F422753

General Info

Members Datasets Scaffolds Average Seq Length
362 240 724 135

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0216510|Ga0496112_0216510_100_600
Length 166
Sequence MTPGLIPTSSSRTPGSIRSVSRRFAQAGLESFAMNWLFKEEPEHYSYDDLVRDGRTSWTGVRNPVAQRNLRSVKKGDKIFFYHTGNEKAVIGICRAAGDAYADPADKSGKLFAVDVEPVKKLKSPVTLAAIKADRKFATFVLTRVPRLSVMPVSDEEWKAIVAMGG

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0
Rhizoplane 4.97
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 19.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0216510 3300048915 Unclassified 1871
2 Ga0065704_10349557 3300005289 Unclassified 812
3 Ga0065712_10077081 3300005290 Bacteria 3549
4 Ga0065712_10087410 3300005290 Bacteria 2565
5 Ga0065715_10101037 3300005293 Bacteria 3243
6 Ga0065715_10102494 3300005293 Bacteria 3110
7 Ga0065715_10102582 3300005293 Bacteria 3098
8 Ga0065715_10385204 3300005293 Unclassified 902
9 Ga0065715_10553461 3300005293 Unclassified 739
10 Ga0065707_10004169 3300005295 Bacteria 3569
11 Ga0065707_10124185 3300005295 Bacteria 2049
12 Ga0070676_10038575 3300005328 Bacteria 2759
13 Ga0070683_100000776 3300005329 Bacteria 23494
14 Ga0070683_100263928 3300005329 Bacteria 1638
15 Ga0070690_100064859 3300005330 Bacteria 2360
16 Ga0070670_100003061 3300005331 Bacteria 13836
17 Ga0070670_100044354 3300005331 Archaea 3824
18 Ga0068869_100025397 3300005334 Bacteria 4114
19 Ga0068869_101641488 3300005334 Bacteria 573
20 Ga0070666_10032834 3300005335 Bacteria 3431
21 Ga0070666_10214602 3300005335 Bacteria 1356
22 Ga0070666_11134440 3300005335 Bacteria 581
23 Ga0070680_100874418 3300005336 Bacteria 775
24 Ga0070682_100074126 3300005337 Bacteria 2185
25 Ga0068868_100104504 3300005338 Bacteria 2296
26 Ga0070660_100195611 3300005339 Bacteria 1639
27 Ga0070689_100095139 3300005340 Bacteria 2353
28 Ga0070689_100736434 3300005340 Unclassified 863
29 Ga0070691_10012638 3300005341 Bacteria 3867
30 Ga0070687_100036040 3300005343 Bacteria 2461
31 Ga0070661_100004773 3300005344 Bacteria 9330
32 Ga0070661_101341111 3300005344 Unclassified 601
33 Ga0070668_101162088 3300005347 Unclassified 698
34 Ga0070669_100000442 3300005353 Bacteria 31705
35 Ga0070669_100037873 3300005353 Bacteria 3499
36 Ga0070669_100260567 3300005353 Bacteria 1383
37 Ga0070675_100038475 3300005354 Bacteria 3899
38 Ga0070675_100071360 3300005354 Bacteria 2881
39 Ga0070675_100682566 3300005354 Bacteria 935
40 Ga0070671_100014370 3300005355 Bacteria 6396
41 Ga0070671_100043414 3300005355 Bacteria 3735
42 Ga0070673_100037064 3300005364 Bacteria 3712
43 Ga0070673_100519067 3300005364 Bacteria 1079
44 Ga0070688_100058086 3300005365 Bacteria 2435
45 Ga0070659_100056286 3300005366 Bacteria 3101
46 Ga0070659_100388757 3300005366 Bacteria 1176
47 Ga0070659_100772791 3300005366 Unclassified 834
48 Ga0070713_100001966 3300005436 Bacteria 13264
49 Ga0070710_11219788 3300005437 Unclassified 557
50 Ga0070701_10022114 3300005438 Bacteria 3045
51 Ga0070701_10218797 3300005438 Bacteria 1135
52 Ga0070711_100708405 3300005439 Bacteria 848
53 Ga0070705_100032882 3300005440 Bacteria 2886
54 Ga0070700_100405047 3300005441 Bacteria 1027
55 Ga0070694_100046903 3300005444 Bacteria 2903
56 Ga0070694_100616507 3300005444 Unclassified 875
57 Ga0070663_100047858 3300005455 Bacteria 3030
58 Ga0070678_100251826 3300005456 Bacteria 1481
59 Ga0070662_101653681 3300005457 Unclassified 553
60 Ga0068867_100137593 3300005459 Unclassified 1906
61 Ga0070706_100363672 3300005467 Bacteria 1348
62 Ga0070698_100032205 3300005471 Bacteria 5431
63 Ga0070699_100052804 3300005518 Bacteria 3517
64 Ga0070699_100248096 3300005518 Bacteria 1590
65 Ga0070679_100670196 3300005530 Bacteria 980
66 Ga0070684_100000689 3300005535 Bacteria 23237
67 Ga0070684_100153029 3300005535 Bacteria 2090
68 Ga0068853_100260115 3300005539 Unclassified 1595
69 Ga0070672_100277652 3300005543 Bacteria 1416
70 Ga0070686_100143537 3300005544 Bacteria 1664
71 Ga0070686_100611420 3300005544 Unclassified 860
72 Ga0070696_100127820 3300005546 Bacteria 1846
73 Ga0070696_100189558 3300005546 Unclassified 1530
74 Ga0070693_100028844 3300005547 Bacteria 3021
75 Ga0070693_100074618 3300005547 Bacteria 2007
76 Ga0070704_100028367 3300005549 Bacteria 3723
77 Ga0070704_100276802 3300005549 Bacteria 1389
78 Ga0070704_100819118 3300005549 Bacteria 833
79 Ga0070664_100001823 3300005564 Bacteria 17069
80 Ga0070664_100509173 3300005564 Bacteria 1110
81 Ga0070664_100597446 3300005564 Bacteria 1023
82 Ga0070664_100769689 3300005564 Bacteria 899
83 Ga0068857_100059332 3300005577 Bacteria 3399
84 Ga0068857_100357842 3300005577 Bacteria 1353
85 Ga0068854_100608639 3300005578 Bacteria 934
86 Ga0070702_100059304 3300005615 Bacteria 2220
87 Ga0068852_100226141 3300005616 Bacteria 1782
88 Ga0068859_100056899 3300005617 Bacteria 3938
89 Ga0068864_100113118 3300005618 Bacteria 2420
90 Ga0068864_100303275 3300005618 Bacteria 1496
91 Ga0068866_10115964 3300005718 Unclassified 1502
92 Ga0068861_100143978 3300005719 Bacteria 1949
93 Ga0068861_101846830 3300005719 Unclassified 600
94 Ga0068851_10837954 3300005834 Unclassified 573
95 Ga0068863_100137319 3300005841 Bacteria 2336
96 Ga0068863_100180242 3300005841 Bacteria 2028
97 Ga0068858_100176421 3300005842 Bacteria 2016
98 Ga0068860_100099425 3300005843 Bacteria 2774
99 Ga0068860_100294078 3300005843 Bacteria 1590
100 Ga0068862_100135962 3300005844 Bacteria 2178
101 Ga0068862_100255507 3300005844 Bacteria 1598
102 Ga0068862_101919564 3300005844 Unclassified 602
103 Ga0070717_11432341 3300006028 Unclassified 627
104 Ga0075365_10000817 3300006038 Bacteria 12836
105 Ga0075365_10082037 3300006038 Bacteria 2186
106 Ga0075365_10526531 3300006038 Bacteria 836
107 Ga0075368_10340440 3300006042 Bacteria 652
108 Ga0075364_10001115 3300006051 Bacteria 14338
109 Ga0075364_10005958 3300006051 Bacteria 7128
110 Ga0075364_10297603 3300006051 Bacteria 1098
111 Ga0075364_10385683 3300006051 Bacteria 956
112 Ga0075362_10001884 3300006177 Bacteria 6878
113 Ga0075367_10005997 3300006178 Bacteria 6103
114 Ga0075367_10011739 3300006178 Bacteria 4648
115 Ga0075366_10070745 3300006195 Bacteria 2078
116 Ga0097621_101610316 3300006237 Unclassified 617
117 Ga0075370_10081565 3300006353 Bacteria 1859
118 Ga0075428_100011641 3300006844 Bacteria 9787
119 Ga0075428_100478062 3300006844 Bacteria 1333
120 Ga0075431_100017023 3300006847 Bacteria 7382
121 Ga0075433_10048030 3300006852 Bacteria 3711
122 Ga0075434_100028510 3300006871 Bacteria 5486
123 Ga0075429_100008601 3300006880 Bacteria 8879
124 Ga0068865_100345709 3300006881 Bacteria 1203
125 Ga0068865_100566766 3300006881 Unclassified 956
126 Ga0075436_100161424 3300006914 Bacteria 1580
127 Ga0075436_100799667 3300006914 Bacteria 702
128 Ga0097620_100056898 3300006931 Bacteria 3938
129 Ga0097620_100280368 3300006931 Bacteria 1759
130 Ga0075435_100550415 3300007076 Bacteria 999
131 Ga0075435_100590450 3300007076 Bacteria 963
132 Ga0105240_10240473 3300009093 Bacteria 2099
133 Ga0105240_10464980 3300009093 Bacteria 1413
134 Ga0111539_10000973 3300009094 Bacteria 37589
135 Ga0111539_10051691 3300009094 Bacteria 4893
136 Ga0111539_10069373 3300009094 Bacteria 4162
137 Ga0111539_10143770 3300009094 Bacteria 2792
138 Ga0111539_10155565 3300009094 Bacteria 2675
139 Ga0111539_11191390 3300009094 Bacteria 885
140 Ga0111539_11867513 3300009094 Bacteria 697
141 Ga0105245_10186996 3300009098 Bacteria 1982
142 Ga0114129_10490259 3300009147 Unclassified 1606
143 Ga0114129_10587597 3300009147 Bacteria 1444
144 Ga0105243_10092106 3300009148 Bacteria 2498
145 Ga0105242_10020520 3300009176 Bacteria 5181
146 Ga0105248_10028898 3300009177 Bacteria 6181
147 Ga0105248_11468678 3300009177 Bacteria 772
148 Ga0105238_10429863 3300009551 Bacteria 1316
149 Ga0105238_10470812 3300009551 Bacteria 1255
150 Ga0105249_10006672 3300009553 Bacteria 10051
151 Ga0105249_11013369 3300009553 Bacteria 899
152 Ga0105249_11071677 3300009553 Bacteria 876
153 Ga0105249_11144841 3300009553 Bacteria 849
154 Ga0105249_11477040 3300009553 Bacteria 752
155 Ga0105246_10379640 3300011119 Bacteria 1167
156 Ga0105246_11520355 3300011119 Bacteria 629
157 Ga0157374_10074949 3300013296 Bacteria 3197
158 Ga0157378_10111239 3300013297 Bacteria 2511
159 Ga0163163_10022564 3300014325 Bacteria 5963
160 Ga0163163_10048027 3300014325 Bacteria 4196
161 Ga0163163_10161392 3300014325 Bacteria 2287
162 Ga0157380_10325090 3300014326 Bacteria 1428
163 Ga0157377_10290532 3300014745 Unclassified 1075
164 Ga0157376_11493459 3300014969 Bacteria 709
165 Ga0207697_10011219 3300025315 Bacteria 3796
166 Ga0207656_10326393 3300025321 Unclassified 763
167 Ga0207692_10940184 3300025898 Unclassified 569
168 Ga0207688_10022067 3300025901 Bacteria 3483
169 Ga0207688_10259405 3300025901 Unclassified 1054
170 Ga0207680_10092926 3300025903 Bacteria 1923
171 Ga0207647_10237840 3300025904 Bacteria 1046
172 Ga0207647_10458049 3300025904 Unclassified 714
173 Ga0207645_10004910 3300025907 Bacteria 9806
174 Ga0207684_10697050 3300025910 Bacteria 863
175 Ga0207695_10233241 3300025913 Bacteria 1744
176 Ga0207663_10606088 3300025916 Bacteria 861
177 Ga0207660_11063563 3300025917 Bacteria 660
178 Ga0207662_10001717 3300025918 Bacteria 10727
179 Ga0207657_10186819 3300025919 Bacteria 1673
180 Ga0207649_10089113 3300025920 Bacteria 2016
181 Ga0207652_11163732 3300025921 Bacteria 673
182 Ga0207681_10008449 3300025923 Bacteria 6293
183 Ga0207694_10534250 3300025924 Bacteria 983
184 Ga0207694_10618375 3300025924 Bacteria 911
185 Ga0207650_10007845 3300025925 Bacteria 7272
186 Ga0207650_10031209 3300025925 Bacteria 3846
187 Ga0207659_10184629 3300025926 Bacteria 1655
188 Ga0207659_10278536 3300025926 Bacteria 1367
189 Ga0207687_11950788 3300025927 Bacteria 502
190 Ga0207700_10004794 3300025928 Bacteria 8025
191 Ga0207644_10124824 3300025931 Bacteria 1963
192 Ga0207644_10249268 3300025931 Bacteria 1416
193 Ga0207690_10040907 3300025932 Bacteria 3033
194 Ga0207690_10156434 3300025932 Bacteria 1695
195 Ga0207690_10183448 3300025932 Bacteria 1577
196 Ga0207706_10072949 3300025933 Bacteria 3018
197 Ga0207706_10118154 3300025933 Unclassified 2332
198 Ga0207706_10208614 3300025933 Bacteria 1713
199 Ga0207706_10346793 3300025933 Bacteria 1291
200 Ga0207709_10152491 3300025935 Bacteria 1602
201 Ga0207670_10063359 3300025936 Bacteria 2530
202 Ga0207704_11881488 3300025938 Unclassified 515
203 Ga0207665_10465465 3300025939 Unclassified 972
204 Ga0207691_10113959 3300025940 Bacteria 2402
205 Ga0207691_10165658 3300025940 Unclassified 1937
206 Ga0207689_10003739 3300025942 Bacteria 13870
207 Ga0207661_10003343 3300025944 Bacteria 11127
208 Ga0207679_10007887 3300025945 Bacteria 6765
209 Ga0207679_10204341 3300025945 Unclassified 1652
210 Ga0207679_10210400 3300025945 Bacteria 1630
211 Ga0207679_10554991 3300025945 Bacteria 1031
212 Ga0207679_10673793 3300025945 Bacteria 937
213 Ga0207667_11329986 3300025949 Bacteria 694
214 Ga0207651_10026255 3300025960 Bacteria 3634
215 Ga0207712_10117052 3300025961 Bacteria 2009
216 Ga0207668_11007377 3300025972 Unclassified 745
217 Ga0207668_11122040 3300025972 Unclassified 705
218 Ga0207658_10185094 3300025986 Bacteria 1727
219 Ga0207677_10216306 3300026023 Bacteria 1534
220 Ga0207677_10672618 3300026023 Bacteria 916
221 Ga0207703_12359319 3300026035 Unclassified 508
222 Ga0207639_10390558 3300026041 Bacteria 1252
223 Ga0207678_10063067 3300026067 Bacteria 3185
224 Ga0207708_10024885 3300026075 Bacteria 4530
225 Ga0207702_10915635 3300026078 Bacteria 869
226 Ga0207641_10051618 3300026088 Bacteria 3483
227 Ga0207641_10133381 3300026088 Bacteria 2233
228 Ga0207648_10053912 3300026089 Bacteria 3514
229 Ga0207676_10045903 3300026095 Bacteria 3378
230 Ga0207676_11007587 3300026095 Unclassified 821
231 Ga0207674_10013238 3300026116 Bacteria 9167
232 Ga0207674_10270452 3300026116 Bacteria 1647
233 Ga0207675_100147714 3300026118 Unclassified 2236
234 Ga0207675_100496988 3300026118 Bacteria 1214
235 Ga0207675_101535352 3300026118 Bacteria 687
236 Ga0207683_10088172 3300026121 Bacteria 2760
237 Ga0207698_10028342 3300026142 Bacteria 3992
238 Ga0209967_1045343 3300027364 Bacteria 671
239 Ga0268266_11553576 3300028379 Bacteria 637
240 Ga0268265_10015035 3300028380 Bacteria 5286
241 Ga0268265_10729105 3300028380 Bacteria 960
242 Ga0268265_11675056 3300028380 Bacteria 642
243 Ga0268265_11831366 3300028380 Unclassified 613
244 Ga0268264_10099769 3300028381 Bacteria 2520
245 Ga0307408_100091118 3300031548 Bacteria 2302
246 Ga0307408_100111875 3300031548 Bacteria 2099
247 Ga0307408_100142795 3300031548 Bacteria 1881
248 Ga0307409_100029367 3300031995 Bacteria 3934
249 Ga0307416_100387691 3300032002 Bacteria 1430
250 Ga0307416_100611982 3300032002 Unclassified 1170
251 Ga0307411_10500434 3300032005 Bacteria 1027
252 Ga0307415_100069951 3300032126 Bacteria 2463
253 Ga0373934_0466060 3300035086 Bacteria 530
254 Ga0373944_0360625 3300035089 Unclassified 554
255 Ga0373923_0234942 3300035111 Bacteria 855
256 Ga0373941_0035077 3300035115 Unclassified 1517
257 Ga0373956_0116802 3300035119 Bacteria 1245
258 Ga0373943_0456131 3300035170 Bacteria 743
259 Ga0373946_0514703 3300035171 Bacteria 615
260 Ga0373955_0061662 3300035172 Bacteria 2072
261 Ga0373962_0072806 3300035242 Unclassified 1030
262 Ga0373931_0134846 3300035691 Unclassified 1425
263 Ga0373947_0016293 3300035725 Bacteria 4272
264 Ga0373937_0001826 3300036401 Bacteria 17866
265 Ga0373925_0000535 3300037068 Bacteria 37601
266 Ga0373925_0860893 3300037068 Unclassified 747
267 Ga0373925_0971559 3300037068 Unclassified 700
268 Ga0395905_0330368 3300037471 Bacteria 1415
269 Ga0436365_0379691 3300039437 Bacteria 1056
270 Ga0439461_0165873 3300041410 Unclassified 578
271 Ga0451802_1729298 3300041460 Unclassified 530
272 Ga0451807_2487186 3300041486 Unclassified 662
273 Ga0451851_0092277 3300041507 Unclassified 518
274 Ga0451853_0862048 3300041512 Unclassified 631
275 Ga0451853_3494059 3300041512 Unclassified 598
276 Ga0439433_0167481 3300041999 Unclassified 571
277 Ga0439462_0042860 3300042015 Bacteria 1209
278 Ga0450898_081793 3300042134 Bacteria 657
279 Ga0439446_0025387 3300042156 Bacteria 1694
280 Ga0451577_0582549 3300042876 Bacteria 1015
281 Ga0453684_0253860 3300044712 Bacteria 2018
282 Ga0495638_0022026 3300046460 Bacteria 4188
283 Ga0495582_0173001 3300046473 Bacteria 1230
284 Ga0495662_0397781 3300046476 Bacteria 677
285 Ga0495608_0280326 3300046511 Bacteria 1035
286 Ga0495618_0648089 3300046514 Bacteria 625
287 Ga0495640_0364342 3300046533 Bacteria 891
288 Ga0495586_0590692 3300046535 Bacteria 641
289 Ga0495645_0001963 3300046543 Bacteria 13970
290 Ga0495635_0481670 3300046663 Bacteria 818
291 Ga0495599_0606111 3300046678 Unclassified 637
292 Ga0495613_0213707 3300046689 Bacteria 1356
293 Ga0495589_0518661 3300046794 Unclassified 544
294 Ga0495604_0804363 3300047317 Bacteria 592
295 Ga0495674_0167371 3300047319 Bacteria 1836
296 Ga0495684_0171989 3300047471 Bacteria 1610
297 Ga0496104_0209601 3300048907 Bacteria 1860
298 Ga0496104_1081935 3300048907 Bacteria 705
299 Ga0496105_0405655 3300048908 Bacteria 1081
300 Ga0496106_0673541 3300048909 Bacteria 826
301 Ga0496107_0025591 3300048910 Unclassified 4179
302 Ga0496108_0001541 3300048911 Bacteria 18246
303 Ga0496109_0002482 3300048912 Bacteria 15456
304 Ga0496110_0001637 3300048913 Bacteria 16436
305 Ga0496110_1199802 3300048913 Unclassified 668
306 Ga0496111_0146239 3300048914 Bacteria 1752
307 Ga0496112_0000511 3300048915 Bacteria 26327
308 Ga0496112_0062688 3300048915 Bacteria 3668
309 Ga0496113_0043985 3300048916 Bacteria 3307
310 Ga0496113_0231385 3300048916 Bacteria 1474
311 Ga0496114_0680195 3300048917 Bacteria 903
312 Ga0501031_0700489 3300049568 Bacteria 650
313 Ga0501031_0765039 3300049568 Unclassified 620
314 Ga0501036_0472562 3300049572 Unclassified 1044
315 Ga0501037_0175936 3300049573 Bacteria 1520
316 Ga0501037_0572360 3300049573 Unclassified 761
317 Ga0501038_0847930 3300049574 Unclassified 677
318 Ga0501041_0714490 3300049577 Bacteria 641
319 Ga0501042_1097775 3300049578 Bacteria 580
320 Ga0501043_0916035 3300049579 Bacteria 628
321 Ga0501067_0515324 3300049583 Unclassified 669
322 Ga0501069_0174204 3300049585 Bacteria 1242
323 Ga0501070_1231982 3300049586 Unclassified 573
324 Ga0501071_0090177 3300049587 Bacteria 2251
325 Ga0501074_0502941 3300049590 Unclassified 858
326 Ga0501075_0026547 3300049591 Bacteria 4265
327 Ga0501076_1039498 3300049592 Bacteria 675
328 Ga0501202_033112 3300049652 Unclassified 1087
329 Ga0501079_0446516 3300049741 Unclassified 1016
330 Ga0501079_1229252 3300049741 Unclassified 590
331 Ga0501081_0609340 3300049743 Unclassified 818
332 nmdc:mga03683_290071_c1 3300050489 Bacteria 766
333 nmdc:mga00v17_9789_c1 3300050491 Bacteria 5207
334 nmdc:mga0yw44_251907_c1 3300050492 Bacteria 1175
335 nmdc:mga0yw44_485441_c1 3300050492 Bacteria 838
336 nmdc:mga0yw44_525687_c1 3300050492 Bacteria 803
337 nmdc:mga0k408_639976_c1 3300050493 Bacteria 626
338 nmdc:mga0k408_702_c1 3300050493 Bacteria 18324
339 nmdc:mga06z11_15841_c1 3300050494 Bacteria 3377
340 nmdc:mga06z11_1728_c1 3300050494 Bacteria 8212
341 nmdc:mga07m45_19036_c1 3300050496 Bacteria 3715
342 nmdc:mga05p37_161219_c1 3300050507 Bacteria 2739
343 nmdc:mga09592_176284_c1 3300050508 Unclassified 1849
344 nmdc:mga06r32_8971_c1 3300050510 Bacteria 9009
345 nmdc:mga08y16_131969_c1 3300050511 Bacteria 2597
346 nmdc:mga08y16_140226_c1 3300050511 Bacteria 2513
347 nmdc:mga08y16_231984_c1 3300050511 Unclassified 1909
348 nmdc:mga08y16_405617_c1 3300050511 Bacteria 1394
349 nmdc:mga08y16_9075_c1 3300050511 Bacteria 10439
350 nmdc:mga0n895_2257_c1 3300050512 Bacteria 14931
351 nmdc:mga0n895_270067_c1 3300050512 Bacteria 1725
352 nmdc:mga0n895_474907_c1 3300050512 Bacteria 1261
353 nmdc:mga0rr50_1805240_c1 3300050513 Bacteria 515
354 nmdc:mga0rr50_21259_c1 3300050513 Bacteria 4426
355 nmdc:mga0rr50_689583_c1 3300050513 Bacteria 872
356 nmdc:mga08x19_80769_c2 3300050514 Bacteria 1631
357 nmdc:mga0a205_33403_c1 3300050515 Bacteria 4933
358 Ga0495595_0154681 3300053084 Bacteria 1129
359 Ga0495619_0077231 3300053085 Bacteria 2237
360 Ga0500628_003459 3300053129 Bacteria 2608
361 Ga0500628_031385 3300053129 Bacteria 1156
362 Ga0500628_167750 3300053129 Unclassified 622
363 Ga0496112_0216510
364 Ga0065704_10349557
365 Ga0065712_10077081
366 Ga0065712_10087410
367 Ga0065715_10101037
368 Ga0065715_10102494
369 Ga0065715_10102582
370 Ga0065715_10385204
371 Ga0065715_10553461
372 Ga0065707_10004169
373 Ga0065707_10124185
374 Ga0070676_10038575
375 Ga0070683_100000776
376 Ga0070683_100263928
377 Ga0070690_100064859
378 Ga0070670_100003061
379 Ga0070670_100044354
380 Ga0068869_100025397
381 Ga0068869_101641488
382 Ga0070666_10032834
383 Ga0070666_10214602
384 Ga0070666_11134440
385 Ga0070680_100874418
386 Ga0070682_100074126
387 Ga0068868_100104504
388 Ga0070660_100195611
389 Ga0070689_100095139
390 Ga0070689_100736434
391 Ga0070691_10012638
392 Ga0070687_100036040
393 Ga0070661_100004773
394 Ga0070661_101341111
395 Ga0070668_101162088
396 Ga0070669_100000442
397 Ga0070669_100037873
398 Ga0070669_100260567
399 Ga0070675_100038475
400 Ga0070675_100071360
401 Ga0070675_100682566
402 Ga0070671_100014370
403 Ga0070671_100043414
404 Ga0070673_100037064
405 Ga0070673_100519067
406 Ga0070688_100058086
407 Ga0070659_100056286
408 Ga0070659_100388757
409 Ga0070659_100772791
410 Ga0070713_100001966
411 Ga0070710_11219788
412 Ga0070701_10022114
413 Ga0070701_10218797
414 Ga0070711_100708405
415 Ga0070705_100032882
416 Ga0070700_100405047
417 Ga0070694_100046903
418 Ga0070694_100616507
419 Ga0070663_100047858
420 Ga0070678_100251826
421 Ga0070662_101653681
422 Ga0068867_100137593
423 Ga0070706_100363672
424 Ga0070698_100032205
425 Ga0070699_100052804
426 Ga0070699_100248096
427 Ga0070679_100670196
428 Ga0070684_100000689
429 Ga0070684_100153029
430 Ga0068853_100260115
431 Ga0070672_100277652
432 Ga0070686_100143537
433 Ga0070686_100611420
434 Ga0070696_100127820
435 Ga0070696_100189558
436 Ga0070693_100028844
437 Ga0070693_100074618
438 Ga0070704_100028367
439 Ga0070704_100276802
440 Ga0070704_100819118
441 Ga0070664_100001823
442 Ga0070664_100509173
443 Ga0070664_100597446
444 Ga0070664_100769689
445 Ga0068857_100059332
446 Ga0068857_100357842
447 Ga0068854_100608639
448 Ga0070702_100059304
449 Ga0068852_100226141
450 Ga0068859_100056899
451 Ga0068864_100113118
452 Ga0068864_100303275
453 Ga0068866_10115964
454 Ga0068861_100143978
455 Ga0068861_101846830
456 Ga0068851_10837954
457 Ga0068863_100137319
458 Ga0068863_100180242
459 Ga0068858_100176421
460 Ga0068860_100099425
461 Ga0068860_100294078
462 Ga0068862_100135962
463 Ga0068862_100255507
464 Ga0068862_101919564
465 Ga0070717_11432341
466 Ga0075365_10000817
467 Ga0075365_10082037
468 Ga0075365_10526531
469 Ga0075368_10340440
470 Ga0075364_10001115
471 Ga0075364_10005958
472 Ga0075364_10297603
473 Ga0075364_10385683
474 Ga0075362_10001884
475 Ga0075367_10005997
476 Ga0075367_10011739
477 Ga0075366_10070745
478 Ga0097621_101610316
479 Ga0075370_10081565
480 Ga0075428_100011641
481 Ga0075428_100478062
482 Ga0075431_100017023
483 Ga0075433_10048030
484 Ga0075434_100028510
485 Ga0075429_100008601
486 Ga0068865_100345709
487 Ga0068865_100566766
488 Ga0075436_100161424
489 Ga0075436_100799667
490 Ga0097620_100056898
491 Ga0097620_100280368
492 Ga0075435_100550415
493 Ga0075435_100590450
494 Ga0105240_10240473
495 Ga0105240_10464980
496 Ga0111539_10000973
497 Ga0111539_10051691
498 Ga0111539_10069373
499 Ga0111539_10143770
500 Ga0111539_10155565
501 Ga0111539_11191390
502 Ga0111539_11867513
503 Ga0105245_10186996
504 Ga0114129_10490259
505 Ga0114129_10587597
506 Ga0105243_10092106
507 Ga0105242_10020520
508 Ga0105248_10028898
509 Ga0105248_11468678
510 Ga0105238_10429863
511 Ga0105238_10470812
512 Ga0105249_10006672
513 Ga0105249_11013369
514 Ga0105249_11071677
515 Ga0105249_11144841
516 Ga0105249_11477040
517 Ga0105246_10379640
518 Ga0105246_11520355
519 Ga0157374_10074949
520 Ga0157378_10111239
521 Ga0163163_10022564
522 Ga0163163_10048027
523 Ga0163163_10161392
524 Ga0157380_10325090
525 Ga0157377_10290532
526 Ga0157376_11493459
527 Ga0207697_10011219
528 Ga0207656_10326393
529 Ga0207692_10940184
530 Ga0207688_10022067
531 Ga0207688_10259405
532 Ga0207680_10092926
533 Ga0207647_10237840
534 Ga0207647_10458049
535 Ga0207645_10004910
536 Ga0207684_10697050
537 Ga0207695_10233241
538 Ga0207663_10606088
539 Ga0207660_11063563
540 Ga0207662_10001717
541 Ga0207657_10186819
542 Ga0207649_10089113
543 Ga0207652_11163732
544 Ga0207681_10008449
545 Ga0207694_10534250
546 Ga0207694_10618375
547 Ga0207650_10007845
548 Ga0207650_10031209
549 Ga0207659_10184629
550 Ga0207659_10278536
551 Ga0207687_11950788
552 Ga0207700_10004794
553 Ga0207644_10124824
554 Ga0207644_10249268
555 Ga0207690_10040907
556 Ga0207690_10156434
557 Ga0207690_10183448
558 Ga0207706_10072949
559 Ga0207706_10118154
560 Ga0207706_10208614
561 Ga0207706_10346793
562 Ga0207709_10152491
563 Ga0207670_10063359
564 Ga0207704_11881488
565 Ga0207665_10465465
566 Ga0207691_10113959
567 Ga0207691_10165658
568 Ga0207689_10003739
569 Ga0207661_10003343
570 Ga0207679_10007887
571 Ga0207679_10204341
572 Ga0207679_10210400
573 Ga0207679_10554991
574 Ga0207679_10673793
575 Ga0207667_11329986
576 Ga0207651_10026255
577 Ga0207712_10117052
578 Ga0207668_11007377
579 Ga0207668_11122040
580 Ga0207658_10185094
581 Ga0207677_10216306
582 Ga0207677_10672618
583 Ga0207703_12359319
584 Ga0207639_10390558
585 Ga0207678_10063067
586 Ga0207708_10024885
587 Ga0207702_10915635
588 Ga0207641_10051618
589 Ga0207641_10133381
590 Ga0207648_10053912
591 Ga0207676_10045903
592 Ga0207676_11007587
593 Ga0207674_10013238
594 Ga0207674_10270452
595 Ga0207675_100147714
596 Ga0207675_100496988
597 Ga0207675_101535352
598 Ga0207683_10088172
599 Ga0207698_10028342
600 Ga0209967_1045343
601 Ga0268266_11553576
602 Ga0268265_10015035
603 Ga0268265_10729105
604 Ga0268265_11675056
605 Ga0268265_11831366
606 Ga0268264_10099769
607 Ga0307408_100091118
608 Ga0307408_100111875
609 Ga0307408_100142795
610 Ga0307409_100029367
611 Ga0307416_100387691
612 Ga0307416_100611982
613 Ga0307411_10500434
614 Ga0307415_100069951
615 Ga0373934_0466060
616 Ga0373944_0360625
617 Ga0373923_0234942
618 Ga0373941_0035077
619 Ga0373956_0116802
620 Ga0373943_0456131
621 Ga0373946_0514703
622 Ga0373955_0061662
623 Ga0373962_0072806
624 Ga0373931_0134846
625 Ga0373947_0016293
626 Ga0373937_0001826
627 Ga0373925_0000535
628 Ga0373925_0860893
629 Ga0373925_0971559
630 Ga0395905_0330368
631 Ga0436365_0379691
632 Ga0439461_0165873
633 Ga0451802_1729298
634 Ga0451807_2487186
635 Ga0451851_0092277
636 Ga0451853_0862048
637 Ga0451853_3494059
638 Ga0439433_0167481
639 Ga0439462_0042860
640 Ga0450898_081793
641 Ga0439446_0025387
642 Ga0451577_0582549
643 Ga0453684_0253860
644 Ga0495638_0022026
645 Ga0495582_0173001
646 Ga0495662_0397781
647 Ga0495608_0280326
648 Ga0495618_0648089
649 Ga0495640_0364342
650 Ga0495586_0590692
651 Ga0495645_0001963
652 Ga0495635_0481670
653 Ga0495599_0606111
654 Ga0495613_0213707
655 Ga0495589_0518661
656 Ga0495604_0804363
657 Ga0495674_0167371
658 Ga0495684_0171989
659 Ga0496104_0209601
660 Ga0496104_1081935
661 Ga0496105_0405655
662 Ga0496106_0673541
663 Ga0496107_0025591
664 Ga0496108_0001541
665 Ga0496109_0002482
666 Ga0496110_0001637
667 Ga0496110_1199802
668 Ga0496111_0146239
669 Ga0496112_0000511
670 Ga0496112_0062688
671 Ga0496113_0043985
672 Ga0496113_0231385
673 Ga0496114_0680195
674 Ga0501031_0700489
675 Ga0501031_0765039
676 Ga0501036_0472562
677 Ga0501037_0175936
678 Ga0501037_0572360
679 Ga0501038_0847930
680 Ga0501041_0714490
681 Ga0501042_1097775
682 Ga0501043_0916035
683 Ga0501067_0515324
684 Ga0501069_0174204
685 Ga0501070_1231982
686 Ga0501071_0090177
687 Ga0501074_0502941
688 Ga0501075_0026547
689 Ga0501076_1039498
690 Ga0501202_033112
691 Ga0501079_0446516
692 Ga0501079_1229252
693 Ga0501081_0609340
694 nmdc:mga03683_290071_c1
695 nmdc:mga00v17_9789_c1
696 nmdc:mga0yw44_251907_c1
697 nmdc:mga0yw44_485441_c1
698 nmdc:mga0yw44_525687_c1
699 nmdc:mga0k408_639976_c1
700 nmdc:mga0k408_702_c1
701 nmdc:mga06z11_15841_c1
702 nmdc:mga06z11_1728_c1
703 nmdc:mga07m45_19036_c1
704 nmdc:mga05p37_161219_c1
705 nmdc:mga09592_176284_c1
706 nmdc:mga06r32_8971_c1
707 nmdc:mga08y16_131969_c1
708 nmdc:mga08y16_140226_c1
709 nmdc:mga08y16_231984_c1
710 nmdc:mga08y16_405617_c1
711 nmdc:mga08y16_9075_c1
712 nmdc:mga0n895_2257_c1
713 nmdc:mga0n895_270067_c1
714 nmdc:mga0n895_474907_c1
715 nmdc:mga0rr50_1805240_c1
716 nmdc:mga0rr50_21259_c1
717 nmdc:mga0rr50_689583_c1
718 nmdc:mga08x19_80769_c2
719 nmdc:mga0a205_33403_c1
720 Ga0495595_0154681
721 Ga0495619_0077231
722 Ga0500628_003459
723 Ga0500628_031385
724 Ga0500628_167750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

34

164

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9562 2 132
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9495 2 132
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9425 1 133
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9358 1 133
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9355 2 132
ID Description Score Start End Superfamily
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9668 1 70 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.935 2 132 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9218 2 132 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9202 1 133 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9182 2 133 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A2V8EKT4-F1-model_v4 EVE domain-containing protein 0.9988 1 132
AF-A0A1F2VKM4-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9979 2 132
AF-A0A832DLA5-F1-model_v4 EVE domain-containing protein 0.9976 1 128
AF-A0A357N7U1-F1-model_v4 EVE domain-containing protein 0.9957 41 132
AF-A0A7S6M4Z7-F1-model_v4 EVE domain-containing protein 0.9952 2 132

Map