F422737

General Info

Members Datasets Scaffolds Average Seq Length
362 219 337 268

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0046706|Ga0495668_0046706_1026_2012
Length 328
Sequence MQPFGHEIVPYGEGAGLTLSGLAHRLTKINEEPAFGCGNEPEETPSPFGNAWTRRSIMSWARIMAPLAGSAADRGLLQSARVLAEAFDAELACVHAPADMADLMPWMGEGFMGGVQVTALESLKEAAVEGHRAVDRLVADLGYGRCRAISLDSPVWAGLAMEGRLSDVIVFDSAAARGKGPLAEAFQQMIADEQRPVVVARPGLKVGGTVMVAWDGGKEASRAMRTSLPLLQKAAQVVVAGAPGASSRSFALERLVEFLAARGVTATAKVLDGTGNDAAALLLGAARDVGADFLVAGAFGHPRLQEFIFGGTTRSLLNNDGPSLFLSH

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221640 Caulobacter sp. Root342 Isolate Unclassified
12 2643221642 Caulobacter sp. Root343 Isolate Unclassified
13 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
14 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
15 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
16 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
17 2818991435 Caulobacter henricii 536 Isolate Unclassified
18 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
19 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
20 2849560528 Caulobacter zeae 410 Isolate Unclassified
21 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
22 2851153111 Caulobacter radicis 736 Isolate Unclassified
23 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
24 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
25 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
202 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
203 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
211 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
212 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.09
Metatranscriptomes 0
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.17
Nodule 0
Rhizoplane 2.76
Rhizosphere 66.02
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10026915 3300002459 Bacteria 1193
2 rootH1_10156770 3300003316 Bacteria 1366
3 rootL2_10016434 3300003322 Bacteria 1751
4 rootL2_10186425 3300003322 Bacteria 2095
5 rootL2_10228638 3300003322 Bacteria 1585
6 Ga0055537_1000562 3300003773 Bacteria 20988
7 Ga0055524_1007120 3300003775 Bacteria 4790
8 Ga0055536_1000971 3300003781 Bacteria 18280
9 Ga0055536_1001157 3300003781 Bacteria 16495
10 Ga0055530_10000405 3300003791 Bacteria 38619
11 Ga0055530_10014218 3300003791 Bacteria 2664
12 Ga0055540_1020954 3300003792 Bacteria 1713
13 Ga0055531_10000224 3300003794 Bacteria 62709
14 Ga0055531_10017988 3300003794 Bacteria 2947
15 Ga0065165_1002473 3300005262 Bacteria 15542
16 Ga0070658_10049740 3300005327 Bacteria 3397
17 Ga0070658_10198171 3300005327 Bacteria 1693
18 Ga0070658_10215185 3300005327 Bacteria 1624
19 Ga0070658_10308555 3300005327 Bacteria 1350
20 Ga0070683_100229968 3300005329 Bacteria 1763
21 Ga0070670_100000128 3300005331 Bacteria 71585
22 Ga0070670_100092753 3300005331 Bacteria 2597
23 Ga0070666_10060179 3300005335 Bacteria 2570
24 Ga0070680_100056301 3300005336 Bacteria 3214
25 Ga0070680_100064204 3300005336 Bacteria 3009
26 Ga0070682_100081869 3300005337 Bacteria 2091
27 Ga0070660_100044217 3300005339 Bacteria 3405
28 Ga0070660_100385106 3300005339 Bacteria 1158
29 Ga0070668_100000195 3300005347 Bacteria 39719
30 Ga0070668_100003161 3300005347 Bacteria 12135
31 Ga0070668_100004647 3300005347 Bacteria 10172
32 Ga0070668_100036004 3300005347 Bacteria 3777
33 Ga0070671_100031377 3300005355 Bacteria 4389
34 Ga0070659_100004122 3300005366 Bacteria 10362
35 Ga0070659_100005078 3300005366 Bacteria 9436
36 Ga0070667_100000169 3300005367 Bacteria 81539
37 Ga0070667_100047472 3300005367 Bacteria 3613
38 Ga0070678_100396795 3300005456 Bacteria 1197
39 Ga0070681_10104000 3300005458 Bacteria 2782
40 Ga0070679_100045656 3300005530 Bacteria 4365
41 Ga0068853_100019157 3300005539 Bacteria 5672
42 Ga0070665_100000176 3300005548 Bacteria 113398
43 Ga0070665_100001054 3300005548 Bacteria 34499
44 Ga0070665_100001083 3300005548 Bacteria 33888
45 Ga0070665_100044661 3300005548 Bacteria 4450
46 Ga0070665_100308764 3300005548 Bacteria 1585
47 Ga0068855_100013022 3300005563 Bacteria 10035
48 Ga0068854_100083216 3300005578 Bacteria 2366
49 Ga0068856_100156361 3300005614 Bacteria 2290
50 Ga0068864_100000561 3300005618 Bacteria 31782
51 Ga0068864_100003418 3300005618 Bacteria 13130
52 Ga0068863_100000101 3300005841 Bacteria 92384
53 Ga0068863_100002206 3300005841 Bacteria 19342
54 Ga0068863_100065088 3300005841 Bacteria 3448
55 Ga0068858_100001173 3300005842 Bacteria 27188
56 Ga0068858_100003917 3300005842 Bacteria 14706
57 Ga0068860_100000211 3300005843 Bacteria 91286
58 Ga0068862_100002104 3300005844 Bacteria 17946
59 Ga0068862_100004288 3300005844 Bacteria 12062
60 Ga0068862_100069547 3300005844 Bacteria 3039
61 Ga0070717_10078474 3300006028 Bacteria 2767
62 Ga0075366_10004644 3300006195 Bacteria 7379
63 Ga0075366_10273936 3300006195 Bacteria 1031
64 Ga0068865_100310508 3300006881 Bacteria 1265
65 Ga0105240_10003059 3300009093 Bacteria 26300
66 Ga0105240_10035366 3300009093 Bacteria 6439
67 Ga0105240_10186453 3300009093 Bacteria 2443
68 Ga0105248_10004855 3300009177 Bacteria 14887
69 Ga0105248_10008404 3300009177 Bacteria 11328
70 Ga0105248_10011646 3300009177 Bacteria 9689
71 Ga0105237_10145343 3300009545 Bacteria 2366
72 Ga0105238_10101189 3300009551 Bacteria 2864
73 Ga0105238_10130284 3300009551 Bacteria 2494
74 Ga0105249_10001588 3300009553 Bacteria 19927
75 Ga0105239_10476032 3300010375 Bacteria 1418
76 Ga0157373_10004968 3300013100 Bacteria 9993
77 Ga0157373_10042339 3300013100 Bacteria 3255
78 Ga0157370_10226242 3300013104 Bacteria 1732
79 Ga0157374_10960605 3300013296 Bacteria 873
80 Ga0163162_10374555 3300013306 Bacteria 1557
81 Ga0157375_10232188 3300013308 Bacteria 2004
82 Ga0163163_10020813 3300014325 Bacteria 6184
83 Ga0163163_10111538 3300014325 Bacteria 2764
84 Ga0163163_10561027 3300014325 Bacteria 1205
85 Ga0157379_10144192 3300014968 Bacteria 2147
86 Ga0213876_10000092 3300021384 Bacteria 100818
87 Ga0209148_1017872 3300025254 Bacteria 1197
88 Ga0209565_1000414 3300025263 Bacteria 35246
89 Ga0209673_1001567 3300025273 Bacteria 20402
90 Ga0209675_1014214 3300025291 Bacteria 2436
91 Ga0209676_1000031 3300025292 Bacteria 478976
92 Ga0209676_1000057 3300025292 Bacteria 361061
93 Ga0209564_1002030 3300025295 Bacteria 17560
94 Ga0209758_1002287 3300025297 Bacteria 19832
95 Ga0209758_1020459 3300025297 Bacteria 3130
96 Ga0209050_1000087 3300025298 Bacteria 261460
97 Ga0209050_1000096 3300025298 Bacteria 240109
98 Ga0209050_1011016 3300025298 Bacteria 4360
99 Ga0209050_1037749 3300025298 Bacteria 1388
100 Ga0209256_1003858 3300025299 Bacteria 9990
101 Ga0209256_1003966 3300025299 Bacteria 9729
102 Ga0209256_1016215 3300025299 Bacteria 2554
103 Ga0209256_1018510 3300025299 Bacteria 2259
104 Ga0209051_1001596 3300025303 Bacteria 18586
105 Ga0209257_1000050 3300025304 Bacteria 439325
106 Ga0209257_1001335 3300025304 Bacteria 29946
107 Ga0209257_1010471 3300025304 Bacteria 4684
108 Ga0207680_10150917 3300025903 Bacteria 1549
109 Ga0207705_10000525 3300025909 Bacteria 32608
110 Ga0207705_10086533 3300025909 Bacteria 2290
111 Ga0207705_10086832 3300025909 Bacteria 2287
112 Ga0207705_10218095 3300025909 Bacteria 1448
113 Ga0207705_10326360 3300025909 Bacteria 1180
114 Ga0207707_10107207 3300025912 Bacteria 2442
115 Ga0207695_10008692 3300025913 Bacteria 12667
116 Ga0207695_10011774 3300025913 Bacteria 10567
117 Ga0207671_10161924 3300025914 Bacteria 1733
118 Ga0207660_10004880 3300025917 Bacteria 8733
119 Ga0207660_10181127 3300025917 Bacteria 1636
120 Ga0207657_10003368 3300025919 Bacteria 17085
121 Ga0207657_10020504 3300025919 Bacteria 6244
122 Ga0207652_10021770 3300025921 Bacteria 5294
123 Ga0207694_10021398 3300025924 Bacteria 4901
124 Ga0207694_10368651 3300025924 Bacteria 1191
125 Ga0207650_10000315 3300025925 Bacteria 47489
126 Ga0207650_10071259 3300025925 Bacteria 2614
127 Ga0207644_10080330 3300025931 Bacteria 2408
128 Ga0207690_10000223 3300025932 Bacteria 42827
129 Ga0207690_10003499 3300025932 Bacteria 9366
130 Ga0207690_10030563 3300025932 Bacteria 3437
131 Ga0207711_10003417 3300025941 Bacteria 13735
132 Ga0207711_10005865 3300025941 Bacteria 10370
133 Ga0207711_10100590 3300025941 Bacteria 2557
134 Ga0207661_10188020 3300025944 Bacteria 1809
135 Ga0207661_10447247 3300025944 Bacteria 1177
136 Ga0207679_10265855 3300025945 Bacteria 1465
137 Ga0207667_10009741 3300025949 Bacteria 11298
138 Ga0207712_10010595 3300025961 Bacteria 5853
139 Ga0207668_10000007 3300025972 Bacteria 190613
140 Ga0207668_10001472 3300025972 Bacteria 13802
141 Ga0207640_10027977 3300025981 Bacteria 3441
142 Ga0207658_10000052 3300025986 Bacteria 128748
143 Ga0207658_10031797 3300025986 Bacteria 3751
144 Ga0207703_10000105 3300026035 Bacteria 99702
145 Ga0207703_10010491 3300026035 Bacteria 7242
146 Ga0207639_10014437 3300026041 Bacteria 5556
147 Ga0207639_10466581 3300026041 Bacteria 1149
148 Ga0207702_10515339 3300026078 Bacteria 1167
149 Ga0207641_10000160 3300026088 Bacteria 95407
150 Ga0207641_10006166 3300026088 Bacteria 10145
151 Ga0207676_10000159 3300026095 Bacteria 59242
152 Ga0207676_10000380 3300026095 Bacteria 37876
153 Ga0207674_10172740 3300026116 Bacteria 2114
154 Ga0207683_10195414 3300026121 Bacteria 1838
155 Ga0268266_10000005 3300028379 Bacteria 1448194
156 Ga0268266_10002189 3300028379 Bacteria 21374
157 Ga0268266_10056945 3300028379 Bacteria 3362
158 Ga0268266_10111835 3300028379 Bacteria 2420
159 Ga0268265_10003935 3300028380 Bacteria 10465
160 Ga0268265_10030008 3300028380 Bacteria 3912
161 Ga0268265_10120518 3300028380 Bacteria 2160
162 Ga0268264_10000270 3300028381 Bacteria 90954
163 Ga0265334_10006729 3300028573 Bacteria 4937
164 Ga0265318_10037977 3300028577 Bacteria 1843
165 Ga0307517_10166466 3300028786 Bacteria 1463
166 Ga0307515_10058050 3300028794 Bacteria 5584
167 Ga0307515_10128770 3300028794 Bacteria 2804
168 Ga0265338_10022804 3300028800 Bacteria 6463
169 Ga0265338_10024361 3300028800 Bacteria 6183
170 Ga0265338_10026178 3300028800 Bacteria 5894
171 Ga0265338_10026523 3300028800 Bacteria 5841
172 Ga0265338_10083442 3300028800 Bacteria 2673
173 Ga0265338_10085940 3300028800 Bacteria 2620
174 Ga0265331_10107209 3300031250 Bacteria 1283
175 Ga0265327_10000337 3300031251 Bacteria 89213
176 Ga0265327_10004676 3300031251 Bacteria 11981
177 Ga0265327_10006753 3300031251 Bacteria 9067
178 Ga0307513_10000082 3300031456 Bacteria 131779
179 Ga0307513_10004685 3300031456 Bacteria 18196
180 Ga0265314_10008170 3300031711 Bacteria 9003
181 Ga0265314_10045477 3300031711 Bacteria 3104
182 Ga0265314_10161642 3300031711 Bacteria 1362
183 Ga0307510_10002252 3300033180 Bacteria 21803
184 Ga0307510_10286165 3300033180 Bacteria 1116
185 Ga0373931_0189436 3300035691 Bacteria 1223
186 Ga0373933_0363371 3300035724 Bacteria 941
187 Ga0373937_0337977 3300036401 Bacteria 1426
188 Ga0373937_0367025 3300036401 Bacteria 1365
189 Ga0395899_0000557 3300037312 Bacteria 40072
190 Ga0395900_0000010 3300037418 Bacteria 461364
191 Ga0395900_0015412 3300037418 Bacteria 7792
192 Ga0395900_0310917 3300037418 Bacteria 1559
193 Ga0395898_0018674 3300037466 Bacteria 7068
194 Ga0395905_0006948 3300037471 Bacteria 11310
195 Ga0395905_0037007 3300037471 Bacteria 4584
196 Ga0395905_0147265 3300037471 Bacteria 2215
197 Ga0436364_0068382 3300037853 Bacteria 2305
198 Ga0436364_1010539 3300037853 Bacteria 1335
199 Ga0395901_0000007 3300038443 Bacteria 497408
200 Ga0395901_0040010 3300038443 Bacteria 4853
201 Ga0436365_0711553 3300039437 Bacteria 97884
202 Ga0436365_0988854 3300039437 Bacteria 4957
203 Ga0436365_1288496 3300039437 Bacteria 5067
204 Ga0436365_1473860 3300039437 Bacteria 2725
205 Ga0436361_0500574 3300039447 Bacteria 9550
206 Ga0436363_0149506 3300039450 Bacteria 2325
207 Ga0439465_0053654 3300041413 Bacteria 1325
208 Ga0439446_0006467 3300042156 Bacteria 3056
209 Ga0495638_0000351 3300046460 Bacteria 57664
210 Ga0495638_0001296 3300046460 Bacteria 23258
211 Ga0495638_0002503 3300046460 Bacteria 14964
212 Ga0495638_0003803 3300046460 Bacteria 11723
213 Ga0495638_0039238 3300046460 Bacteria 3006
214 Ga0495650_0000007 3300046471 Bacteria 718072
215 Ga0495650_0025100 3300046471 Bacteria 2801
216 Ga0495650_0129720 3300046471 Bacteria 920
217 Ga0495583_0000024 3300046506 Bacteria 274122
218 Ga0495606_0008563 3300046507 Bacteria 8852
219 Ga0495606_0092564 3300046507 Bacteria 1856
220 Ga0495610_0000029 3300046512 Bacteria 271137
221 Ga0495610_0010088 3300046512 Bacteria 5898
222 Ga0495610_0015770 3300046512 Bacteria 4377
223 Ga0495616_0000174 3300046513 Bacteria 54942
224 Ga0495620_0038008 3300046515 Bacteria 2139
225 Ga0495628_0104971 3300046516 Bacteria 2177
226 Ga0495631_0006175 3300046518 Bacteria 6209
227 Ga0495631_0071424 3300046518 Bacteria 1500
228 Ga0495632_0012294 3300046519 Bacteria 4940
229 Ga0495632_0115518 3300046519 Bacteria 1257
230 Ga0495632_0180066 3300046519 Bacteria 968
231 Ga0495637_0013757 3300046520 Bacteria 3835
232 Ga0495637_0022565 3300046520 Bacteria 2869
233 Ga0495637_0048314 3300046520 Bacteria 1793
234 Ga0495644_0081378 3300046523 Bacteria 1221
235 Ga0495648_0005500 3300046524 Bacteria 10507
236 Ga0495648_0101293 3300046524 Bacteria 1589
237 Ga0495648_0138288 3300046524 Bacteria 1285
238 Ga0495642_0047893 3300046528 Bacteria 1752
239 Ga0495654_0000116 3300046530 Bacteria 90109
240 Ga0495597_0014651 3300046542 Bacteria 3730
241 Ga0495597_0017381 3300046542 Bacteria 3386
242 Ga0495645_0129428 3300046543 Bacteria 1770
243 Ga0495668_0000019 3300046616 Bacteria 416042
244 Ga0495668_0015293 3300046616 Bacteria 4485
245 Ga0495668_0028351 3300046616 Bacteria 3166
246 Ga0495668_0034575 3300046616 Bacteria 2834
247 Ga0495668_0046706 3300046616 Bacteria 2405
248 Ga0495611_0006946 3300046648 Bacteria 4809
249 Ga0495611_0222085 3300046648 Bacteria 879
250 Ga0495625_0000051 3300046660 Bacteria 193325
251 Ga0495625_0006547 3300046660 Bacteria 10345
252 Ga0495625_0013474 3300046660 Bacteria 6568
253 Ga0495625_0082257 3300046660 Bacteria 2239
254 Ga0495625_0186540 3300046660 Bacteria 1376
255 Ga0495625_0268963 3300046660 Bacteria 1100
256 Ga0495669_0000003 3300046684 Bacteria 267741
257 Ga0495669_0023009 3300046684 Bacteria 2709
258 Ga0495669_0036782 3300046684 Bacteria 2165
259 Ga0495613_0000877 3300046689 Bacteria 23120
260 Ga0495670_0179106 3300046691 Bacteria 1119
261 Ga0495671_0164234 3300046692 Bacteria 1080
262 Ga0495589_0014765 3300046794 Bacteria 4019
263 Ga0495660_0006350 3300046810 Bacteria 7003
264 Ga0495660_0086972 3300046810 Bacteria 1631
265 Ga0495674_0108033 3300047319 Bacteria 2361
266 Ga0495672_0005855 3300047320 Bacteria 9642
267 Ga0495683_0040802 3300047323 Bacteria 2344
268 Ga0495677_0015236 3300047445 Bacteria 2794
269 Ga0495685_045599 3300047447 Bacteria 1493
270 Ga0495673_0000082 3300047469 Bacteria 199141
271 Ga0495673_0000123 3300047469 Bacteria 144484
272 Ga0495681_0068251 3300047470 Bacteria 1618
273 Ga0495686_0006301 3300047472 Bacteria 9117
274 Ga0495686_0011451 3300047472 Bacteria 6247
275 Ga0495686_0013415 3300047472 Bacteria 5684
276 Ga0495686_0074415 3300047472 Bacteria 2084
277 Ga0496101_0049620 3300048904 Bacteria 3020
278 Ga0496102_0023819 3300048905 Bacteria 5440
279 Ga0496103_0151965 3300048906 Bacteria 1483
280 Ga0496106_0019483 3300048909 Bacteria 5033
281 Ga0496106_0109995 3300048909 Bacteria 2144
282 Ga0496107_0000089 3300048910 Bacteria 43926
283 Ga0496107_0071425 3300048910 Bacteria 2522
284 Ga0496112_0025331 3300048915 Bacteria 5697
285 Ga0496115_0002412 3300048918 Bacteria 13419
286 Ga0496115_0020431 3300048918 Bacteria 5109
287 Ga0496121_0011733 3300048924 Bacteria 9669
288 Ga0496124_0057826 3300048927 Bacteria 3265
289 Ga0496125_0032220 3300048928 Bacteria 4659
290 Ga0496126_0005452 3300048929 Bacteria 14510
291 Ga0495678_002925 3300049459 Bacteria 10933
292 Ga0501032_0067343 3300049569 Bacteria 2392
293 Ga0501032_0265888 3300049569 Bacteria 1112
294 Ga0501043_0192886 3300049579 Bacteria 1584
295 Ga0501047_0117683 3300049581 Bacteria 2539
296 Ga0501048_0108347 3300049582 Bacteria 1961
297 Ga0501257_001918 3300049686 Bacteria 4330
298 nmdc:mga0k408_219078_c1 3300050493 Bacteria 1136
299 nmdc:mga0k408_58819_c1 3300050493 Bacteria 2232
300 Ga0500635_0000080 3300053080 Bacteria 63214
301 Ga0500578_0001330 3300053086 Bacteria 25351
302 Ga0500578_0145050 3300053086 Bacteria 1482
303 Ga0500643_018221 3300053087 Bacteria 2334
304 Ga0500643_027605 3300053087 Bacteria 1763
305 Ga0500644_0000817 3300053088 Bacteria 10508
306 Ga0500651_0043669 3300053093 Bacteria 2823
307 Ga0500566_0025410 3300053094 Bacteria 3473
308 Ga0500556_0004885 3300053104 Bacteria 3795
309 Ga0500562_001492 3300053108 Bacteria 5771
310 Ga0500569_003741 3300053109 Bacteria 3141
311 Ga0500572_001306 3300053111 Bacteria 6956
312 Ga0500594_0000343 3300053118 Bacteria 10448
313 Ga0500595_071007 3300053119 Bacteria 1033
314 Ga0500608_001307 3300053122 Bacteria 8876
315 Ga0500608_195888 3300053122 Bacteria 840
316 Ga0500618_000305 3300053125 Bacteria 36613
317 Ga0500658_0010384 3300053134 Bacteria 3433
318 Ga0500658_0042268 3300053134 Bacteria 1831
319 Ga0500559_0000002 3300053136 Bacteria 262002
320 Ga0500559_0000008 3300053136 Bacteria 182182
321 Ga0500559_0005600 3300053136 Bacteria 5762
322 Ga0500559_0008913 3300053136 Bacteria 4367
323 Ga0500559_0009234 3300053136 Bacteria 4279
324 Ga0500564_008131 3300053138 Bacteria 4489
325 Ga0500577_0019072 3300053142 Bacteria 2217
326 Ga0500590_086804 3300053148 Bacteria 1525
327 Ga0500616_0146077 3300053153 Bacteria 1100
328 Ga0500622_0000474 3300053156 Bacteria 37843
329 Ga0500622_0003517 3300053156 Bacteria 10389
330 Ga0500622_0014049 3300053156 Bacteria 4304
331 Ga0500622_0016554 3300053156 Bacteria 3939
332 Ga0500638_003811 3300053162 Bacteria 5677
333 Ga0500636_0008561 3300053177 Bacteria 5931
334 Ga0500636_0188954 3300053177 Bacteria 1099
335 Ga0500637_0002594 3300053178 Bacteria 8079
336 Ga0500645_016533 3300053730 Bacteria 2322
337 Ga0500609_000232 3300053731 Bacteria 8044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046648 Ga0495611_0222085 Ga0495611_0222085_195_869 224
2 3300046471 Ga0495650_0129720 Ga0495650_0129720_14_700 228
3 3300048904 Ga0496101_0049620 Ga0496101_0049620_2300_2986 228
4 3300053153 Ga0500616_0146077 Ga0500616_0146077_30_719 228
5 3300047319 Ga0495674_0108033 Ga0495674_0108033_408_1121 237
6 3300046660 Ga0495625_0186540 Ga0495625_0186540_44_784 246
7 3300025924 Ga0207694_10368651 Ga0207694_103686512 248
8 3300037418 Ga0395900_0310917 Ga0395900_0310917_248_1042 249
9 3300035691 Ga0373931_0189436 Ga0373931_0189436_189_983 250
10 3300036401 Ga0373937_0337977 Ga0373937_0337977_311_1105 251
11 3300046460 Ga0495638_0003803 Ga0495638_0003803_3834_4589 251
12 3300046471 Ga0495650_0025100 Ga0495650_0025100_1678_2433 251
13 3300046512 Ga0495610_0015770 Ga0495610_0015770_40_795 251
14 3300046516 Ga0495628_0104971 Ga0495628_0104971_103_897 251
15 3300046518 Ga0495631_0006175 Ga0495631_0006175_3671_4426 251
16 3300046520 Ga0495637_0022565 Ga0495637_0022565_470_1225 251
17 3300046543 Ga0495645_0129428 Ga0495645_0129428_197_991 251
18 3300046692 Ga0495671_0164234 Ga0495671_0164234_294_1049 251
19 3300047472 Ga0495686_0011451 Ga0495686_0011451_1708_2463 251
20 3300049459 Ga0495678_002925 Ga0495678_002925_3448_4203 251
21 3300053086 Ga0500578_0001330 Ga0500578_0001330_20858_21613 251
22 3300053108 Ga0500562_001492 Ga0500562_001492_1618_2373 251
23 3300053118 Ga0500594_0000343 Ga0500594_0000343_6081_6836 251
24 3300053156 Ga0500622_0000474 Ga0500622_0000474_24957_25712 251
25 3300048915 Ga0496112_0025331 Ga0496112_0025331_2274_3068 254
26 3300013296 Ga0157374_10960605 Ga0157374_109606051 255
27 3300025917 Ga0207660_10181127 Ga0207660_101811272 256
28 3300026041 Ga0207639_10466581 Ga0207639_104665812 256
29 3300049579 Ga0501043_0192886 Ga0501043_0192886_485_1279 257
30 3300013104 Ga0157370_10226242 Ga0157370_102262422 260
31 3300046542 Ga0495597_0017381 Ga0495597_0017381_810_1622 260
32 3300053093 Ga0500651_0043669 Ga0500651_0043669_541_1353 260
33 3300053094 Ga0500566_0025410 Ga0500566_0025410_1463_2275 260
34 3300053109 Ga0500569_003741 Ga0500569_003741_1304_2116 260
35 3300053134 Ga0500658_0042268 Ga0500658_0042268_369_1181 260
36 3300053136 Ga0500559_0009234 Ga0500559_0009234_1593_2405 260
37 3300053148 Ga0500590_086804 Ga0500590_086804_173_985 260
38 3300028577 Ga0265318_10037977 Ga0265318_100379772 262
39 3300031250 Ga0265331_10107209 Ga0265331_101072091 262
40 3300031711 Ga0265314_10045477 Ga0265314_100454771 262
41 3300005456 Ga0070678_100396795 Ga0070678_1003967952 264
42 3300009093 Ga0105240_10186453 Ga0105240_101864532 264
43 3300009177 Ga0105248_10004855 Ga0105248_1000485514 264
44 3300013100 Ga0157373_10004968 Ga0157373_100049684 264
45 3300013100 Ga0157373_10042339 Ga0157373_100423394 264
46 3300013308 Ga0157375_10232188 Ga0157375_102321882 264
47 3300014325 Ga0163163_10561027 Ga0163163_105610271 264
48 3300026121 Ga0207683_10195414 Ga0207683_101954142 264
49 3300036401 Ga0373937_0367025 Ga0373937_0367025_546_1340 264
50 3300037312 Ga0395899_0000557 Ga0395899_0000557_29291_30085 264
51 3300037418 Ga0395900_0000010 Ga0395900_0000010_172062_172856 264
52 3300037418 Ga0395900_0015412 Ga0395900_0015412_2730_3524 264
53 3300037466 Ga0395898_0018674 Ga0395898_0018674_302_1096 264
54 3300037471 Ga0395905_0006948 Ga0395905_0006948_4544_5338 264
55 3300037471 Ga0395905_0037007 Ga0395905_0037007_2005_2799 264
56 3300037853 Ga0436364_0068382 Ga0436364_0068382_88_885 264
57 3300038443 Ga0395901_0000007 Ga0395901_0000007_256424_257218 264
58 3300038443 Ga0395901_0040010 Ga0395901_0040010_913_1707 264
59 3300039437 Ga0436365_0988854 Ga0436365_0988854_2440_3234 264
60 3300039437 Ga0436365_1288496 Ga0436365_1288496_3328_4122 264
61 3300041413 Ga0439465_0053654 Ga0439465_0053654_503_1297 264
62 3300042156 Ga0439446_0006467 Ga0439446_0006467_484_1278 264
63 3300046460 Ga0495638_0000351 Ga0495638_0000351_26477_27271 264
64 3300046460 Ga0495638_0002503 Ga0495638_0002503_3303_4100 264
65 3300046460 Ga0495638_0039238 Ga0495638_0039238_1723_2517 264
66 3300046471 Ga0495650_0000007 Ga0495650_0000007_460312_461109 264
67 3300046506 Ga0495583_0000024 Ga0495583_0000024_99363_100160 264
68 3300046507 Ga0495606_0008563 Ga0495606_0008563_6835_7632 264
69 3300046507 Ga0495606_0092564 Ga0495606_0092564_379_1173 264
70 3300046512 Ga0495610_0010088 Ga0495610_0010088_2114_2908 264
71 3300046513 Ga0495616_0000174 Ga0495616_0000174_23239_24036 264
72 3300046515 Ga0495620_0038008 Ga0495620_0038008_1196_1993 264
73 3300046518 Ga0495631_0071424 Ga0495631_0071424_611_1408 264
74 3300046519 Ga0495632_0012294 Ga0495632_0012294_3986_4783 264
75 3300046519 Ga0495632_0115518 Ga0495632_0115518_220_1017 264
76 3300046519 Ga0495632_0180066 Ga0495632_0180066_51_848 264
77 3300046520 Ga0495637_0013757 Ga0495637_0013757_1468_2265 264
78 3300046520 Ga0495637_0048314 Ga0495637_0048314_653_1447 264
79 3300046524 Ga0495648_0005500 Ga0495648_0005500_3022_3816 264
80 3300046524 Ga0495648_0101293 Ga0495648_0101293_460_1254 264
81 3300046524 Ga0495648_0138288 Ga0495648_0138288_449_1246 264
82 3300046528 Ga0495642_0047893 Ga0495642_0047893_191_985 264
83 3300046530 Ga0495654_0000116 Ga0495654_0000116_54048_54845 264
84 3300046616 Ga0495668_0000019 Ga0495668_0000019_102022_102816 264
85 3300046616 Ga0495668_0034575 Ga0495668_0034575_267_1061 264
86 3300046660 Ga0495625_0000051 Ga0495625_0000051_9949_10743 264
87 3300046660 Ga0495625_0006547 Ga0495625_0006547_9147_9944 264
88 3300046660 Ga0495625_0082257 Ga0495625_0082257_412_1206 264
89 3300046660 Ga0495625_0268963 Ga0495625_0268963_186_983 264
90 3300046684 Ga0495669_0000003 Ga0495669_0000003_266366_267160 264
91 3300046689 Ga0495613_0000877 Ga0495613_0000877_1594_2388 264
92 3300046691 Ga0495670_0179106 Ga0495670_0179106_13_810 264
93 3300046794 Ga0495589_0014765 Ga0495589_0014765_1805_2599 264
94 3300046810 Ga0495660_0006350 Ga0495660_0006350_2827_3624 264
95 3300046810 Ga0495660_0086972 Ga0495660_0086972_239_1225 264
96 3300047323 Ga0495683_0040802 Ga0495683_0040802_112_909 264
97 3300047445 Ga0495677_0015236 Ga0495677_0015236_624_1418 264
98 3300047469 Ga0495673_0000082 Ga0495673_0000082_90099_90893 264
99 3300047469 Ga0495673_0000123 Ga0495673_0000123_3462_4256 264
100 3300047470 Ga0495681_0068251 Ga0495681_0068251_304_1101 264
101 3300047472 Ga0495686_0006301 Ga0495686_0006301_6281_7075 264
102 3300047472 Ga0495686_0013415 Ga0495686_0013415_2365_3162 264
103 3300047472 Ga0495686_0074415 Ga0495686_0074415_1073_1867 264
104 3300048909 Ga0496106_0019483 Ga0496106_0019483_3348_4142 264
105 3300048910 Ga0496107_0000089 Ga0496107_0000089_34306_35100 264
106 3300048918 Ga0496115_0020431 Ga0496115_0020431_2762_3559 264
107 3300048924 Ga0496121_0011733 Ga0496121_0011733_3500_4294 264
108 3300048928 Ga0496125_0032220 Ga0496125_0032220_2107_2901 264
109 3300049569 Ga0501032_0067343 Ga0501032_0067343_961_1755 264
110 3300049569 Ga0501032_0265888 Ga0501032_0265888_83_877 264
111 3300049581 Ga0501047_0117683 Ga0501047_0117683_791_1585 264
112 3300049582 Ga0501048_0108347 Ga0501048_0108347_452_1246 264
113 3300049686 Ga0501257_001918 Ga0501257_001918_2906_3700 264
114 3300050493 nmdc:mga0k408_219078_c1 nmdc:mga0k408_219078_c1_232_1026 264
115 3300053086 Ga0500578_0145050 Ga0500578_0145050_27_824 264
116 3300053087 Ga0500643_018221 Ga0500643_018221_104_898 264
117 3300053087 Ga0500643_027605 Ga0500643_027605_294_1088 264
118 3300053088 Ga0500644_0000817 Ga0500644_0000817_3459_4253 264
119 3300053104 Ga0500556_0004885 Ga0500556_0004885_452_1249 264
120 3300053119 Ga0500595_071007 Ga0500595_071007_77_871 264
121 3300053122 Ga0500608_001307 Ga0500608_001307_6324_7118 264
122 3300053122 Ga0500608_195888 Ga0500608_195888_11_805 264
123 3300053125 Ga0500618_000305 Ga0500618_000305_7724_8521 264
124 3300053136 Ga0500559_0000002 Ga0500559_0000002_12773_13567 264
125 3300053136 Ga0500559_0000008 Ga0500559_0000008_173285_174082 264
126 3300053136 Ga0500559_0005600 Ga0500559_0005600_3179_3973 264
127 3300053136 Ga0500559_0008913 Ga0500559_0008913_1997_2791 264
128 3300053138 Ga0500564_008131 Ga0500564_008131_1802_2596 264
129 3300053142 Ga0500577_0019072 Ga0500577_0019072_164_958 264
130 3300053156 Ga0500622_0003517 Ga0500622_0003517_5466_6260 264
131 3300053156 Ga0500622_0014049 Ga0500622_0014049_1061_1855 264
132 3300053730 Ga0500645_016533 Ga0500645_016533_1118_1915 264
133 3300053731 Ga0500609_000232 Ga0500609_000232_6704_7501 264
134 iso_pu_bacteria 2643221584 2643930058 265
135 iso_pu_bacteria 2582581279 2585150208 266
136 iso_pu_bacteria 2582581280 2585153244 266
137 iso_pu_bacteria 2582581293 2585196933 266
138 iso_pu_bacteria 2585428106 2587916366 266
139 iso_pu_bacteria 2643221545 2643748823 266
140 iso_pu_bacteria 2643221552 2643778977 266
141 iso_pu_bacteria 2643221583 2643923391 266
142 iso_pu_bacteria 2643221598 2644001986 266
143 iso_pu_bacteria 2643221614 2644085367 266
144 iso_pu_bacteria 2643221640 2644226125 266
145 iso_pu_bacteria 2643221642 2644235613 266
146 iso_pu_bacteria 2643221661 2644342919 266
147 iso_pu_bacteria 2643221666 2644366219 266
148 iso_pu_bacteria 2643221691 2644509577 266
149 iso_pu_bacteria 2791355048 2792463657 266
150 iso_pu_bacteria 2818991435 2819539274 266
151 iso_pu_bacteria 2818991454 2819648211 266
152 iso_pu_bacteria 2843744320 2843748450 266
153 iso_pu_bacteria 2849560528 2849562355 266
154 iso_pu_bacteria 2849573788 2849574594 266
155 iso_pu_bacteria 2851153111 2851155036 266
156 iso_pu_bacteria 2857504554 2857509051 266
157 iso_pu_bacteria 2884960567 2884964891 266
158 iso_pu_bacteria 2898329390 2898330065 266
159 3300031456 Ga0307513_10000082 Ga0307513_1000008218 269
160 3300002459 JGI24751J29686_10026915 JGI24751J29686_100269151 270
161 3300003316 rootH1_10156770 rootH1_101567702 270
162 3300003322 rootL2_10016434 rootL2_100164342 270
163 3300003322 rootL2_10186425 rootL2_101864252 270
164 3300003322 rootL2_10228638 rootL2_102286381 270
165 3300003773 Ga0055537_1000562 Ga0055537_10005625 270
166 3300003775 Ga0055524_1007120 Ga0055524_10071201 270
167 3300003781 Ga0055536_1000971 Ga0055536_100097115 270
168 3300003781 Ga0055536_1001157 Ga0055536_100115713 270
169 3300003791 Ga0055530_10000405 Ga0055530_100004058 270
170 3300003791 Ga0055530_10014218 Ga0055530_100142182 270
171 3300003792 Ga0055540_1020954 Ga0055540_10209543 270
172 3300003794 Ga0055531_10000224 Ga0055531_1000022411 270
173 3300003794 Ga0055531_10017988 Ga0055531_100179883 270
174 3300005262 Ga0065165_1002473 Ga0065165_10024736 270
175 3300005327 Ga0070658_10049740 Ga0070658_100497401 270
176 3300005327 Ga0070658_10198171 Ga0070658_101981712 270
177 3300005327 Ga0070658_10215185 Ga0070658_102151852 270
178 3300005327 Ga0070658_10308555 Ga0070658_103085552 270
179 3300005329 Ga0070683_100229968 Ga0070683_1002299681 270
180 3300005331 Ga0070670_100000128 Ga0070670_10000012836 270
181 3300005331 Ga0070670_100092753 Ga0070670_1000927533 270
182 3300005335 Ga0070666_10060179 Ga0070666_100601792 270
183 3300005336 Ga0070680_100056301 Ga0070680_1000563014 270
184 3300005336 Ga0070680_100064204 Ga0070680_1000642043 270
185 3300005337 Ga0070682_100081869 Ga0070682_1000818691 270
186 3300005339 Ga0070660_100044217 Ga0070660_1000442172 270
187 3300005339 Ga0070660_100385106 Ga0070660_1003851062 270
188 3300005347 Ga0070668_100000195 Ga0070668_10000019532 270
189 3300005347 Ga0070668_100003161 Ga0070668_10000316113 270
190 3300005347 Ga0070668_100004647 Ga0070668_1000046479 270
191 3300005347 Ga0070668_100036004 Ga0070668_1000360044 270
192 3300005355 Ga0070671_100031377 Ga0070671_1000313774 270
193 3300005366 Ga0070659_100004122 Ga0070659_10000412211 270
194 3300005366 Ga0070659_100005078 Ga0070659_1000050788 270
195 3300005367 Ga0070667_100000169 Ga0070667_10000016975 270
196 3300005367 Ga0070667_100047472 Ga0070667_1000474724 270
197 3300005458 Ga0070681_10104000 Ga0070681_101040002 270
198 3300005530 Ga0070679_100045656 Ga0070679_1000456564 270
199 3300005539 Ga0068853_100019157 Ga0068853_1000191578 270
200 3300005548 Ga0070665_100000176 Ga0070665_100000176106 270
201 3300005548 Ga0070665_100001054 Ga0070665_10000105416 270
202 3300005548 Ga0070665_100001083 Ga0070665_1000010839 270
203 3300005548 Ga0070665_100044661 Ga0070665_1000446613 270
204 3300005548 Ga0070665_100308764 Ga0070665_1003087642 270
205 3300005563 Ga0068855_100013022 Ga0068855_10001302213 270
206 3300005578 Ga0068854_100083216 Ga0068854_1000832163 270
207 3300005614 Ga0068856_100156361 Ga0068856_1001563611 270
208 3300005618 Ga0068864_100000561 Ga0068864_1000005612 270
209 3300005618 Ga0068864_100003418 Ga0068864_1000034182 270
210 3300005841 Ga0068863_100000101 Ga0068863_10000010113 270
211 3300005841 Ga0068863_100002206 Ga0068863_10000220618 270
212 3300005841 Ga0068863_100065088 Ga0068863_1000650881 270
213 3300005842 Ga0068858_100001173 Ga0068858_10000117311 270
214 3300005842 Ga0068858_100003917 Ga0068858_1000039179 270
215 3300005843 Ga0068860_100000211 Ga0068860_10000021178 270
216 3300005844 Ga0068862_100002104 Ga0068862_10000210412 270
217 3300005844 Ga0068862_100004288 Ga0068862_1000042885 270
218 3300005844 Ga0068862_100069547 Ga0068862_1000695472 270
219 3300006028 Ga0070717_10078474 Ga0070717_100784741 270
220 3300006195 Ga0075366_10004644 Ga0075366_100046443 270
221 3300006195 Ga0075366_10273936 Ga0075366_102739361 270
222 3300006881 Ga0068865_100310508 Ga0068865_1003105082 270
223 3300009093 Ga0105240_10003059 Ga0105240_1000305924 270
224 3300009093 Ga0105240_10035366 Ga0105240_100353664 270
225 3300009177 Ga0105248_10008404 Ga0105248_100084043 270
226 3300009177 Ga0105248_10011646 Ga0105248_1001164610 270
227 3300009545 Ga0105237_10145343 Ga0105237_101453432 270
228 3300009551 Ga0105238_10101189 Ga0105238_101011893 270
229 3300009551 Ga0105238_10130284 Ga0105238_101302843 270
230 3300009553 Ga0105249_10001588 Ga0105249_1000158811 270
231 3300010375 Ga0105239_10476032 Ga0105239_104760322 270
232 3300013306 Ga0163162_10374555 Ga0163162_103745552 270
233 3300014325 Ga0163163_10020813 Ga0163163_100208135 270
234 3300014325 Ga0163163_10111538 Ga0163163_101115381 270
235 3300014968 Ga0157379_10144192 Ga0157379_101441922 270
236 3300021384 Ga0213876_10000092 Ga0213876_1000009286 270
237 3300025254 Ga0209148_1017872 Ga0209148_10178721 270
238 3300025263 Ga0209565_1000414 Ga0209565_100041413 270
239 3300025273 Ga0209673_1001567 Ga0209673_10015678 270
240 3300025291 Ga0209675_1014214 Ga0209675_10142143 270
241 3300025292 Ga0209676_1000031 Ga0209676_1000031261 270
242 3300025292 Ga0209676_1000057 Ga0209676_1000057114 270
243 3300025295 Ga0209564_1002030 Ga0209564_10020308 270
244 3300025297 Ga0209758_1002287 Ga0209758_100228714 270
245 3300025297 Ga0209758_1020459 Ga0209758_10204591 270
246 3300025298 Ga0209050_1000087 Ga0209050_100008711 270
247 3300025298 Ga0209050_1000096 Ga0209050_100009611 270
248 3300025298 Ga0209050_1011016 Ga0209050_10110161 270
249 3300025298 Ga0209050_1037749 Ga0209050_10377491 270
250 3300025299 Ga0209256_1003858 Ga0209256_10038583 270
251 3300025299 Ga0209256_1003966 Ga0209256_100396612 270
252 3300025299 Ga0209256_1016215 Ga0209256_10162152 270
253 3300025299 Ga0209256_1018510 Ga0209256_10185103 270
254 3300025303 Ga0209051_1001596 Ga0209051_100159617 270
255 3300025304 Ga0209257_1000050 Ga0209257_1000050169 270
256 3300025304 Ga0209257_1001335 Ga0209257_100133514 270
257 3300025304 Ga0209257_1010471 Ga0209257_10104716 270
258 3300025903 Ga0207680_10150917 Ga0207680_101509173 270
259 3300025909 Ga0207705_10000525 Ga0207705_100005258 270
260 3300025909 Ga0207705_10086533 Ga0207705_100865333 270
261 3300025909 Ga0207705_10086832 Ga0207705_100868322 270
262 3300025909 Ga0207705_10218095 Ga0207705_102180951 270
263 3300025909 Ga0207705_10326360 Ga0207705_103263601 270
264 3300025912 Ga0207707_10107207 Ga0207707_101072072 270
265 3300025913 Ga0207695_10008692 Ga0207695_100086925 270
266 3300025913 Ga0207695_10011774 Ga0207695_100117745 270
267 3300025914 Ga0207671_10161924 Ga0207671_101619242 270
268 3300025917 Ga0207660_10004880 Ga0207660_100048804 270
269 3300025919 Ga0207657_10003368 Ga0207657_100033689 270
270 3300025919 Ga0207657_10020504 Ga0207657_100205042 270
271 3300025921 Ga0207652_10021770 Ga0207652_100217704 270
272 3300025924 Ga0207694_10021398 Ga0207694_100213983 270
273 3300025925 Ga0207650_10000315 Ga0207650_1000031511 270
274 3300025925 Ga0207650_10071259 Ga0207650_100712593 270
275 3300025931 Ga0207644_10080330 Ga0207644_100803303 270
276 3300025932 Ga0207690_10000223 Ga0207690_1000022334 270
277 3300025932 Ga0207690_10003499 Ga0207690_100034996 270
278 3300025932 Ga0207690_10030563 Ga0207690_100305632 270
279 3300025941 Ga0207711_10003417 Ga0207711_1000341713 270
280 3300025941 Ga0207711_10005865 Ga0207711_100058653 270
281 3300025941 Ga0207711_10100590 Ga0207711_101005904 270
282 3300025944 Ga0207661_10188020 Ga0207661_101880203 270
283 3300025944 Ga0207661_10447247 Ga0207661_104472472 270
284 3300025945 Ga0207679_10265855 Ga0207679_102658551 270
285 3300025949 Ga0207667_10009741 Ga0207667_100097413 270
286 3300025961 Ga0207712_10010595 Ga0207712_100105957 270
287 3300025972 Ga0207668_10000007 Ga0207668_10000007184 270
288 3300025972 Ga0207668_10001472 Ga0207668_1000147211 270
289 3300025981 Ga0207640_10027977 Ga0207640_100279773 270
290 3300025986 Ga0207658_10000052 Ga0207658_10000052116 270
291 3300025986 Ga0207658_10031797 Ga0207658_100317973 270
292 3300026035 Ga0207703_10000105 Ga0207703_1000010530 270
293 3300026035 Ga0207703_10010491 Ga0207703_100104919 270
294 3300026041 Ga0207639_10014437 Ga0207639_100144372 270
295 3300026078 Ga0207702_10515339 Ga0207702_105153392 270
296 3300026088 Ga0207641_10000160 Ga0207641_1000016015 270
297 3300026088 Ga0207641_10006166 Ga0207641_100061665 270
298 3300026095 Ga0207676_10000159 Ga0207676_1000015923 270
299 3300026095 Ga0207676_10000380 Ga0207676_1000038020 270
300 3300026116 Ga0207674_10172740 Ga0207674_101727402 270
301 3300028379 Ga0268266_10000005 Ga0268266_100000051308 270
302 3300028379 Ga0268266_10002189 Ga0268266_100021896 270
303 3300028379 Ga0268266_10056945 Ga0268266_100569453 270
304 3300028379 Ga0268266_10111835 Ga0268266_101118353 270
305 3300028380 Ga0268265_10003935 Ga0268265_100039353 270
306 3300028380 Ga0268265_10030008 Ga0268265_100300085 270
307 3300028380 Ga0268265_10120518 Ga0268265_101205183 270
308 3300028381 Ga0268264_10000270 Ga0268264_1000027015 270
309 3300028573 Ga0265334_10006729 Ga0265334_100067292 270
310 3300028786 Ga0307517_10166466 Ga0307517_101664662 270
311 3300028794 Ga0307515_10058050 Ga0307515_100580505 270
312 3300028794 Ga0307515_10128770 Ga0307515_101287702 270
313 3300028800 Ga0265338_10022804 Ga0265338_100228044 270
314 3300028800 Ga0265338_10024361 Ga0265338_100243613 270
315 3300028800 Ga0265338_10026178 Ga0265338_100261785 270
316 3300028800 Ga0265338_10026523 Ga0265338_100265234 270
317 3300028800 Ga0265338_10083442 Ga0265338_100834423 270
318 3300028800 Ga0265338_10085940 Ga0265338_100859403 270
319 3300031251 Ga0265327_10000337 Ga0265327_1000033745 270
320 3300031251 Ga0265327_10004676 Ga0265327_100046762 270
321 3300031251 Ga0265327_10006753 Ga0265327_1000675310 270
322 3300031456 Ga0307513_10004685 Ga0307513_1000468514 270
323 3300031711 Ga0265314_10008170 Ga0265314_100081705 270
324 3300031711 Ga0265314_10161642 Ga0265314_101616421 270
325 3300033180 Ga0307510_10002252 Ga0307510_1000225218 270
326 3300033180 Ga0307510_10286165 Ga0307510_102861651 270
327 3300035724 Ga0373933_0363371 Ga0373933_0363371_73_900 270
328 3300037471 Ga0395905_0147265 Ga0395905_0147265_1169_1981 270
329 3300037853 Ga0436364_1010539 Ga0436364_1010539_255_1067 270
330 3300039437 Ga0436365_0711553 Ga0436365_0711553_74585_75397 270
331 3300039437 Ga0436365_1473860 Ga0436365_1473860_164_994 270
332 3300039447 Ga0436361_0500574 Ga0436361_0500574_5109_5921 270
333 3300039450 Ga0436363_0149506 Ga0436363_0149506_469_1281 270
334 3300046460 Ga0495638_0001296 Ga0495638_0001296_1622_2437 270
335 3300046512 Ga0495610_0000029 Ga0495610_0000029_168363_169334 270
336 3300046523 Ga0495644_0081378 Ga0495644_0081378_216_1028 270
337 3300046542 Ga0495597_0014651 Ga0495597_0014651_26_901 270
338 3300046616 Ga0495668_0015293 Ga0495668_0015293_2246_3121 270
339 3300046616 Ga0495668_0028351 Ga0495668_0028351_180_992 270
340 3300046616 Ga0495668_0046706 Ga0495668_0046706_1026_2012 270
341 3300046648 Ga0495611_0006946 Ga0495611_0006946_81_893 270
342 3300046660 Ga0495625_0013474 Ga0495625_0013474_5362_6240 270
343 3300046684 Ga0495669_0023009 Ga0495669_0023009_903_1715 270
344 3300046684 Ga0495669_0036782 Ga0495669_0036782_277_1089 270
345 3300047320 Ga0495672_0005855 Ga0495672_0005855_8807_9622 270
346 3300047447 Ga0495685_045599 Ga0495685_045599_368_1180 270
347 3300048905 Ga0496102_0023819 Ga0496102_0023819_3222_4052 270
348 3300048906 Ga0496103_0151965 Ga0496103_0151965_38_868 270
349 3300048909 Ga0496106_0109995 Ga0496106_0109995_22_834 270
350 3300048910 Ga0496107_0071425 Ga0496107_0071425_1123_1950 270
351 3300048918 Ga0496115_0002412 Ga0496115_0002412_3638_4450 270
352 3300048927 Ga0496124_0057826 Ga0496124_0057826_1993_2868 270
353 3300048929 Ga0496126_0005452 Ga0496126_0005452_8560_9435 270
354 3300050493 nmdc:mga0k408_58819_c1 nmdc:mga0k408_58819_c1_676_1662 270
355 3300053080 Ga0500635_0000080 Ga0500635_0000080_58715_59527 270
356 3300053111 Ga0500572_001306 Ga0500572_001306_5830_6657 270
357 3300053134 Ga0500658_0010384 Ga0500658_0010384_664_1635 270
358 3300053156 Ga0500622_0016554 Ga0500622_0016554_358_1233 270
359 3300053162 Ga0500638_003811 Ga0500638_003811_180_992 270
360 3300053177 Ga0500636_0008561 Ga0500636_0008561_452_1264 270
361 3300053177 Ga0500636_0188954 Ga0500636_0188954_125_952 270
362 3300053178 Ga0500637_0002594 Ga0500637_0002594_878_1690 270

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hgm-assembly2.cif.gz_D universal stress protein tead from the trap transporter teaabc of halomonas elongata 0.767 151 266
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.7669 145 236
3s3t-assembly1.cif.gz_A universal stress protein uspa from lactobacillus plantarum 0.7637 146 270
2z09-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.7438 151 270
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.7353 5 270
ID Description Score Start End Superfamily
af_A0A1D6LZ57_4_167_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8082 150 269 3.40.50.620
af_Q57997_1_162_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7919 149 269 3.40.50.620
3loqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7866 153 236 3.40.50.620
af_Q94E74_9_167_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7853 148 266 3.40.50.620
af_Q2FXL6_6_143_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.785 153 270 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T9JHE6-F1-model_v4 Universal stress protein UspA 0.9653 1 270
AF-E8RTC7-F1-model_v4 UspA domain-containing protein 0.9424 3 270
AF-A0A1D2TW84-F1-model_v4 UspA domain-containing protein 0.935 1 186
AF-A0A1D2TW84-F1-model_v4 UspA domain-containing protein 0.9302 1 186
AF-E8RTC7-F1-model_v4 UspA domain-containing protein 0.9289 3 270

Feature Viewer

pLDDT pTM Quality
90.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map