F422537

General Info

Members Datasets Scaffolds Average Seq Length
362 173 724 361

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100148107|Ga0068856_1001481072
Length 386
Sequence MTARAGDAGELGRHDEQRRAGGDFRTRVVHAGLDPDPAYGSIIPAIHQTSTFVQTAVGEVVEDYDYARGANPTRSALERALGALEGGYASAFSSGMAATHALITAVCSAGDHVVIPADLYGGTYRLVDKVLSRWGLRHTMVDQTDLDALAAAVADDTRLVWVETPTNPLLNVVDIAAVVARKRNALVAVDNTFATPANQRPLEDGADAVVHSTTKYLGGHSDVIGGAVIARDPGLHEQVRFVQKSIGAVPGPFDSFLVHRGLRTLAVRMRAHAESARAVSEWLSGADGAYDVRWPGFSGMVCFRHPEAAAIAEATKLFTLAESLGGVESLIEVPQAMTHQTVEDSAAAVPADLVRLSCGIEAPEDLVDDLARAFARVAEGAAALRA

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 9.39
Rhizosphere 83.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100148107 3300005614 Bacteria 2355
2 JGI25407J50210_10000227 3300003373 Bacteria 9757
3 JGI25407J50210_10013232 3300003373 Bacteria 2120
4 Ga0070683_100187132 3300005329 Bacteria 1966
5 Ga0070683_100218434 3300005329 Bacteria 1811
6 Ga0070660_100022226 3300005339 Bacteria 4688
7 Ga0070660_100206092 3300005339 Bacteria 1596
8 Ga0070692_10102212 3300005345 Bacteria 1573
9 Ga0070668_100037905 3300005347 Bacteria 3683
10 Ga0070714_100019385 3300005435 Bacteria 5540
11 Ga0070714_100033767 3300005435 Bacteria 4280
12 Ga0070713_100007050 3300005436 Bacteria 7852
13 Ga0070713_100049589 3300005436 Bacteria 3464
14 Ga0070710_10033387 3300005437 Bacteria 2794
15 Ga0070711_100055544 3300005439 Bacteria 2736
16 Ga0070700_100049853 3300005441 Bacteria 2601
17 Ga0070662_100002985 3300005457 Bacteria 10516
18 Ga0070662_100135499 3300005457 Bacteria 1903
19 Ga0068867_100202712 3300005459 Bacteria 1589
20 Ga0070684_100005084 3300005535 Bacteria 10047
21 Ga0068853_100199394 3300005539 Bacteria 1821
22 Ga0070672_100090640 3300005543 Bacteria 2466
23 Ga0070665_100013905 3300005548 Bacteria 8095
24 Ga0070664_100410090 3300005564 Bacteria 1240
25 Ga0068854_100034817 3300005578 Bacteria 3521
26 Ga0068856_100428533 3300005614 Bacteria 1343
27 Ga0068852_100167215 3300005616 Bacteria 2058
28 Ga0068864_100424811 3300005618 Bacteria 1267
29 Ga0068866_10063037 3300005718 Bacteria 1931
30 Ga0068861_100056994 3300005719 Bacteria 2984
31 Ga0081455_10003650 3300005937 Bacteria 17631
32 Ga0081455_10004445 3300005937 Bacteria 15724
33 Ga0081455_10007741 3300005937 Bacteria 11268
34 Ga0081455_10018879 3300005937 Bacteria 6543
35 Ga0081455_10091527 3300005937 Bacteria 2463
36 Ga0081538_10000068 3300005981 Bacteria 97659
37 Ga0081538_10000235 3300005981 Bacteria 62346
38 Ga0081538_10000364 3300005981 Bacteria 51665
39 Ga0081538_10000487 3300005981 Bacteria 44314
40 Ga0081538_10000911 3300005981 Bacteria 31882
41 Ga0081538_10001196 3300005981 Bacteria 27277
42 Ga0081538_10002809 3300005981 Bacteria 16683
43 Ga0081538_10003277 3300005981 Bacteria 15371
44 Ga0081538_10003395 3300005981 Bacteria 15070
45 Ga0081538_10004898 3300005981 Bacteria 12196
46 Ga0081538_10005357 3300005981 Bacteria 11526
47 Ga0081538_10005722 3300005981 Bacteria 11105
48 Ga0081538_10007168 3300005981 Bacteria 9680
49 Ga0081538_10008254 3300005981 Bacteria 8869
50 Ga0081538_10019780 3300005981 Bacteria 4983
51 Ga0081538_10024636 3300005981 Bacteria 4281
52 Ga0081538_10057766 3300005981 Bacteria 2257
53 Ga0081538_10061385 3300005981 Bacteria 2152
54 Ga0081538_10111924 3300005981 Bacteria 1337
55 Ga0081540_1012482 3300005983 Bacteria 5587
56 Ga0081539_10003865 3300005985 Bacteria 17538
57 Ga0081539_10004942 3300005985 Bacteria 14173
58 Ga0081539_10017609 3300005985 Bacteria 5006
59 Ga0081539_10050758 3300005985 Bacteria 2344
60 Ga0070717_10007828 3300006028 Bacteria 7951
61 Ga0070717_10058217 3300006028 Bacteria 3195
62 Ga0070717_10079968 3300006028 Bacteria 2742
63 Ga0070715_10026318 3300006163 Bacteria 2313
64 Ga0070712_100003271 3300006175 Bacteria 9978
65 Ga0075428_100166406 3300006844 Bacteria 2391
66 Ga0075428_100194508 3300006844 Bacteria 2194
67 Ga0075430_100000335 3300006846 Bacteria 33808
68 Ga0075430_100029332 3300006846 Bacteria 4669
69 Ga0075431_100048378 3300006847 Bacteria 4386
70 Ga0075431_100053828 3300006847 Bacteria 4149
71 Ga0075431_100061439 3300006847 Bacteria 3876
72 Ga0075431_100117883 3300006847 Bacteria 2739
73 Ga0075431_100160543 3300006847 Bacteria 2311
74 Ga0075434_100100069 3300006871 Bacteria 2905
75 Ga0075434_100171262 3300006871 Bacteria 2191
76 Ga0075429_100135412 3300006880 Bacteria 2156
77 Ga0068865_100205369 3300006881 Bacteria 1532
78 Ga0068865_100284831 3300006881 Bacteria 1317
79 Ga0111539_10013416 3300009094 Bacteria 10243
80 Ga0111539_10032021 3300009094 Bacteria 6387
81 Ga0111539_10066128 3300009094 Bacteria 4270
82 Ga0111539_10151194 3300009094 Bacteria 2717
83 Ga0105245_10005224 3300009098 Bacteria 11408
84 Ga0105245_10020269 3300009098 Bacteria 5829
85 Ga0114129_10002371 3300009147 Bacteria 26160
86 Ga0114129_10084983 3300009147 Bacteria 4391
87 Ga0114129_10191349 3300009147 Bacteria 2778
88 Ga0114129_10380484 3300009147 Bacteria 1864
89 Ga0105249_10008684 3300009553 Bacteria 8854
90 Ga0105249_10201684 3300009553 Bacteria 1947
91 Ga0105249_10296909 3300009553 Bacteria 1619
92 Ga0105239_10296368 3300010375 Bacteria 1821
93 Ga0163162_10067311 3300013306 Bacteria 3632
94 Ga0163162_10325198 3300013306 Bacteria 1670
95 Ga0157372_10385588 3300013307 Bacteria 1633
96 Ga0157377_10131090 3300014745 Bacteria 1531
97 Ga0157379_10004740 3300014968 Bacteria 11674
98 Ga0163161_10066224 3300017792 Bacteria 2637
99 Ga0213876_10017142 3300021384 Bacteria 3824
100 Ga0213876_10033467 3300021384 Bacteria 2710
101 Ga0213876_10050461 3300021384 Bacteria 2198
102 Ga0213875_10000148 3300021388 Bacteria 74125
103 Ga0213875_10027512 3300021388 Bacteria 2705
104 Ga0213875_10043492 3300021388 Bacteria 2109
105 Ga0207656_10085026 3300025321 Bacteria 1428
106 Ga0207692_10035526 3300025898 Bacteria 2422
107 Ga0207645_10036640 3300025907 Bacteria 3150
108 Ga0207707_10083526 3300025912 Bacteria 2789
109 Ga0207693_10001944 3300025915 Bacteria 18107
110 Ga0207663_10146429 3300025916 Bacteria 1652
111 Ga0207662_10096683 3300025918 Bacteria 1825
112 Ga0207657_10004267 3300025919 Bacteria 15147
113 Ga0207657_10128799 3300025919 Bacteria 2076
114 Ga0207687_10005608 3300025927 Bacteria 8296
115 Ga0207664_10030578 3300025929 Bacteria 4113
116 Ga0207664_10065688 3300025929 Bacteria 2905
117 Ga0207664_10179652 3300025929 Bacteria 1816
118 Ga0207664_10206060 3300025929 Bacteria 1700
119 Ga0207706_10003131 3300025933 Bacteria 15890
120 Ga0207706_10023814 3300025933 Bacteria 5492
121 Ga0207706_10295299 3300025933 Bacteria 1412
122 Ga0207669_10208654 3300025937 Bacteria 1424
123 Ga0207689_10132582 3300025942 Bacteria 2051
124 Ga0207661_10007614 3300025944 Bacteria 7702
125 Ga0207661_10138629 3300025944 Bacteria 2091
126 Ga0207712_10066793 3300025961 Bacteria 2572
127 Ga0207678_10207403 3300026067 Bacteria 1676
128 Ga0207708_10055870 3300026075 Bacteria 3011
129 Ga0207648_10166046 3300026089 Bacteria 1951
130 Ga0207676_10346551 3300026095 Bacteria 1372
131 Ga0207675_100023241 3300026118 Bacteria 5765
132 Ga0207675_100276712 3300026118 Bacteria 1630
133 Ga0207428_10091657 3300027907 Bacteria 2359
134 Ga0268266_10044612 3300028379 Bacteria 3790
135 Ga0265319_1004578 3300028563 Bacteria 6809
136 Ga0265318_10000721 3300028577 Bacteria 22208
137 Ga0265338_10016964 3300028800 Bacteria 7880
138 Ga0265320_10011937 3300031240 Bacteria 5086
139 Ga0265316_10149520 3300031344 Bacteria 1750
140 Ga0307413_10045659 3300031824 Bacteria 2599
141 Ga0307406_10046179 3300031901 Bacteria 2739
142 Ga0307406_10134333 3300031901 Bacteria 1741
143 Ga0307407_10011672 3300031903 Bacteria 4194
144 Ga0307407_10119512 3300031903 Bacteria 1668
145 Ga0307407_10152798 3300031903 Bacteria 1502
146 Ga0307412_10013572 3300031911 Bacteria 4781
147 Ga0307409_100037214 3300031995 Bacteria 3586
148 Ga0307409_100076344 3300031995 Bacteria 2686
149 Ga0307409_100107925 3300031995 Bacteria 2327
150 Ga0307409_100162874 3300031995 Bacteria 1953
151 Ga0307416_100109700 3300032002 Bacteria 2428
152 Ga0307416_100120344 3300032002 Bacteria 2338
153 Ga0307416_100233557 3300032002 Bacteria 1775
154 Ga0307416_100252208 3300032002 Bacteria 1718
155 Ga0307416_100410396 3300032002 Bacteria 1395
156 Ga0307411_10327262 3300032005 Bacteria 1240
157 Ga0307411_10340804 3300032005 Bacteria 1218
158 Ga0307415_100000496 3300032126 Bacteria 17052
159 Ga0307415_100043095 3300032126 Bacteria 3008
160 Ga0307415_100150990 3300032126 Bacteria 1788
161 Ga0307415_100157525 3300032126 Bacteria 1756
162 Ga0373935_0175345 3300035692 Bacteria 1469
163 Ga0373937_0028476 3300036401 Bacteria 5055
164 Ga0395899_0065053 3300037312 Bacteria 2680
165 Ga0395900_0028569 3300037418 Bacteria 5715
166 Ga0395898_0004827 3300037466 Bacteria 14666
167 Ga0395898_0010602 3300037466 Bacteria 9624
168 Ga0395898_0024208 3300037466 Bacteria 6125
169 Ga0395898_0026540 3300037466 Bacteria 5826
170 Ga0395898_0084837 3300037466 Bacteria 3053
171 Ga0395898_0109379 3300037466 Bacteria 2650
172 Ga0395898_0114971 3300037466 Bacteria 2578
173 Ga0395898_0157642 3300037466 Bacteria 2171
174 Ga0395898_0284376 3300037466 Bacteria 1578
175 Ga0395905_0005356 3300037471 Bacteria 13110
176 Ga0395905_0039080 3300037471 Bacteria 4452
177 Ga0395905_0353866 3300037471 Bacteria 1361
178 Ga0436364_0242938 3300037853 Bacteria 11085
179 Ga0436364_0387194 3300037853 Bacteria 2570
180 Ga0436364_1012485 3300037853 Bacteria 1945
181 Ga0436364_1105580 3300037853 Bacteria 94835
182 Ga0436364_1192189 3300037853 Bacteria 33424
183 Ga0436364_1354282 3300037853 Bacteria 8649
184 Ga0436364_1493554 3300037853 Bacteria 2705
185 Ga0436364_1538102 3300037853 Bacteria 3942
186 Ga0395901_0005230 3300038443 Bacteria 13099
187 Ga0395901_0024387 3300038443 Bacteria 6207
188 Ga0395901_0191095 3300038443 Bacteria 2147
189 Ga0395901_0502995 3300038443 Bacteria 1233
190 Ga0436365_0040193 3300039437 Bacteria 3442
191 Ga0436365_0856560 3300039437 Bacteria 5625
192 Ga0436365_1099557 3300039437 Bacteria 16467
193 Ga0436365_1677651 3300039437 Bacteria 28588
194 Ga0436363_0324116 3300039450 Bacteria 1949
195 Ga0436363_0375335 3300039450 Bacteria 7330
196 Ga0436363_0959734 3300039450 Bacteria 2163
197 Ga0451791_0446260 3300041451 Bacteria 2398
198 Ga0466969_0019432 3300044656 Bacteria 3532
199 Ga0466972_0074854 3300044658 Bacteria 1614
200 Ga0466966_0117828 3300044684 Bacteria 1633
201 Ga0466961_0036137 3300044693 Bacteria 3171
202 Ga0466961_0095926 3300044693 Bacteria 1870
203 Ga0466963_0005833 3300044694 Bacteria 7248
204 Ga0466963_0013579 3300044694 Bacteria 5002
205 Ga0466963_0016334 3300044694 Bacteria 4615
206 Ga0466963_0052204 3300044694 Bacteria 2712
207 Ga0466963_0185290 3300044694 Bacteria 1454
208 Ga0466971_0003800 3300044719 Bacteria 6464
209 Ga0466971_0108615 3300044719 Bacteria 1279
210 Ga0466968_0067415 3300044735 Bacteria 1552
211 Ga0466957_0019513 3300044842 Bacteria 3987
212 Ga0466957_0044993 3300044842 Bacteria 2676
213 Ga0466957_0111814 3300044842 Bacteria 1733
214 Ga0466960_0000038 3300044901 Bacteria 42497
215 Ga0466960_0027876 3300044901 Bacteria 2581
216 Ga0466959_0009255 3300045049 Bacteria 7000
217 Ga0466959_0009920 3300045049 Bacteria 6789
218 Ga0466959_0015012 3300045049 Bacteria 5644
219 Ga0466959_0082329 3300045049 Bacteria 2318
220 Ga0466959_0119114 3300045049 Bacteria 1878
221 Ga0466958_0003836 3300045836 Bacteria 7853
222 Ga0466958_0018423 3300045836 Bacteria 4052
223 Ga0466958_0027581 3300045836 Bacteria 3361
224 Ga0466958_0032893 3300045836 Bacteria 3087
225 Ga0466958_0057420 3300045836 Bacteria 2365
226 Ga0466967_0008539 3300045976 Bacteria 7520
227 Ga0466967_0008771 3300045976 Bacteria 7450
228 Ga0466967_0011770 3300045976 Bacteria 6651
229 Ga0466967_0020916 3300045976 Bacteria 5301
230 Ga0466967_0040022 3300045976 Bacteria 4033
231 Ga0466967_0081826 3300045976 Bacteria 2917
232 Ga0466967_0102906 3300045976 Bacteria 2613
233 Ga0466967_0149130 3300045976 Bacteria 2184
234 Ga0466967_0162163 3300045976 Bacteria 2099
235 Ga0466967_0329041 3300045976 Bacteria 1475
236 Ga0466967_0337525 3300045976 Bacteria 1456
237 Ga0495592_0226104 3300046454 Bacteria 1248
238 Ga0495651_0016554 3300046462 Bacteria 5710
239 Ga0495653_0063082 3300046463 Bacteria 2798
240 Ga0495650_0000104 3300046471 Bacteria 208976
241 Ga0495608_0008468 3300046511 Bacteria 7204
242 Ga0495628_0023087 3300046516 Bacteria 5107
243 Ga0495640_0109231 3300046533 Bacteria 1809
244 Ga0495635_0079611 3300046663 Bacteria 2242
245 Ga0495599_0193908 3300046678 Bacteria 1249
246 Ga0495646_0091740 3300046680 Bacteria 1753
247 Ga0495613_0124336 3300046689 Bacteria 1851
248 Ga0495600_0025104 3300046809 Bacteria 3840
249 Ga0495581_0146591 3300047315 Bacteria 1378
250 Ga0495672_0014203 3300047320 Bacteria 5462
251 Ga0495684_0035140 3300047471 Bacteria 3845
252 Ga0495593_0042241 3300047673 Bacteria 2448
253 Ga0496101_0037219 3300048904 Bacteria 3450
254 Ga0496105_0000904 3300048908 Bacteria 20209
255 Ga0496105_0062460 3300048908 Bacteria 3074
256 Ga0496105_0119778 3300048908 Bacteria 2171
257 Ga0496105_0148932 3300048908 Bacteria 1924
258 Ga0496106_0006779 3300048909 Bacteria 8479
259 Ga0496106_0030897 3300048909 Bacteria 3993
260 Ga0496107_0022323 3300048910 Bacteria 4473
261 Ga0496107_0168695 3300048910 Bacteria 1624
262 Ga0496108_0001301 3300048911 Bacteria 19620
263 Ga0496108_0042424 3300048911 Bacteria 3798
264 Ga0496109_0003765 3300048912 Bacteria 12669
265 Ga0496109_0055930 3300048912 Bacteria 3600
266 Ga0496109_0076510 3300048912 Bacteria 3078
267 Ga0496109_0090475 3300048912 Bacteria 2830
268 Ga0496109_0120374 3300048912 Bacteria 2445
269 Ga0496109_0143311 3300048912 Bacteria 2235
270 Ga0496109_0224767 3300048912 Bacteria 1766
271 Ga0496110_0005391 3300048913 Bacteria 10026
272 Ga0496111_0027609 3300048914 Bacteria 4018
273 Ga0496111_0029643 3300048914 Bacteria 3887
274 Ga0496112_0002349 3300048915 Bacteria 15188
275 Ga0496112_0004768 3300048915 Bacteria 11564
276 Ga0496112_0012505 3300048915 Bacteria 7800
277 Ga0496112_0071846 3300048915 Bacteria 3420
278 Ga0496112_0176000 3300048915 Bacteria 2105
279 Ga0496112_0245583 3300048915 Bacteria 1742
280 Ga0496113_0019396 3300048916 Bacteria 4756
281 Ga0496113_0036209 3300048916 Bacteria 3615
282 Ga0496113_0083001 3300048916 Bacteria 2458
283 Ga0496113_0114364 3300048916 Bacteria 2104
284 Ga0496115_0032638 3300048918 Bacteria 4108
285 Ga0496115_0345213 3300048918 Bacteria 1214
286 Ga0496124_0144162 3300048927 Bacteria 1876
287 Ga0501031_0028665 3300049568 Bacteria 3630
288 Ga0501031_0029602 3300049568 Bacteria 3572
289 Ga0501032_0044636 3300049569 Bacteria 2999
290 Ga0501033_0013128 3300049570 Bacteria 6311
291 Ga0501033_0096246 3300049570 Bacteria 2163
292 Ga0501033_0160618 3300049570 Bacteria 1618
293 Ga0501034_0019807 3300049571 Bacteria 6876
294 Ga0501034_0439376 3300049571 Bacteria 1224
295 Ga0501036_0088021 3300049572 Bacteria 2625
296 Ga0501036_0094478 3300049572 Bacteria 2527
297 Ga0501037_0024957 3300049573 Bacteria 4418
298 Ga0501037_0109023 3300049573 Bacteria 1995
299 Ga0501038_0069938 3300049574 Bacteria 2981
300 Ga0501038_0193365 3300049574 Bacteria 1636
301 Ga0501039_0045820 3300049575 Bacteria 3379
302 Ga0501039_0117774 3300049575 Bacteria 2080
303 Ga0501042_0038863 3300049578 Bacteria 3380
304 Ga0501042_0048045 3300049578 Bacteria 3043
305 Ga0501043_0209477 3300049579 Bacteria 1511
306 Ga0501047_0003825 3300049581 Bacteria 14151
307 Ga0501047_0025872 3300049581 Bacteria 5643
308 Ga0501068_0038623 3300049584 Bacteria 2861
309 Ga0501069_0023586 3300049585 Bacteria 3356
310 Ga0501071_0042740 3300049587 Bacteria 3248
311 Ga0501071_0122228 3300049587 Bacteria 1930
312 Ga0501071_0314486 3300049587 Bacteria 1188
313 Ga0501072_0074820 3300049588 Bacteria 2678
314 Ga0501072_0091556 3300049588 Bacteria 2414
315 Ga0501072_0175373 3300049588 Bacteria 1710
316 Ga0501072_0264338 3300049588 Bacteria 1369
317 Ga0501074_0272889 3300049590 Bacteria 1202
318 Ga0501075_0014856 3300049591 Bacteria 5584
319 Ga0501075_0077800 3300049591 Bacteria 2510
320 Ga0501076_0011501 3300049592 Bacteria 6596
321 Ga0501076_0043112 3300049592 Bacteria 3554
322 Ga0501077_0045051 3300049593 Bacteria 2802
323 Ga0501077_0089944 3300049593 Bacteria 1946
324 Ga0501079_0061649 3300049741 Bacteria 2893
325 Ga0501079_0127453 3300049741 Bacteria 1980
326 Ga0501079_0356462 3300049741 Bacteria 1146
327 Ga0501081_0278891 3300049743 Bacteria 1223
328 Ga0501083_0244680 3300049744 Bacteria 1168
329 Ga0501035_0001658 3300049822 Bacteria 22498
330 Ga0501044_0007034 3300049823 Bacteria 12379
331 Ga0501044_0016726 3300049823 Bacteria 7874
332 Ga0501044_0034748 3300049823 Bacteria 5284
333 Ga0501044_0429706 3300049823 Bacteria 1230
334 Ga0501045_0069495 3300049824 Bacteria 2589
335 Ga0501045_0098079 3300049824 Bacteria 2168
336 nmdc:mga05p37_180759_c1 3300050507 Bacteria 2566
337 nmdc:mga05p37_263757_c1 3300050507 Bacteria 2060
338 nmdc:mga05p37_350773_c1 3300050507 Bacteria 1737
339 nmdc:mga09592_113876_c1 3300050508 Bacteria 2321
340 nmdc:mga0qj67_221964_c1 3300050509 Bacteria 1534
341 nmdc:mga0qj67_411_c1 3300050509 Bacteria 29303
342 nmdc:mga06r32_14763_c1 3300050510 Bacteria 7090
343 nmdc:mga06r32_181818_c1 3300050510 Bacteria 2088
344 nmdc:mga06r32_2376_c1 3300050510 Bacteria 16856
345 nmdc:mga06r32_31507_c1 3300050510 Bacteria 4981
346 nmdc:mga06r32_84136_c1 3300050510 Bacteria 3100
347 nmdc:mga08y16_130527_c2 3300050511 Bacteria 1770
348 nmdc:mga08y16_159653_c2 3300050511 Bacteria 2047
349 nmdc:mga08y16_18495_c1 3300050511 Bacteria 7341
350 nmdc:mga08y16_75648_c1 3300050511 Bacteria 3510
351 nmdc:mga0n895_114000_c1 3300050512 Bacteria 2721
352 nmdc:mga0a205_121408_c1 3300050515 Bacteria 2206
353 nmdc:mga0a205_148070_c1 3300050515 Bacteria 2248
354 Ga0495655_0034193 3300053083 Bacteria 1256
355 Ga0495595_0030161 3300053084 Bacteria 2431
356 Ga0500556_0000383 3300053104 Bacteria 32358
357 Ga0500616_0008943 3300053153 Bacteria 6137
358 Ga0501084_0087594 3300054114 Bacteria 2614
359 Ga0501084_0181082 3300054114 Bacteria 1779
360 Ga0501082_0013680 3300060353 Bacteria 6976
361 Ga0466962_0004543 3300061719 Bacteria 6656
362 Ga0466962_0053754 3300061719 Bacteria 1924
363 Ga0068856_100148107
364 JGI25407J50210_10000227
365 JGI25407J50210_10013232
366 Ga0070683_100187132
367 Ga0070683_100218434
368 Ga0070660_100022226
369 Ga0070660_100206092
370 Ga0070692_10102212
371 Ga0070668_100037905
372 Ga0070714_100019385
373 Ga0070714_100033767
374 Ga0070713_100007050
375 Ga0070713_100049589
376 Ga0070710_10033387
377 Ga0070711_100055544
378 Ga0070700_100049853
379 Ga0070662_100002985
380 Ga0070662_100135499
381 Ga0068867_100202712
382 Ga0070684_100005084
383 Ga0068853_100199394
384 Ga0070672_100090640
385 Ga0070665_100013905
386 Ga0070664_100410090
387 Ga0068854_100034817
388 Ga0068856_100428533
389 Ga0068852_100167215
390 Ga0068864_100424811
391 Ga0068866_10063037
392 Ga0068861_100056994
393 Ga0081455_10003650
394 Ga0081455_10004445
395 Ga0081455_10007741
396 Ga0081455_10018879
397 Ga0081455_10091527
398 Ga0081538_10000068
399 Ga0081538_10000235
400 Ga0081538_10000364
401 Ga0081538_10000487
402 Ga0081538_10000911
403 Ga0081538_10001196
404 Ga0081538_10002809
405 Ga0081538_10003277
406 Ga0081538_10003395
407 Ga0081538_10004898
408 Ga0081538_10005357
409 Ga0081538_10005722
410 Ga0081538_10007168
411 Ga0081538_10008254
412 Ga0081538_10019780
413 Ga0081538_10024636
414 Ga0081538_10057766
415 Ga0081538_10061385
416 Ga0081538_10111924
417 Ga0081540_1012482
418 Ga0081539_10003865
419 Ga0081539_10004942
420 Ga0081539_10017609
421 Ga0081539_10050758
422 Ga0070717_10007828
423 Ga0070717_10058217
424 Ga0070717_10079968
425 Ga0070715_10026318
426 Ga0070712_100003271
427 Ga0075428_100166406
428 Ga0075428_100194508
429 Ga0075430_100000335
430 Ga0075430_100029332
431 Ga0075431_100048378
432 Ga0075431_100053828
433 Ga0075431_100061439
434 Ga0075431_100117883
435 Ga0075431_100160543
436 Ga0075434_100100069
437 Ga0075434_100171262
438 Ga0075429_100135412
439 Ga0068865_100205369
440 Ga0068865_100284831
441 Ga0111539_10013416
442 Ga0111539_10032021
443 Ga0111539_10066128
444 Ga0111539_10151194
445 Ga0105245_10005224
446 Ga0105245_10020269
447 Ga0114129_10002371
448 Ga0114129_10084983
449 Ga0114129_10191349
450 Ga0114129_10380484
451 Ga0105249_10008684
452 Ga0105249_10201684
453 Ga0105249_10296909
454 Ga0105239_10296368
455 Ga0163162_10067311
456 Ga0163162_10325198
457 Ga0157372_10385588
458 Ga0157377_10131090
459 Ga0157379_10004740
460 Ga0163161_10066224
461 Ga0213876_10017142
462 Ga0213876_10033467
463 Ga0213876_10050461
464 Ga0213875_10000148
465 Ga0213875_10027512
466 Ga0213875_10043492
467 Ga0207656_10085026
468 Ga0207692_10035526
469 Ga0207645_10036640
470 Ga0207707_10083526
471 Ga0207693_10001944
472 Ga0207663_10146429
473 Ga0207662_10096683
474 Ga0207657_10004267
475 Ga0207657_10128799
476 Ga0207687_10005608
477 Ga0207664_10030578
478 Ga0207664_10065688
479 Ga0207664_10179652
480 Ga0207664_10206060
481 Ga0207706_10003131
482 Ga0207706_10023814
483 Ga0207706_10295299
484 Ga0207669_10208654
485 Ga0207689_10132582
486 Ga0207661_10007614
487 Ga0207661_10138629
488 Ga0207712_10066793
489 Ga0207678_10207403
490 Ga0207708_10055870
491 Ga0207648_10166046
492 Ga0207676_10346551
493 Ga0207675_100023241
494 Ga0207675_100276712
495 Ga0207428_10091657
496 Ga0268266_10044612
497 Ga0265319_1004578
498 Ga0265318_10000721
499 Ga0265338_10016964
500 Ga0265320_10011937
501 Ga0265316_10149520
502 Ga0307413_10045659
503 Ga0307406_10046179
504 Ga0307406_10134333
505 Ga0307407_10011672
506 Ga0307407_10119512
507 Ga0307407_10152798
508 Ga0307412_10013572
509 Ga0307409_100037214
510 Ga0307409_100076344
511 Ga0307409_100107925
512 Ga0307409_100162874
513 Ga0307416_100109700
514 Ga0307416_100120344
515 Ga0307416_100233557
516 Ga0307416_100252208
517 Ga0307416_100410396
518 Ga0307411_10327262
519 Ga0307411_10340804
520 Ga0307415_100000496
521 Ga0307415_100043095
522 Ga0307415_100150990
523 Ga0307415_100157525
524 Ga0373935_0175345
525 Ga0373937_0028476
526 Ga0395899_0065053
527 Ga0395900_0028569
528 Ga0395898_0004827
529 Ga0395898_0010602
530 Ga0395898_0024208
531 Ga0395898_0026540
532 Ga0395898_0084837
533 Ga0395898_0109379
534 Ga0395898_0114971
535 Ga0395898_0157642
536 Ga0395898_0284376
537 Ga0395905_0005356
538 Ga0395905_0039080
539 Ga0395905_0353866
540 Ga0436364_0242938
541 Ga0436364_0387194
542 Ga0436364_1012485
543 Ga0436364_1105580
544 Ga0436364_1192189
545 Ga0436364_1354282
546 Ga0436364_1493554
547 Ga0436364_1538102
548 Ga0395901_0005230
549 Ga0395901_0024387
550 Ga0395901_0191095
551 Ga0395901_0502995
552 Ga0436365_0040193
553 Ga0436365_0856560
554 Ga0436365_1099557
555 Ga0436365_1677651
556 Ga0436363_0324116
557 Ga0436363_0375335
558 Ga0436363_0959734
559 Ga0451791_0446260
560 Ga0466969_0019432
561 Ga0466972_0074854
562 Ga0466966_0117828
563 Ga0466961_0036137
564 Ga0466961_0095926
565 Ga0466963_0005833
566 Ga0466963_0013579
567 Ga0466963_0016334
568 Ga0466963_0052204
569 Ga0466963_0185290
570 Ga0466971_0003800
571 Ga0466971_0108615
572 Ga0466968_0067415
573 Ga0466957_0019513
574 Ga0466957_0044993
575 Ga0466957_0111814
576 Ga0466960_0000038
577 Ga0466960_0027876
578 Ga0466959_0009255
579 Ga0466959_0009920
580 Ga0466959_0015012
581 Ga0466959_0082329
582 Ga0466959_0119114
583 Ga0466958_0003836
584 Ga0466958_0018423
585 Ga0466958_0027581
586 Ga0466958_0032893
587 Ga0466958_0057420
588 Ga0466967_0008539
589 Ga0466967_0008771
590 Ga0466967_0011770
591 Ga0466967_0020916
592 Ga0466967_0040022
593 Ga0466967_0081826
594 Ga0466967_0102906
595 Ga0466967_0149130
596 Ga0466967_0162163
597 Ga0466967_0329041
598 Ga0466967_0337525
599 Ga0495592_0226104
600 Ga0495651_0016554
601 Ga0495653_0063082
602 Ga0495650_0000104
603 Ga0495608_0008468
604 Ga0495628_0023087
605 Ga0495640_0109231
606 Ga0495635_0079611
607 Ga0495599_0193908
608 Ga0495646_0091740
609 Ga0495613_0124336
610 Ga0495600_0025104
611 Ga0495581_0146591
612 Ga0495672_0014203
613 Ga0495684_0035140
614 Ga0495593_0042241
615 Ga0496101_0037219
616 Ga0496105_0000904
617 Ga0496105_0062460
618 Ga0496105_0119778
619 Ga0496105_0148932
620 Ga0496106_0006779
621 Ga0496106_0030897
622 Ga0496107_0022323
623 Ga0496107_0168695
624 Ga0496108_0001301
625 Ga0496108_0042424
626 Ga0496109_0003765
627 Ga0496109_0055930
628 Ga0496109_0076510
629 Ga0496109_0090475
630 Ga0496109_0120374
631 Ga0496109_0143311
632 Ga0496109_0224767
633 Ga0496110_0005391
634 Ga0496111_0027609
635 Ga0496111_0029643
636 Ga0496112_0002349
637 Ga0496112_0004768
638 Ga0496112_0012505
639 Ga0496112_0071846
640 Ga0496112_0176000
641 Ga0496112_0245583
642 Ga0496113_0019396
643 Ga0496113_0036209
644 Ga0496113_0083001
645 Ga0496113_0114364
646 Ga0496115_0032638
647 Ga0496115_0345213
648 Ga0496124_0144162
649 Ga0501031_0028665
650 Ga0501031_0029602
651 Ga0501032_0044636
652 Ga0501033_0013128
653 Ga0501033_0096246
654 Ga0501033_0160618
655 Ga0501034_0019807
656 Ga0501034_0439376
657 Ga0501036_0088021
658 Ga0501036_0094478
659 Ga0501037_0024957
660 Ga0501037_0109023
661 Ga0501038_0069938
662 Ga0501038_0193365
663 Ga0501039_0045820
664 Ga0501039_0117774
665 Ga0501042_0038863
666 Ga0501042_0048045
667 Ga0501043_0209477
668 Ga0501047_0003825
669 Ga0501047_0025872
670 Ga0501068_0038623
671 Ga0501069_0023586
672 Ga0501071_0042740
673 Ga0501071_0122228
674 Ga0501071_0314486
675 Ga0501072_0074820
676 Ga0501072_0091556
677 Ga0501072_0175373
678 Ga0501072_0264338
679 Ga0501074_0272889
680 Ga0501075_0014856
681 Ga0501075_0077800
682 Ga0501076_0011501
683 Ga0501076_0043112
684 Ga0501077_0045051
685 Ga0501077_0089944
686 Ga0501079_0061649
687 Ga0501079_0127453
688 Ga0501079_0356462
689 Ga0501081_0278891
690 Ga0501083_0244680
691 Ga0501035_0001658
692 Ga0501044_0007034
693 Ga0501044_0016726
694 Ga0501044_0034748
695 Ga0501044_0429706
696 Ga0501045_0069495
697 Ga0501045_0098079
698 nmdc:mga05p37_180759_c1
699 nmdc:mga05p37_263757_c1
700 nmdc:mga05p37_350773_c1
701 nmdc:mga09592_113876_c1
702 nmdc:mga0qj67_221964_c1
703 nmdc:mga0qj67_411_c1
704 nmdc:mga06r32_14763_c1
705 nmdc:mga06r32_181818_c1
706 nmdc:mga06r32_2376_c1
707 nmdc:mga06r32_31507_c1
708 nmdc:mga06r32_84136_c1
709 nmdc:mga08y16_130527_c2
710 nmdc:mga08y16_159653_c2
711 nmdc:mga08y16_18495_c1
712 nmdc:mga08y16_75648_c1
713 nmdc:mga0n895_114000_c1
714 nmdc:mga0a205_121408_c1
715 nmdc:mga0a205_148070_c1
716 Ga0495655_0034193
717 Ga0495595_0030161
718 Ga0500556_0000383
719 Ga0500616_0008943
720 Ga0501084_0087594
721 Ga0501084_0181082
722 Ga0501082_0013680
723 Ga0466962_0004543
724 Ga0466962_0053754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

25

375

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x5h-assembly1.cif.gz_A crystal structure of metb from corynebacterium glutamicum 0.9708 22 376
3qi6-assembly1.cif.gz_B crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 0.9558 23 375
3qhx-assembly1.cif.gz_D crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes 0.955 23 375
3qi6-assembly1.cif.gz_A crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 0.9512 23 375
6ld9-assembly1.cif.gz_A crystal structure of cystathionine gamma synthase from xanthomonas oryzae pv. oryzae in complex with cystathionine 0.9503 24 376
ID Description Score Start End Superfamily
3e6gD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9594 72 262 3.40.640.10
af_Q2G120_12_246_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.954 38 265 3.40.640.10
af_A4HVY9_120_366_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9514 25 265 3.40.640.10
1pffB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9504 78 266 3.40.640.10
4kamA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9459 78 266 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A544VQ81-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9824 79 212 GO:0003962
GO:0004123
GO:0005737
GO:0008483
GO:0009086
GO:0019343
GO:0019346
GO:0030170
AF-A0A7G1I9C6-F1-model_v4 Cystathionine gamma-synthase 0.9811 79 297 GO:0003962
GO:0004123
GO:0005737
GO:0009086
GO:0019343
GO:0019346
GO:0030170
AF-A0A7I9V9A6-F1-model_v4 Putative cystathionine gamma-synthase (CGS) 0.9745 20 375 GO:0003962
GO:0004123
GO:0005737
GO:0009086
GO:0019343
GO:0019346
GO:0030170
AF-A0A0Q7NXQ8-F1-model_v4 Cystathionine gamma-synthase 0.974 20 375 GO:0003962
GO:0004123
GO:0005737
GO:0009086
GO:0019343
GO:0019346
GO:0030170
AF-A0A4P8PMZ4-F1-model_v4 Cystathionine gamma-synthase (EC 2.5.1.48) 0.973 20 375 GO:0003962
GO:0004123
GO:0005737
GO:0009086
GO:0019343
GO:0019346
GO:0030170

Map