F422703

General Info

Members Datasets Scaffolds Average Seq Length
362 221 362 108

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0727002|Ga0466960_0727002_36_416
Length 126
Sequence LRAAPGFWSNRRSDPIKEVGMSVIMTLHIQGDPAALESHADSDPDGIRAIADRAKEHGVIAHRFYGSDDGQIMVIDEWPDPESFQAFFSEQQESIEPMMRAVGATGEPKVTFWRKLETHDEIGWES

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 4.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 9.12
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10027642 3300003203 Bacteria 2172
2 rootL2_10164680 3300003322 Bacteria 1447
3 Ga0070658_11301956 3300005327 Bacteria 631
4 Ga0070683_100000682 3300005329 Bacteria 24589
5 Ga0070683_100905491 3300005329 Bacteria 846
6 Ga0070683_101019690 3300005329 Bacteria 795
7 Ga0070683_101711127 3300005329 Unclassified 605
8 Ga0070680_100125157 3300005336 Bacteria 2148
9 Ga0070682_101206124 3300005337 Bacteria 639
10 Ga0068868_100012019 3300005338 Bacteria 6320
11 Ga0070660_100449751 3300005339 Bacteria 1069
12 Ga0070660_100644103 3300005339 Bacteria 887
13 Ga0070687_100010280 3300005343 Bacteria 4041
14 Ga0070674_100051904 3300005356 Bacteria 2827
15 Ga0070674_100278775 3300005356 Bacteria 1324
16 Ga0070673_100329336 3300005364 Bacteria 1351
17 Ga0070673_101663039 3300005364 Unclassified 604
18 Ga0070701_10022942 3300005438 Bacteria 2999
19 Ga0070705_101801164 3300005440 Unclassified 519
20 Ga0070678_100009329 3300005456 Bacteria 5938
21 Ga0070678_100327534 3300005456 Bacteria 1310
22 Ga0070662_101184971 3300005457 Bacteria 656
23 Ga0070681_10032323 3300005458 Bacteria 5251
24 Ga0070685_10133815 3300005466 Bacteria 1553
25 Ga0070679_100053070 3300005530 Bacteria 4036
26 Ga0070684_100629711 3300005535 Bacteria 998
27 Ga0070684_101000522 3300005535 Bacteria 785
28 Ga0070697_101421913 3300005536 Unclassified 619
29 Ga0068853_100435044 3300005539 Bacteria 1232
30 Ga0070686_100253662 3300005544 Bacteria 1286
31 Ga0070686_100582045 3300005544 Bacteria 880
32 Ga0070696_100300150 3300005546 Bacteria 1230
33 Ga0070696_101653930 3300005546 Bacteria 551
34 Ga0070665_101116013 3300005548 Unclassified 800
35 Ga0068854_101126412 3300005578 Bacteria 700
36 Ga0068856_100186977 3300005614 Bacteria 2085
37 Ga0070702_100097078 3300005615 Bacteria 1800
38 Ga0070702_101350677 3300005615 Bacteria 581
39 Ga0068852_100292238 3300005616 Bacteria 1575
40 Ga0068859_100044981 3300005617 Bacteria 4436
41 Ga0068864_100147376 3300005618 Bacteria 2129
42 Ga0068866_10156702 3300005718 Bacteria 1324
43 Ga0068863_100684789 3300005841 Unclassified 1018
44 Ga0068858_101020430 3300005842 Bacteria 811
45 Ga0068860_100491762 3300005843 Bacteria 1224
46 Ga0081539_10001486 3300005985 Bacteria 39689
47 Ga0070717_10197023 3300006028 Bacteria 1762
48 Ga0075365_11104661 3300006038 Unclassified 558
49 Ga0070716_100039736 3300006173 Bacteria 2613
50 Ga0070716_100358529 3300006173 Bacteria 1035
51 Ga0070712_100356506 3300006175 Bacteria 1198
52 Ga0068871_101351491 3300006358 Unclassified 671
53 Ga0075433_11956161 3300006852 Unclassified 502
54 Ga0068865_100220582 3300006881 Bacteria 1482
55 Ga0097620_100044981 3300006931 Bacteria 4436
56 Ga0105251_10485481 3300009011 Bacteria 576
57 Ga0105240_10245422 3300009093 Bacteria 2074
58 Ga0111539_10825088 3300009094 Bacteria 1079
59 Ga0105245_10003765 3300009098 Bacteria 13499
60 Ga0105245_10021096 3300009098 Bacteria 5714
61 Ga0105247_10594992 3300009101 Bacteria 819
62 Ga0114129_11438651 3300009147 Bacteria 849
63 Ga0105243_10779493 3300009148 Bacteria 940
64 Ga0105242_10440497 3300009176 Bacteria 1226
65 Ga0105248_10207955 3300009177 Bacteria 2205
66 Ga0105248_11327262 3300009177 Bacteria 814
67 Ga0105237_11072736 3300009545 Bacteria 812
68 Ga0105238_11443749 3300009551 Bacteria 716
69 Ga0105249_10161688 3300009553 Bacteria 2164
70 Ga0105249_10333417 3300009553 Bacteria 1531
71 Ga0105249_11458773 3300009553 Bacteria 756
72 Ga0105239_10437633 3300010375 Bacteria 1482
73 Ga0105246_10104317 3300011119 Bacteria 2070
74 Ga0157371_11461800 3300013102 Bacteria 532
75 Ga0157369_10375895 3300013105 Bacteria 1475
76 Ga0163162_10096421 3300013306 Bacteria 3046
77 Ga0163162_12359053 3300013306 Unclassified 611
78 Ga0163163_10437093 3300014325 Bacteria 1368
79 Ga0182008_10008954 3300014497 Bacteria 5425
80 Ga0157379_10225981 3300014968 Unclassified 1696
81 Ga0157376_10952690 3300014969 Bacteria 879
82 Ga0182006_1078327 3300015261 Bacteria 1210
83 Ga0163161_10980156 3300017792 Bacteria 721
84 Ga0197907_10445946 3300020069 Bacteria 505
85 Ga0197907_10462820 3300020069 Unclassified 944
86 Ga0206356_10168183 3300020070 Bacteria 770
87 Ga0206356_10695787 3300020070 Bacteria 748
88 Ga0206356_11090347 3300020070 Unclassified 616
89 Ga0206349_1796683 3300020075 Bacteria 602
90 Ga0206352_10468200 3300020078 Bacteria 755
91 Ga0206354_10135559 3300020081 Unclassified 1268
92 Ga0206354_10302353 3300020081 Bacteria 680
93 Ga0206353_10290262 3300020082 Bacteria 1874
94 Ga0206353_10601394 3300020082 Bacteria 3270
95 Ga0213871_10000619 3300021441 Bacteria 5059
96 Ga0224712_10282581 3300022467 Bacteria 773
97 Ga0224712_10385117 3300022467 Bacteria 667
98 Ga0207692_10716867 3300025898 Bacteria 650
99 Ga0207642_10247175 3300025899 Bacteria 1010
100 Ga0207710_10337549 3300025900 Bacteria 766
101 Ga0207707_10022195 3300025912 Bacteria 5548
102 Ga0207695_10235125 3300025913 Bacteria 1735
103 Ga0207693_10012593 3300025915 Bacteria 6833
104 Ga0207660_10140085 3300025917 Bacteria 1849
105 Ga0207662_10026538 3300025918 Bacteria 3341
106 Ga0207662_10126091 3300025918 Bacteria 1610
107 Ga0207657_10486727 3300025919 Unclassified 967
108 Ga0207687_10254378 3300025927 Bacteria 1398
109 Ga0207687_10473676 3300025927 Bacteria 1042
110 Ga0207664_11011549 3300025929 Bacteria 745
111 Ga0207686_10823806 3300025934 Bacteria 745
112 Ga0207669_10110998 3300025937 Bacteria 1838
113 Ga0207704_10136004 3300025938 Bacteria 1711
114 Ga0207665_10158063 3300025939 Bacteria 1628
115 Ga0207665_10886010 3300025939 Bacteria 707
116 Ga0207665_11187102 3300025939 Bacteria 609
117 Ga0207711_10696577 3300025941 Bacteria 947
118 Ga0207711_11905768 3300025941 Bacteria 537
119 Ga0207661_10007486 3300025944 Bacteria 7767
120 Ga0207661_11486005 3300025944 Bacteria 621
121 Ga0207667_12143451 3300025949 Unclassified 517
122 Ga0207651_10607244 3300025960 Unclassified 957
123 Ga0207640_10104992 3300025981 Bacteria 1990
124 Ga0207703_10504065 3300026035 Bacteria 1136
125 Ga0207678_10104405 3300026067 Bacteria 2418
126 Ga0207678_10613058 3300026067 Bacteria 955
127 Ga0207702_10001437 3300026078 Bacteria 23675
128 Ga0207641_11015896 3300026088 Unclassified 826
129 Ga0207648_10511170 3300026089 Bacteria 1100
130 Ga0207674_12092115 3300026116 Bacteria 530
131 Ga0207683_10008796 3300026121 Bacteria 8618
132 Ga0207698_11252648 3300026142 Unclassified 756
133 Ga0268266_11314528 3300028379 Unclassified 698
134 Ga0268266_12152704 3300028379 Bacteria 530
135 Ga0265334_10034101 3300028573 Bacteria 2021
136 Ga0307517_10204863 3300028786 Unclassified 1226
137 Ga0265338_10012119 3300028800 Bacteria 9850
138 Ga0265338_10013370 3300028800 Bacteria 9272
139 Ga0307512_10350437 3300030522 Bacteria 651
140 Ga0265313_10007306 3300031595 Bacteria 7585
141 Ga0307508_10482767 3300031616 Bacteria 833
142 Ga0373926_0050199 3300035083 Bacteria 1503
143 Ga0373934_0376174 3300035086 Unclassified 592
144 Ga0373940_0009156 3300035088 Bacteria 2295
145 Ga0373941_0172765 3300035115 Bacteria 806
146 Ga0373945_0001901 3300035116 Bacteria 6482
147 Ga0373943_0001176 3300035170 Bacteria 11678
148 Ga0373946_0018238 3300035171 Unclassified 2692
149 Ga0373942_0020422 3300035207 Bacteria 1663
150 Ga0373935_0011249 3300035692 Bacteria 5374
151 Ga0373927_0049647 3300035695 Bacteria 2713
152 Ga0373947_0003657 3300035725 Bacteria 9070
153 Ga0373925_0001856 3300037068 Bacteria 17583
154 Ga0395899_0280788 3300037312 Bacteria 1133
155 Ga0395898_0259385 3300037466 Bacteria 1658
156 Ga0436364_0263178 3300037853 Unclassified 878
157 Ga0436364_0536907 3300037853 Unclassified 723
158 Ga0436364_0643394 3300037853 Unclassified 1075
159 Ga0395901_0499838 3300038443 Bacteria 1238
160 Ga0436360_0447378 3300039438 Unclassified 632
161 Ga0436360_0996833 3300039438 Bacteria 7037
162 Ga0436363_0419069 3300039450 Bacteria 629
163 Ga0436363_1455464 3300039450 Bacteria 1092
164 Ga0436362_0030590 3300039453 Archaea 763
165 Ga0436362_0385092 3300039453 Bacteria 1080
166 Ga0451793_0453200 3300041452 Bacteria 757
167 Ga0451835_0200805 3300041492 Bacteria 574
168 Ga0451839_1068516 3300041496 Bacteria 2551
169 Ga0451855_1621600 3300041511 Bacteria 1038
170 Ga0451853_2213660 3300041512 Bacteria 905
171 Ga0466965_0017351 3300044683 Bacteria 3440
172 Ga0466965_0078791 3300044683 Bacteria 1664
173 Ga0466966_0063419 3300044684 Unclassified 2328
174 Ga0466966_0076502 3300044684 Bacteria 2090
175 Ga0466966_0646280 3300044684 Bacteria 637
176 Ga0466966_0770663 3300044684 Unclassified 580
177 Ga0466961_0058350 3300044693 Bacteria 2456
178 Ga0466963_0001407 3300044694 Bacteria 12920
179 Ga0466963_0004226 3300044694 Bacteria 8329
180 Ga0466963_0004485 3300044694 Bacteria 8124
181 Ga0466963_0091208 3300044694 Bacteria 2075
182 Ga0466963_0091460 3300044694 Bacteria 2072
183 Ga0466963_0781081 3300044694 Bacteria 674
184 Ga0466963_0841082 3300044694 Bacteria 647
185 Ga0466963_0865573 3300044694 Unclassified 637
186 Ga0466963_0899933 3300044694 Bacteria 624
187 Ga0466964_0007719 3300044706 Bacteria 4027
188 Ga0466964_0089643 3300044706 Bacteria 1336
189 Ga0466964_0145848 3300044706 Unclassified 1092
190 Ga0466964_0176369 3300044706 Bacteria 1010
191 Ga0466971_0116407 3300044719 Bacteria 1236
192 Ga0466968_0041968 3300044735 Bacteria 1933
193 Ga0466968_0209037 3300044735 Unclassified 916
194 Ga0466968_0223550 3300044735 Unclassified 887
195 Ga0466968_0483828 3300044735 Unclassified 615
196 Ga0466970_0323612 3300044765 Unclassified 872
197 Ga0466957_0003457 3300044842 Bacteria 8668
198 Ga0466957_0085358 3300044842 Bacteria 1972
199 Ga0466957_0117823 3300044842 Bacteria 1691
200 Ga0466957_0581023 3300044842 Bacteria 783
201 Ga0466957_0826012 3300044842 Unclassified 659
202 Ga0466960_0049100 3300044901 Bacteria 2030
203 Ga0466960_0117607 3300044901 Unclassified 1389
204 Ga0466960_0167455 3300044901 Bacteria 1184
205 Ga0466960_0727002 3300044901 Bacteria 597
206 Ga0466960_0789784 3300044901 Bacteria 574
207 Ga0466959_0005567 3300045049 Bacteria 8652
208 Ga0466959_0006828 3300045049 Bacteria 7955
209 Ga0466959_0135009 3300045049 Bacteria 1747
210 Ga0466959_0273847 3300045049 Bacteria 1160
211 Ga0466959_0404858 3300045049 Bacteria 927
212 Ga0466959_0881318 3300045049 Bacteria 597
213 Ga0466958_0001842 3300045836 Bacteria 10326
214 Ga0466958_0327379 3300045836 Bacteria 985
215 Ga0466958_0334934 3300045836 Bacteria 973
216 Ga0466958_0601533 3300045836 Bacteria 715
217 Ga0466958_0759628 3300045836 Bacteria 632
218 Ga0466967_0001517 3300045976 Bacteria 13570
219 Ga0466967_0003084 3300045976 Bacteria 10711
220 Ga0466967_0003131 3300045976 Bacteria 10652
221 Ga0466967_0003853 3300045976 Bacteria 9935
222 Ga0466967_0014706 3300045976 Bacteria 6110
223 Ga0466967_0024536 3300045976 Bacteria 4960
224 Ga0466967_0028570 3300045976 Bacteria 4657
225 Ga0466967_0030117 3300045976 Bacteria 4551
226 Ga0466967_0045407 3300045976 Bacteria 3817
227 Ga0466967_0053376 3300045976 Bacteria 3552
228 Ga0466967_0211586 3300045976 Bacteria 1839
229 Ga0466967_0334576 3300045976 Bacteria 1463
230 Ga0466967_0340383 3300045976 Bacteria 1450
231 Ga0466967_0353773 3300045976 Unclassified 1422
232 Ga0466967_0465381 3300045976 Bacteria 1237
233 Ga0466967_0495018 3300045976 Bacteria 1199
234 Ga0466967_0684574 3300045976 Bacteria 1015
235 Ga0466967_0767136 3300045976 Bacteria 957
236 Ga0466967_0775125 3300045976 Bacteria 952
237 Ga0466967_0863807 3300045976 Bacteria 899
238 Ga0495592_0283153 3300046454 Unclassified 1084
239 Ga0495592_0580988 3300046454 Bacteria 685
240 Ga0495603_0507335 3300046455 Bacteria 691
241 Ga0495629_0023439 3300046459 Bacteria 4398
242 Ga0495629_0027799 3300046459 Bacteria 4017
243 Ga0495641_0005429 3300046461 Bacteria 8622
244 Ga0495641_0361058 3300046461 Unclassified 657
245 Ga0495651_0896300 3300046462 Bacteria 543
246 Ga0495653_0004479 3300046463 Bacteria 11279
247 Ga0495653_0378867 3300046463 Bacteria 904
248 Ga0495653_0490898 3300046463 Unclassified 767
249 Ga0495580_0018049 3300046472 Bacteria 5260
250 Ga0495582_0002155 3300046473 Bacteria 11012
251 Ga0495605_0396917 3300046474 Unclassified 574
252 Ga0495639_0001136 3300046475 Bacteria 12009
253 Ga0495662_0000631 3300046476 Bacteria 16407
254 Ga0495662_0279721 3300046476 Bacteria 821
255 Ga0495664_0002923 3300046477 Bacteria 9220
256 Ga0495584_0320577 3300046491 Unclassified 787
257 Ga0495594_0078535 3300046499 Bacteria 1842
258 Ga0495607_0259997 3300046501 Unclassified 832
259 Ga0495608_0697038 3300046511 Unclassified 604
260 Ga0495608_0864492 3300046511 Unclassified 531
261 Ga0495618_0017744 3300046514 Bacteria 4367
262 Ga0495618_0085467 3300046514 Bacteria 2016
263 Ga0495618_0702550 3300046514 Unclassified 594
264 Ga0495628_0281082 3300046516 Bacteria 1236
265 Ga0495630_0002781 3300046517 Bacteria 12142
266 Ga0495630_0222347 3300046517 Bacteria 1441
267 Ga0495630_1109809 3300046517 Archaea 599
268 Ga0495630_1206259 3300046517 Archaea 572
269 Ga0495666_0000169 3300046526 Bacteria 27666
270 Ga0495652_0082914 3300046529 Bacteria 2641
271 Ga0495652_0655591 3300046529 Unclassified 710
272 Ga0495652_0673113 3300046529 Bacteria 699
273 Ga0495665_0000431 3300046531 Bacteria 21350
274 Ga0495640_0007017 3300046533 Bacteria 8866
275 Ga0495640_0101966 3300046533 Bacteria 1883
276 Ga0495586_0028087 3300046535 Bacteria 3010
277 Ga0495586_0219404 3300046535 Bacteria 1080
278 Ga0495586_0347174 3300046535 Unclassified 852
279 Ga0495587_0669645 3300046536 Unclassified 570
280 Ga0495645_0082256 3300046543 Bacteria 2309
281 Ga0495667_0133612 3300046559 Bacteria 1600
282 Ga0495667_0887439 3300046559 Unclassified 547
283 Ga0495634_0023159 3300046642 Bacteria 4367
284 Ga0495634_0081514 3300046642 Bacteria 2116
285 Ga0495634_0149386 3300046642 Bacteria 1478
286 Ga0495635_0017915 3300046663 Bacteria 4946
287 Ga0495635_0066585 3300046663 Bacteria 2470
288 Ga0495588_0380908 3300046674 Bacteria 741
289 Ga0495599_0724050 3300046678 Unclassified 572
290 Ga0495623_0638663 3300046679 Unclassified 550
291 Ga0495646_0058181 3300046680 Bacteria 2311
292 Ga0495647_0000214 3300046681 Bacteria 15610
293 Ga0495658_0000272 3300046683 Bacteria 29389
294 Ga0495613_0003786 3300046689 Bacteria 11339
295 Ga0495613_0017484 3300046689 Bacteria 5340
296 Ga0495613_0630942 3300046689 Bacteria 711
297 Ga0495624_0000454 3300046690 Bacteria 32267
298 Ga0495600_0078945 3300046809 Bacteria 2149
299 Ga0495600_0110311 3300046809 Bacteria 1791
300 Ga0495581_0002824 3300047315 Bacteria 9927
301 Ga0495674_0083263 3300047319 Bacteria 2742
302 Ga0495674_0106750 3300047319 Bacteria 2377
303 Ga0495676_0005938 3300047321 Bacteria 11207
304 Ga0495676_0884461 3300047321 Unclassified 573
305 Ga0495680_0032884 3300047322 Bacteria 4205
306 Ga0495684_0010417 3300047471 Bacteria 7189
307 Ga0495684_0285799 3300047471 Bacteria 1188
308 Ga0495593_0000504 3300047673 Bacteria 22038
309 Ga0495602_0661526 3300048088 Unclassified 712
310 Ga0495614_0001712 3300048089 Bacteria 9581
311 Ga0496100_0104080 3300048903 Unclassified 1961
312 Ga0496101_0228276 3300048904 Bacteria 1446
313 Ga0496102_0079753 3300048905 Bacteria 3015
314 Ga0496102_0128072 3300048905 Bacteria 2374
315 Ga0496102_1560120 3300048905 Unclassified 579
316 Ga0496103_0048396 3300048906 Unclassified 2627
317 Ga0496104_0097250 3300048907 Bacteria 2817
318 Ga0496104_0597854 3300048907 Bacteria 1013
319 Ga0496105_1093022 3300048908 Bacteria 592
320 Ga0496105_1261756 3300048908 Bacteria 541
321 Ga0496106_0146065 3300048909 Bacteria 1863
322 Ga0496107_0020627 3300048910 Bacteria 4656
323 Ga0496107_1277466 3300048910 Unclassified 526
324 Ga0496108_0048857 3300048911 Bacteria 3538
325 Ga0496108_0074860 3300048911 Bacteria 2860
326 Ga0496108_0434676 3300048911 Bacteria 1146
327 Ga0496109_0019810 3300048912 Bacteria 5935
328 Ga0496109_1236144 3300048912 Unclassified 683
329 Ga0496109_1412246 3300048912 Bacteria 631
330 Ga0496109_1935356 3300048912 Bacteria 522
331 Ga0496110_0254193 3300048913 Bacteria 1599
332 Ga0496110_0482404 3300048913 Bacteria 1129
333 Ga0496110_1559960 3300048913 Bacteria 570
334 Ga0496111_0035200 3300048914 Bacteria 3577
335 Ga0496111_0153340 3300048914 Bacteria 1709
336 Ga0496111_0952625 3300048914 Unclassified 616
337 Ga0496112_0163986 3300048915 Bacteria 2188
338 Ga0496112_0530769 3300048915 Bacteria 1111
339 Ga0496113_0563310 3300048916 Bacteria 913
340 Ga0496114_0072422 3300048917 Bacteria 2898
341 Ga0496115_0011057 3300048918 Bacteria 6762
342 Ga0496115_0606934 3300048918 Bacteria 869
343 Ga0501040_0902416 3300049576 Bacteria 640
344 Ga0501067_0008614 3300049583 Bacteria 5654
345 Ga0501067_0062647 3300049583 Unclassified 2059
346 Ga0501069_0062279 3300049585 Unclassified 2083
347 Ga0501070_1305117 3300049586 Unclassified 554
348 Ga0495601_0005652 3300053077 Bacteria 7293
349 Ga0495601_0075785 3300053077 Bacteria 2153
350 Ga0495601_0088079 3300053077 Bacteria 1996
351 Ga0495612_0003206 3300053078 Bacteria 6781
352 Ga0495595_0280233 3300053084 Bacteria 837
353 Ga0495619_0006440 3300053085 Bacteria 7434
354 Ga0500566_0049870 3300053094 Bacteria 2398
355 Ga0587082_138247 3300059504 Unclassified 566
356 Ga0587115_070335 3300059626 Unclassified 603
357 Ga0466962_0049137 3300061719 Bacteria 2016
358 Ga0466962_0148622 3300061719 Bacteria 1136
359 Ga0466962_0284642 3300061719 Unclassified 816
360 Ga0466962_0295443 3300061719 Bacteria 801
361 Ga0530510_0224803 3300061734 Bacteria 1396
362 Ga0530510_0391410 3300061734 Bacteria 1047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0361058 Ga0495641_0361058_240_581 94
2 3300028786 Ga0307517_10204863 Ga0307517_102048632 96
3 3300044694 Ga0466963_0091208 Ga0466963_0091208_889_1188 99
4 3300044706 Ga0466964_0145848 Ga0466964_0145848_179_478 99
5 3300045976 Ga0466967_0001517 Ga0466967_0001517_720_1019 99
6 3300045976 Ga0466967_0014706 Ga0466967_0014706_5182_5481 99
7 3300045976 Ga0466967_0353773 Ga0466967_0353773_312_611 99
8 3300045976 Ga0466967_0684574 Ga0466967_0684574_245_544 99
9 3300003322 rootL2_10164680 rootL2_101646802 100
10 3300005548 Ga0070665_101116013 Ga0070665_1011160132 100
11 3300005841 Ga0068863_100684789 Ga0068863_1006847892 100
12 3300006038 Ga0075365_11104661 Ga0075365_111046611 100
13 3300009176 Ga0105242_10440497 Ga0105242_104404972 100
14 3300025939 Ga0207665_11187102 Ga0207665_111871021 100
15 3300026088 Ga0207641_11015896 Ga0207641_110158962 100
16 3300028379 Ga0268266_11314528 Ga0268266_113145281 100
17 3300030522 Ga0307512_10350437 Ga0307512_103504372 100
18 3300031616 Ga0307508_10482767 Ga0307508_104827671 100
19 3300035088 Ga0373940_0009156 Ga0373940_0009156_911_1213 100
20 3300035115 Ga0373941_0172765 Ga0373941_0172765_453_755 100
21 3300035207 Ga0373942_0020422 Ga0373942_0020422_548_850 100
22 3300049576 Ga0501040_0902416 Ga0501040_0902416_78_416 100
23 3300046463 Ga0495653_0490898 Ga0495653_0490898_99_404 101
24 3300047321 Ga0495676_0884461 Ga0495676_0884461_13_318 101
25 3300048912 Ga0496109_1236144 Ga0496109_1236144_190_495 101
26 3300048913 Ga0496110_0482404 Ga0496110_0482404_412_717 101
27 3300048914 Ga0496111_0153340 Ga0496111_0153340_738_1043 101
28 3300025934 Ga0207686_10823806 Ga0207686_108238063 102
29 3300041452 Ga0451793_0453200 Ga0451793_0453200_22_330 102
30 3300041492 Ga0451835_0200805 Ga0451835_0200805_35_343 102
31 3300041496 Ga0451839_1068516 Ga0451839_1068516_1805_2113 102
32 3300041511 Ga0451855_1621600 Ga0451855_1621600_188_496 102
33 3300041512 Ga0451853_2213660 Ga0451853_2213660_451_759 102
34 3300044694 Ga0466963_0091460 Ga0466963_0091460_1448_1759 102
35 3300045976 Ga0466967_0030117 Ga0466967_0030117_3319_3630 102
36 3300048913 Ga0496110_1559960 Ga0496110_1559960_10_318 102
37 3300049583 Ga0501067_0008614 Ga0501067_0008614_624_932 102
38 3300005329 Ga0070683_100000682 Ga0070683_10000068229 103
39 3300005336 Ga0070680_100125157 Ga0070680_1001251572 103
40 3300005339 Ga0070660_100449751 Ga0070660_1004497512 103
41 3300005458 Ga0070681_10032323 Ga0070681_100323232 103
42 3300005530 Ga0070679_100053070 Ga0070679_1000530706 103
43 3300005535 Ga0070684_100629711 Ga0070684_1006297111 103
44 3300013105 Ga0157369_10375895 Ga0157369_103758952 103
45 3300020070 Ga0206356_10695787 Ga0206356_106957871 103
46 3300020081 Ga0206354_10135559 Ga0206354_101355595 103
47 3300020082 Ga0206353_10601394 Ga0206353_106013945 103
48 3300022467 Ga0224712_10385117 Ga0224712_103851171 103
49 3300025912 Ga0207707_10022195 Ga0207707_100221958 103
50 3300025917 Ga0207660_10140085 Ga0207660_101400852 103
51 3300025919 Ga0207657_10486727 Ga0207657_104867274 103
52 3300025944 Ga0207661_10007486 Ga0207661_100074863 103
53 3300025981 Ga0207640_10104992 Ga0207640_101049921 103
54 3300026116 Ga0207674_12092115 Ga0207674_120921152 103
55 3300044684 Ga0466966_0063419 Ga0466966_0063419_1051_1362 103
56 3300044694 Ga0466963_0001407 Ga0466963_0001407_5100_5411 103
57 3300044706 Ga0466964_0089643 Ga0466964_0089643_869_1180 103
58 3300044719 Ga0466971_0116407 Ga0466971_0116407_27_338 103
59 3300044735 Ga0466968_0041968 Ga0466968_0041968_1248_1604 103
60 3300044842 Ga0466957_0117823 Ga0466957_0117823_1354_1665 103
61 3300045049 Ga0466959_0006828 Ga0466959_0006828_2575_2886 103
62 3300045976 Ga0466967_0003084 Ga0466967_0003084_4935_5246 103
63 3300045976 Ga0466967_0465381 Ga0466967_0465381_740_1051 103
64 3300045976 Ga0466967_0767136 Ga0466967_0767136_430_741 103
65 3300046517 Ga0495630_1109809 Ga0495630_1109809_264_575 103
66 3300046535 Ga0495586_0347174 Ga0495586_0347174_67_378 103
67 3300061719 Ga0466962_0295443 Ga0466962_0295443_107_418 103
68 3300005457 Ga0070662_101184971 Ga0070662_1011849711 104
69 3300005615 Ga0070702_101350677 Ga0070702_1013506772 104
70 3300006852 Ga0075433_11956161 Ga0075433_119561611 104
71 3300009147 Ga0114129_11438651 Ga0114129_114386511 104
72 3300021441 Ga0213871_10000619 Ga0213871_100006196 104
73 3300035086 Ga0373934_0376174 Ga0373934_0376174_196_510 104
74 3300039438 Ga0436360_0996833 Ga0436360_0996833_2799_3113 104
75 3300045976 Ga0466967_0211586 Ga0466967_0211586_630_944 104
76 3300046474 Ga0495605_0396917 Ga0495605_0396917_80_394 104
77 3300046491 Ga0495584_0320577 Ga0495584_0320577_400_714 104
78 3300046501 Ga0495607_0259997 Ga0495607_0259997_332_646 104
79 3300046529 Ga0495652_0673113 Ga0495652_0673113_196_510 104
80 3300005329 Ga0070683_101019690 Ga0070683_1010196901 105
81 3300005337 Ga0070682_101206124 Ga0070682_1012061242 105
82 3300005338 Ga0068868_100012019 Ga0068868_1000120191 105
83 3300005339 Ga0070660_100644103 Ga0070660_1006441031 105
84 3300005343 Ga0070687_100010280 Ga0070687_1000102806 105
85 3300005356 Ga0070674_100051904 Ga0070674_1000519044 105
86 3300005356 Ga0070674_100278775 Ga0070674_1002787752 105
87 3300005364 Ga0070673_100329336 Ga0070673_1003293361 105
88 3300005364 Ga0070673_101663039 Ga0070673_1016630391 105
89 3300005438 Ga0070701_10022942 Ga0070701_100229422 105
90 3300005440 Ga0070705_101801164 Ga0070705_1018011641 105
91 3300005456 Ga0070678_100009329 Ga0070678_1000093293 105
92 3300005456 Ga0070678_100327534 Ga0070678_1003275342 105
93 3300005466 Ga0070685_10133815 Ga0070685_101338154 105
94 3300005536 Ga0070697_101421913 Ga0070697_1014219131 105
95 3300005539 Ga0068853_100435044 Ga0068853_1004350442 105
96 3300005544 Ga0070686_100253662 Ga0070686_1002536621 105
97 3300005544 Ga0070686_100582045 Ga0070686_1005820452 105
98 3300005546 Ga0070696_100300150 Ga0070696_1003001502 105
99 3300005578 Ga0068854_101126412 Ga0068854_1011264121 105
100 3300005614 Ga0068856_100186977 Ga0068856_1001869773 105
101 3300005615 Ga0070702_100097078 Ga0070702_1000970783 105
102 3300005616 Ga0068852_100292238 Ga0068852_1002922382 105
103 3300005617 Ga0068859_100044981 Ga0068859_1000449817 105
104 3300005618 Ga0068864_100147376 Ga0068864_1001473764 105
105 3300005718 Ga0068866_10156702 Ga0068866_101567021 105
106 3300005842 Ga0068858_101020430 Ga0068858_1010204301 105
107 3300005843 Ga0068860_100491762 Ga0068860_1004917621 105
108 3300006173 Ga0070716_100039736 Ga0070716_1000397362 105
109 3300006173 Ga0070716_100358529 Ga0070716_1003585292 105
110 3300006175 Ga0070712_100356506 Ga0070712_1003565063 105
111 3300006358 Ga0068871_101351491 Ga0068871_1013514911 105
112 3300006881 Ga0068865_100220582 Ga0068865_1002205822 105
113 3300006931 Ga0097620_100044981 Ga0097620_1000449812 105
114 3300009011 Ga0105251_10485481 Ga0105251_104854812 105
115 3300009094 Ga0111539_10825088 Ga0111539_108250882 105
116 3300009098 Ga0105245_10003765 Ga0105245_1000376511 105
117 3300009098 Ga0105245_10021096 Ga0105245_100210962 105
118 3300009101 Ga0105247_10594992 Ga0105247_105949922 105
119 3300009148 Ga0105243_10779493 Ga0105243_107794933 105
120 3300009177 Ga0105248_10207955 Ga0105248_102079554 105
121 3300009177 Ga0105248_11327262 Ga0105248_113272621 105
122 3300009545 Ga0105237_11072736 Ga0105237_110727361 105
123 3300009553 Ga0105249_10161688 Ga0105249_101616881 105
124 3300009553 Ga0105249_10333417 Ga0105249_103334172 105
125 3300010375 Ga0105239_10437633 Ga0105239_104376332 105
126 3300011119 Ga0105246_10104317 Ga0105246_101043172 105
127 3300013102 Ga0157371_11461800 Ga0157371_114618001 105
128 3300013306 Ga0163162_10096421 Ga0163162_100964213 105
129 3300013306 Ga0163162_12359053 Ga0163162_123590532 105
130 3300014325 Ga0163163_10437093 Ga0163163_104370932 105
131 3300014968 Ga0157379_10225981 Ga0157379_102259811 105
132 3300014969 Ga0157376_10952690 Ga0157376_109526902 105
133 3300017792 Ga0163161_10980156 Ga0163161_109801562 105
134 3300020069 Ga0197907_10445946 Ga0197907_104459461 105
135 3300020070 Ga0206356_10168183 Ga0206356_101681832 105
136 3300020070 Ga0206356_11090347 Ga0206356_110903472 105
137 3300020075 Ga0206349_1796683 Ga0206349_17966831 105
138 3300020078 Ga0206352_10468200 Ga0206352_104682002 105
139 3300020081 Ga0206354_10302353 Ga0206354_103023532 105
140 3300020082 Ga0206353_10290262 Ga0206353_102902622 105
141 3300022467 Ga0224712_10282581 Ga0224712_102825812 105
142 3300025898 Ga0207692_10716867 Ga0207692_107168672 105
143 3300025899 Ga0207642_10247175 Ga0207642_102471751 105
144 3300025900 Ga0207710_10337549 Ga0207710_103375492 105
145 3300025915 Ga0207693_10012593 Ga0207693_100125936 105
146 3300025918 Ga0207662_10026538 Ga0207662_100265384 105
147 3300025918 Ga0207662_10126091 Ga0207662_101260912 105
148 3300025927 Ga0207687_10254378 Ga0207687_102543781 105
149 3300025927 Ga0207687_10473676 Ga0207687_104736762 105
150 3300025929 Ga0207664_11011549 Ga0207664_110115492 105
151 3300025937 Ga0207669_10110998 Ga0207669_101109982 105
152 3300025938 Ga0207704_10136004 Ga0207704_101360044 105
153 3300025939 Ga0207665_10158063 Ga0207665_101580632 105
154 3300025939 Ga0207665_10886010 Ga0207665_108860101 105
155 3300025941 Ga0207711_10696577 Ga0207711_106965772 105
156 3300025941 Ga0207711_11905768 Ga0207711_119057681 105
157 3300025944 Ga0207661_11486005 Ga0207661_114860052 105
158 3300025960 Ga0207651_10607244 Ga0207651_106072443 105
159 3300026035 Ga0207703_10504065 Ga0207703_105040652 105
160 3300026067 Ga0207678_10104405 Ga0207678_101044052 105
161 3300026067 Ga0207678_10613058 Ga0207678_106130582 105
162 3300026078 Ga0207702_10001437 Ga0207702_1000143718 105
163 3300026089 Ga0207648_10511170 Ga0207648_105111701 105
164 3300026121 Ga0207683_10008796 Ga0207683_100087966 105
165 3300026142 Ga0207698_11252648 Ga0207698_112526482 105
166 3300028379 Ga0268266_12152704 Ga0268266_121527041 105
167 3300028573 Ga0265334_10034101 Ga0265334_100341012 105
168 3300028800 Ga0265338_10012119 Ga0265338_100121198 105
169 3300028800 Ga0265338_10013370 Ga0265338_100133702 105
170 3300031595 Ga0265313_10007306 Ga0265313_100073069 105
171 3300035083 Ga0373926_0050199 Ga0373926_0050199_415_789 105
172 3300035116 Ga0373945_0001901 Ga0373945_0001901_4555_4929 105
173 3300035170 Ga0373943_0001176 Ga0373943_0001176_3308_3682 105
174 3300035171 Ga0373946_0018238 Ga0373946_0018238_138_512 105
175 3300035692 Ga0373935_0011249 Ga0373935_0011249_1658_2032 105
176 3300035695 Ga0373927_0049647 Ga0373927_0049647_1691_2065 105
177 3300035725 Ga0373947_0003657 Ga0373947_0003657_1222_1596 105
178 3300037068 Ga0373925_0001856 Ga0373925_0001856_8659_9033 105
179 3300037853 Ga0436364_0536907 Ga0436364_0536907_106_423 105
180 3300039450 Ga0436363_1455464 Ga0436363_1455464_44_361 105
181 3300044694 Ga0466963_0004485 Ga0466963_0004485_4865_5182 105
182 3300044694 Ga0466963_0841082 Ga0466963_0841082_314_631 105
183 3300044706 Ga0466964_0007719 Ga0466964_0007719_859_1176 105
184 3300044842 Ga0466957_0581023 Ga0466957_0581023_337_654 105
185 3300044901 Ga0466960_0049100 Ga0466960_0049100_1405_1722 105
186 3300045049 Ga0466959_0135009 Ga0466959_0135009_173_490 105
187 3300045049 Ga0466959_0404858 Ga0466959_0404858_145_462 105
188 3300045049 Ga0466959_0881318 Ga0466959_0881318_270_587 105
189 3300045836 Ga0466958_0327379 Ga0466958_0327379_543_860 105
190 3300045836 Ga0466958_0334934 Ga0466958_0334934_416_733 105
191 3300045976 Ga0466967_0028570 Ga0466967_0028570_2528_2845 105
192 3300045976 Ga0466967_0045407 Ga0466967_0045407_318_635 105
193 3300045976 Ga0466967_0053376 Ga0466967_0053376_3075_3392 105
194 3300046454 Ga0495592_0283153 Ga0495592_0283153_238_555 105
195 3300046454 Ga0495592_0580988 Ga0495592_0580988_165_539 105
196 3300046455 Ga0495603_0507335 Ga0495603_0507335_330_647 105
197 3300046459 Ga0495629_0023439 Ga0495629_0023439_3690_4064 105
198 3300046459 Ga0495629_0027799 Ga0495629_0027799_335_709 105
199 3300046461 Ga0495641_0005429 Ga0495641_0005429_3163_3537 105
200 3300046462 Ga0495651_0896300 Ga0495651_0896300_45_362 105
201 3300046463 Ga0495653_0004479 Ga0495653_0004479_1884_2258 105
202 3300046463 Ga0495653_0378867 Ga0495653_0378867_495_812 105
203 3300046472 Ga0495580_0018049 Ga0495580_0018049_2429_2803 105
204 3300046473 Ga0495582_0002155 Ga0495582_0002155_335_709 105
205 3300046475 Ga0495639_0001136 Ga0495639_0001136_3163_3537 105
206 3300046476 Ga0495662_0000631 Ga0495662_0000631_11862_12236 105
207 3300046476 Ga0495662_0279721 Ga0495662_0279721_298_672 105
208 3300046477 Ga0495664_0002923 Ga0495664_0002923_1728_2102 105
209 3300046499 Ga0495594_0078535 Ga0495594_0078535_462_836 105
210 3300046511 Ga0495608_0697038 Ga0495608_0697038_59_376 105
211 3300046511 Ga0495608_0864492 Ga0495608_0864492_42_416 105
212 3300046514 Ga0495618_0017744 Ga0495618_0017744_2160_2534 105
213 3300046514 Ga0495618_0085467 Ga0495618_0085467_1145_1513 105
214 3300046514 Ga0495618_0702550 Ga0495618_0702550_131_448 105
215 3300046516 Ga0495628_0281082 Ga0495628_0281082_511_885 105
216 3300046517 Ga0495630_0002781 Ga0495630_0002781_1482_1856 105
217 3300046517 Ga0495630_0222347 Ga0495630_0222347_817_1191 105
218 3300046526 Ga0495666_0000169 Ga0495666_0000169_20073_20447 105
219 3300046529 Ga0495652_0082914 Ga0495652_0082914_1458_1775 105
220 3300046529 Ga0495652_0655591 Ga0495652_0655591_195_563 105
221 3300046531 Ga0495665_0000431 Ga0495665_0000431_1350_1724 105
222 3300046533 Ga0495640_0007017 Ga0495640_0007017_7606_7980 105
223 3300046533 Ga0495640_0101966 Ga0495640_0101966_893_1261 105
224 3300046535 Ga0495586_0028087 Ga0495586_0028087_887_1261 105
225 3300046535 Ga0495586_0219404 Ga0495586_0219404_505_873 105
226 3300046536 Ga0495587_0669645 Ga0495587_0669645_89_406 105
227 3300046543 Ga0495645_0082256 Ga0495645_0082256_634_1008 105
228 3300046559 Ga0495667_0133612 Ga0495667_0133612_764_1138 105
229 3300046559 Ga0495667_0887439 Ga0495667_0887439_126_443 105
230 3300046642 Ga0495634_0023159 Ga0495634_0023159_2160_2534 105
231 3300046642 Ga0495634_0081514 Ga0495634_0081514_579_896 105
232 3300046642 Ga0495634_0149386 Ga0495634_0149386_784_1152 105
233 3300046663 Ga0495635_0017915 Ga0495635_0017915_3351_3725 105
234 3300046663 Ga0495635_0066585 Ga0495635_0066585_893_1261 105
235 3300046674 Ga0495588_0380908 Ga0495588_0380908_258_632 105
236 3300046678 Ga0495599_0724050 Ga0495599_0724050_113_481 105
237 3300046679 Ga0495623_0638663 Ga0495623_0638663_56_373 105
238 3300046680 Ga0495646_0058181 Ga0495646_0058181_1588_1962 105
239 3300046681 Ga0495647_0000214 Ga0495647_0000214_8272_8646 105
240 3300046683 Ga0495658_0000272 Ga0495658_0000272_23060_23434 105
241 3300046689 Ga0495613_0003786 Ga0495613_0003786_8835_9209 105
242 3300046689 Ga0495613_0017484 Ga0495613_0017484_314_688 105
243 3300046689 Ga0495613_0630942 Ga0495613_0630942_53_370 105
244 3300046690 Ga0495624_0000454 Ga0495624_0000454_11535_11909 105
245 3300046809 Ga0495600_0078945 Ga0495600_0078945_1395_1763 105
246 3300046809 Ga0495600_0110311 Ga0495600_0110311_1226_1600 105
247 3300047315 Ga0495581_0002824 Ga0495581_0002824_6686_7060 105
248 3300047319 Ga0495674_0083263 Ga0495674_0083263_887_1261 105
249 3300047319 Ga0495674_0106750 Ga0495674_0106750_602_970 105
250 3300047321 Ga0495676_0005938 Ga0495676_0005938_3309_3683 105
251 3300047322 Ga0495680_0032884 Ga0495680_0032884_2313_2687 105
252 3300047471 Ga0495684_0010417 Ga0495684_0010417_3122_3496 105
253 3300047471 Ga0495684_0285799 Ga0495684_0285799_480_854 105
254 3300047673 Ga0495593_0000504 Ga0495593_0000504_14756_15130 105
255 3300048088 Ga0495602_0661526 Ga0495602_0661526_378_695 105
256 3300048089 Ga0495614_0001712 Ga0495614_0001712_3035_3409 105
257 3300048903 Ga0496100_0104080 Ga0496100_0104080_1607_1924 105
258 3300048904 Ga0496101_0228276 Ga0496101_0228276_975_1292 105
259 3300048905 Ga0496102_0079753 Ga0496102_0079753_2013_2330 105
260 3300048905 Ga0496102_0128072 Ga0496102_0128072_209_526 105
261 3300048905 Ga0496102_1560120 Ga0496102_1560120_70_393 105
262 3300048906 Ga0496103_0048396 Ga0496103_0048396_2075_2392 105
263 3300048907 Ga0496104_0097250 Ga0496104_0097250_1707_2024 105
264 3300048907 Ga0496104_0597854 Ga0496104_0597854_149_466 105
265 3300048908 Ga0496105_1093022 Ga0496105_1093022_213_530 105
266 3300048908 Ga0496105_1261756 Ga0496105_1261756_170_487 105
267 3300048909 Ga0496106_0146065 Ga0496106_0146065_1151_1528 105
268 3300048910 Ga0496107_0020627 Ga0496107_0020627_4225_4542 105
269 3300048911 Ga0496108_0048857 Ga0496108_0048857_1263_1580 105
270 3300048911 Ga0496108_0074860 Ga0496108_0074860_2294_2611 105
271 3300048911 Ga0496108_0434676 Ga0496108_0434676_611_928 105
272 3300048912 Ga0496109_0019810 Ga0496109_0019810_4398_4715 105
273 3300048912 Ga0496109_1412246 Ga0496109_1412246_237_554 105
274 3300048913 Ga0496110_0254193 Ga0496110_0254193_502_819 105
275 3300048914 Ga0496111_0035200 Ga0496111_0035200_1112_1429 105
276 3300048914 Ga0496111_0952625 Ga0496111_0952625_88_405 105
277 3300048915 Ga0496112_0163986 Ga0496112_0163986_66_383 105
278 3300048915 Ga0496112_0530769 Ga0496112_0530769_541_858 105
279 3300048916 Ga0496113_0563310 Ga0496113_0563310_91_408 105
280 3300048917 Ga0496114_0072422 Ga0496114_0072422_879_1196 105
281 3300048918 Ga0496115_0011057 Ga0496115_0011057_6375_6692 105
282 3300048918 Ga0496115_0606934 Ga0496115_0606934_281_598 105
283 3300049583 Ga0501067_0062647 Ga0501067_0062647_1007_1327 105
284 3300049586 Ga0501070_1305117 Ga0501070_1305117_58_378 105
285 3300053077 Ga0495601_0005652 Ga0495601_0005652_5698_6072 105
286 3300053077 Ga0495601_0075785 Ga0495601_0075785_1476_1793 105
287 3300053077 Ga0495601_0088079 Ga0495601_0088079_258_575 105
288 3300053078 Ga0495612_0003206 Ga0495612_0003206_1676_2050 105
289 3300053084 Ga0495595_0280233 Ga0495595_0280233_131_448 105
290 3300053085 Ga0495619_0006440 Ga0495619_0006440_3180_3554 105
291 3300053094 Ga0500566_0049870 Ga0500566_0049870_1895_2269 105
292 3300059504 Ga0587082_138247 Ga0587082_138247_59_376 105
293 3300061719 Ga0466962_0049137 Ga0466962_0049137_128_445 105
294 3300061719 Ga0466962_0284642 Ga0466962_0284642_235_552 105
295 3300061734 Ga0530510_0391410 Ga0530510_0391410_492_812 105
296 3300003203 JGI25406J46586_10027642 JGI25406J46586_100276422 106
297 3300005327 Ga0070658_11301956 Ga0070658_113019561 106
298 3300005329 Ga0070683_100905491 Ga0070683_1009054911 106
299 3300005329 Ga0070683_101711127 Ga0070683_1017111271 106
300 3300005535 Ga0070684_101000522 Ga0070684_1010005222 106
301 3300005546 Ga0070696_101653930 Ga0070696_1016539301 106
302 3300005985 Ga0081539_10001486 Ga0081539_100014864 106
303 3300006028 Ga0070717_10197023 Ga0070717_101970231 106
304 3300009093 Ga0105240_10245422 Ga0105240_102454223 106
305 3300009551 Ga0105238_11443749 Ga0105238_114437492 106
306 3300009553 Ga0105249_11458773 Ga0105249_114587732 106
307 3300014497 Ga0182008_10008954 Ga0182008_100089547 106
308 3300015261 Ga0182006_1078327 Ga0182006_10783272 106
309 3300020069 Ga0197907_10462820 Ga0197907_104628201 106
310 3300025913 Ga0207695_10235125 Ga0207695_102351252 106
311 3300025949 Ga0207667_12143451 Ga0207667_121434511 106
312 3300037312 Ga0395899_0280788 Ga0395899_0280788_458_778 106
313 3300037466 Ga0395898_0259385 Ga0395898_0259385_1286_1606 106
314 3300037853 Ga0436364_0263178 Ga0436364_0263178_414_734 106
315 3300037853 Ga0436364_0643394 Ga0436364_0643394_604_924 106
316 3300038443 Ga0395901_0499838 Ga0395901_0499838_115_435 106
317 3300039438 Ga0436360_0447378 Ga0436360_0447378_53_373 106
318 3300039450 Ga0436363_0419069 Ga0436363_0419069_239_559 106
319 3300039453 Ga0436362_0030590 Ga0436362_0030590_316_636 106
320 3300039453 Ga0436362_0385092 Ga0436362_0385092_597_920 106
321 3300044683 Ga0466965_0017351 Ga0466965_0017351_1009_1329 106
322 3300044683 Ga0466965_0078791 Ga0466965_0078791_1207_1527 106
323 3300044684 Ga0466966_0076502 Ga0466966_0076502_1562_1882 106
324 3300044684 Ga0466966_0646280 Ga0466966_0646280_23_343 106
325 3300044684 Ga0466966_0770663 Ga0466966_0770663_19_339 106
326 3300044693 Ga0466961_0058350 Ga0466961_0058350_156_476 106
327 3300044694 Ga0466963_0004226 Ga0466963_0004226_5632_5952 106
328 3300044694 Ga0466963_0781081 Ga0466963_0781081_160_480 106
329 3300044694 Ga0466963_0865573 Ga0466963_0865573_263_583 106
330 3300044694 Ga0466963_0899933 Ga0466963_0899933_13_333 106
331 3300044706 Ga0466964_0176369 Ga0466964_0176369_469_789 106
332 3300044735 Ga0466968_0209037 Ga0466968_0209037_398_718 106
333 3300044735 Ga0466968_0223550 Ga0466968_0223550_224_544 106
334 3300044735 Ga0466968_0483828 Ga0466968_0483828_63_383 106
335 3300044765 Ga0466970_0323612 Ga0466970_0323612_430_753 106
336 3300044842 Ga0466957_0003457 Ga0466957_0003457_1327_1647 106
337 3300044842 Ga0466957_0085358 Ga0466957_0085358_1316_1636 106
338 3300044842 Ga0466957_0826012 Ga0466957_0826012_262_582 106
339 3300044901 Ga0466960_0117607 Ga0466960_0117607_195_515 106
340 3300044901 Ga0466960_0167455 Ga0466960_0167455_260_580 106
341 3300044901 Ga0466960_0727002 Ga0466960_0727002_36_416 106
342 3300044901 Ga0466960_0789784 Ga0466960_0789784_159_539 106
343 3300045049 Ga0466959_0005567 Ga0466959_0005567_865_1185 106
344 3300045049 Ga0466959_0273847 Ga0466959_0273847_14_334 106
345 3300045836 Ga0466958_0001842 Ga0466958_0001842_2086_2406 106
346 3300045836 Ga0466958_0601533 Ga0466958_0601533_102_422 106
347 3300045836 Ga0466958_0759628 Ga0466958_0759628_277_597 106
348 3300045976 Ga0466967_0003131 Ga0466967_0003131_9211_9531 106
349 3300045976 Ga0466967_0003853 Ga0466967_0003853_910_1230 106
350 3300045976 Ga0466967_0024536 Ga0466967_0024536_3264_3617 106
351 3300045976 Ga0466967_0334576 Ga0466967_0334576_595_915 106
352 3300045976 Ga0466967_0340383 Ga0466967_0340383_241_564 106
353 3300045976 Ga0466967_0495018 Ga0466967_0495018_124_444 106
354 3300045976 Ga0466967_0775125 Ga0466967_0775125_316_636 106
355 3300045976 Ga0466967_0863807 Ga0466967_0863807_556_876 106
356 3300046517 Ga0495630_1206259 Ga0495630_1206259_67_387 106
357 3300048910 Ga0496107_1277466 Ga0496107_1277466_187_510 106
358 3300048912 Ga0496109_1935356 Ga0496109_1935356_105_425 106
359 3300049585 Ga0501069_0062279 Ga0501069_0062279_703_1026 106
360 3300059626 Ga0587115_070335 Ga0587115_070335_41_361 106
361 3300061719 Ga0466962_0148622 Ga0466962_0148622_799_1119 106
362 3300061734 Ga0530510_0224803 Ga0530510_0224803_285_608 106

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wd6-assembly1.cif.gz_B crystal structure of jw1657 from escherichia coli 0.7516 3 95
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.7183 2 96
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.7105 1 96
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.7062 2 90
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.7033 2 101
ID Description Score Start End Superfamily
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7369 1 96 3.30.70.100
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7294 2 93 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7235 1 96 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7198 1 61 3.30.70.100
af_Q9LIS1_12_210_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.7118 42 69 3.30.559.10
ID Description Score Start End GO Terms
AF-A0A538K312-F1-model_v4 ABM domain-containing protein 0.9869 4 106
AF-A0A4R6L4G5-F1-model_v4 Quinol monooxygenase YgiN 0.9803 1 103
AF-A0A538IIQ4-F1-model_v4 ABM domain-containing protein 0.9698 1 106
AF-A0A538IIQ4-F1-model_v4 ABM domain-containing protein 0.9609 1 106
AF-A0A538K312-F1-model_v4 ABM domain-containing protein 0.9504 4 106

Feature Viewer

pLDDT pTM Quality
93.92 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map