
644 Ga0495653_0438371
645 Ga0495662_0025267
646 Ga0495594_0110102
647 Ga0495594_0477471
648 Ga0495628_0530434
649 Ga0495642_0091601
650 Ga0495665_0272577
651 Ga0495598_0074641
652 Ga0495597_0109190
653 Ga0495667_0096065
654 Ga0495656_0075940
655 Ga0495668_0340179
656 Ga0495634_0824969
657 Ga0495635_0008525
658 Ga0495659_0431273
659 Ga0495658_0036331
660 Ga0495658_1066037
661 Ga0495613_0560054
662 Ga0495624_0100112
663 Ga0495600_0338129
664 Ga0495636_0076272
665 Ga0495672_0003854
666 Ga0495626_0098899
667 Ga0496102_0498341
668 Ga0496104_0002924
669 Ga0496104_0368980
670 Ga0496106_0175076
671 Ga0496107_1097137
672 Ga0496108_0040628
673 Ga0496109_0048303
674 Ga0496110_0000616
675 Ga0496111_0009965
676 Ga0496112_0004201
677 Ga0496113_0220325
678 Ga0501309_087043
679 Ga0501307_060032
680 Ga0501311_057014
681 Ga0501312_088814
682 Ga0501320_031878
683 Ga0501038_0285973
684 Ga0501039_0467720
685 Ga0501039_0471973
686 Ga0501040_0594363
687 Ga0501041_0120439
688 Ga0501042_0769857
689 Ga0501046_0207892
690 Ga0501047_0381995
691 Ga0501071_0080500
692 Ga0501072_0258589
693 Ga0501072_0338127
694 Ga0501074_0118330
695 Ga0501075_0054601
696 Ga0501077_0008738
697 Ga0501081_0101761
698 Ga0501035_0039386
699 Ga0501044_0307207
700 Ga0501045_0028942
701 nmdc:mga0yw44_246713_c1
702 nmdc:mga05p37_1690467_c1
703 nmdc:mga05p37_249747_c1
704 nmdc:mga05p37_45041_c1
705 nmdc:mga05p37_810662_c1
706 nmdc:mga05p37_938289_c1
707 nmdc:mga09592_180942_c1
708 nmdc:mga09592_338565_c1
709 nmdc:mga06r32_21171_c1
710 nmdc:mga08y16_109312_c1
711 nmdc:mga08y16_59506_c1
712 nmdc:mga0n895_116610_c1
713 nmdc:mga0n895_490103_c1
714 nmdc:mga0n895_882959_c1
715 nmdc:mga0rr50_1177744_c1
716 nmdc:mga0rr50_8497_c1
717 nmdc:mga0a205_3734_c1
718 nmdc:mga0a205_414639_c1
719 Ga0495601_0014627
720 Ga0500635_0103736
721 Ga0500646_0015270
722 Ga0500628_009732
723 Ga0500637_0049090
724 Ga0500656_004903
725 Ga0501084_0032326
726 Ga0501082_0003235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

1

131

0.87

Map