F422503

General Info

Members Datasets Scaffolds Average Seq Length
362 212 356 72

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_102166821|Ga0070713_1021668211
Length 79
Sequence MTAAEAAEPAVVQATARSFHPDTRTGTVLLDDGTEVAYDAAAFDAGGLRMLRIGQRVRMAVAADGRITALTLVTLPLPD

Samples

Sample ID Description Type Environment
1 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
2 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
3 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
4 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
75 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
76 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
187 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
188 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
189 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
198 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
199 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
202 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
203 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
206 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
212 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0.83
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0
Rhizoplane 1.1
Rhizosphere 85.08
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10172176 3300002067 Bacteria 626
2 JGI24738J21930_10155588 3300002075 Bacteria 510
3 rootH2_10052506 3300003320 Bacteria 4866
4 Ga0006562J51391_1042851 3300003578 Bacteria 950
5 Ga0070658_10360966 3300005327 Bacteria 1244
6 Ga0070660_101641336 3300005339 Bacteria 547
7 Ga0070713_102166821 3300005436 Bacteria 539
8 Ga0070678_102045398 3300005456 Bacteria 542
9 Ga0070685_10024886 3300005466 Bacteria 3292
10 Ga0068853_100020110 3300005539 Bacteria 5550
11 Ga0068853_100031220 3300005539 Bacteria 4505
12 Ga0070665_100021142 3300005548 Bacteria 6542
13 Ga0070665_100064066 3300005548 Bacteria 3686
14 Ga0068855_100081097 3300005563 Bacteria 3761
15 Ga0068854_100025414 3300005578 Bacteria 4063
16 Ga0068856_100210237 3300005614 Bacteria 1961
17 Ga0068852_100069348 3300005616 Bacteria 3090
18 Ga0081455_10037912 3300005937 Bacteria 4271
19 Ga0075428_100016824 3300006844 Bacteria 8075
20 Ga0075430_100365369 3300006846 Bacteria 1191
21 Ga0075431_100059569 3300006847 Bacteria 3940
22 Ga0075429_100006522 3300006880 Bacteria 10107
23 Ga0105251_10379163 3300009011 Bacteria 648
24 Ga0105250_10568290 3300009092 Bacteria 522
25 Ga0105240_10030692 3300009093 Bacteria 6982
26 Ga0105245_10468926 3300009098 Bacteria 1270
27 Ga0114129_10437701 3300009147 Bacteria 1717
28 Ga0114129_12328390 3300009147 Bacteria 642
29 Ga0105241_10001932 3300009174 Bacteria 15679
30 Ga0105241_12200131 3300009174 Bacteria 547
31 Ga0105242_12937479 3300009176 Bacteria 527
32 Ga0105237_10051961 3300009545 Bacteria 4116
33 Ga0105238_10031618 3300009551 Bacteria 5388
34 Ga0105238_12324049 3300009551 Unclassified 571
35 Ga0105239_10136173 3300010375 Bacteria 2734
36 Ga0105239_11456679 3300010375 Bacteria 791
37 Ga0105239_11613225 3300010375 Bacteria 750
38 Ga0105246_10072736 3300011119 Bacteria 2424
39 Ga0157374_10219806 3300013296 Bacteria 1864
40 Ga0157378_13009618 3300013297 Bacteria 523
41 Ga0157372_10876882 3300013307 Bacteria 1041
42 Ga0157372_11066139 3300013307 Bacteria 935
43 Ga0157375_11563581 3300013308 Bacteria 779
44 Ga0157377_10988445 3300014745 Bacteria 636
45 Ga0206353_11658457 3300020082 Bacteria 613
46 Ga0213875_10025192 3300021388 Bacteria 2835
47 Ga0224712_10659677 3300022467 Bacteria 513
48 Ga0207426_1163673 3300025302 Bacteria 507
49 Ga0207647_10001499 3300025904 Bacteria 17946
50 Ga0207705_11370323 3300025909 Bacteria 538
51 Ga0207654_10004974 3300025911 Bacteria 6721
52 Ga0207695_10000324 3300025913 Bacteria 114066
53 Ga0207671_10000133 3300025914 Bacteria 114011
54 Ga0207663_11655162 3300025916 Unclassified 515
55 Ga0207694_10000161 3300025924 Bacteria 68691
56 Ga0207700_10472084 3300025928 Bacteria 1108
57 Ga0207644_11635985 3300025931 Bacteria 540
58 Ga0207667_10075050 3300025949 Bacteria 3511
59 Ga0207640_10026573 3300025981 Bacteria 3516
60 Ga0207639_10064253 3300026041 Bacteria 2845
61 Ga0207678_11451924 3300026067 Bacteria 606
62 Ga0207702_10911029 3300026078 Bacteria 871
63 Ga0207674_11733307 3300026116 Bacteria 592
64 Ga0207698_10070024 3300026142 Bacteria 2777
65 Ga0268266_10034256 3300028379 Bacteria 4319
66 Ga0268266_10147424 3300028379 Bacteria 2117
67 Ga0268266_12007192 3300028379 Bacteria 552
68 Ga0307517_10000616 3300028786 Bacteria 60799
69 Ga0307515_10262260 3300028794 Bacteria 1462
70 Ga0307511_10107751 3300030521 Bacteria 1792
71 Ga0307511_10117365 3300030521 Bacteria 1663
72 Ga0307513_10035186 3300031456 Bacteria 5608
73 Ga0307509_10077065 3300031507 Bacteria 3457
74 Ga0307509_10941555 3300031507 Bacteria 529
75 Ga0307508_10034575 3300031616 Bacteria 4556
76 Ga0307508_10043316 3300031616 Bacteria 4033
77 Ga0307508_10457442 3300031616 Bacteria 869
78 Ga0307514_10052507 3300031649 Bacteria 3151
79 Ga0307514_10064722 3300031649 Bacteria 2772
80 Ga0307514_10211567 3300031649 Bacteria 1203
81 Ga0307516_10384574 3300031730 Bacteria 1064
82 Ga0307507_10057733 3300033179 Bacteria 3652
83 Ga0307507_10242841 3300033179 Bacteria 1176
84 Ga0307507_10648684 3300033179 Bacteria 536
85 Ga0307510_10516801 3300033180 Bacteria 638
86 Ga0395899_0009287 3300037312 Bacteria 7551
87 Ga0436364_1308106 3300037853 Bacteria 24961
88 Ga0451795_0218248 3300041456 Bacteria 620
89 Ga0451800_0204734 3300041459 Bacteria 561
90 Ga0451807_1465630 3300041486 Bacteria 837
91 Ga0439449_0178683 3300042007 Bacteria 793
92 Ga0466969_0004236 3300044656 Bacteria 7625
93 Ga0466969_0058995 3300044656 Bacteria 1866
94 Ga0466965_0158237 3300044683 Bacteria 1187
95 Ga0466966_0042308 3300044684 Bacteria 2924
96 Ga0466961_0013639 3300044693 Bacteria 5207
97 Ga0466961_0020409 3300044693 Bacteria 4261
98 Ga0466961_0299415 3300044693 Bacteria 982
99 Ga0466963_0173980 3300044694 Bacteria 1502
100 Ga0466964_0121710 3300044706 Bacteria 1177
101 Ga0466971_0000945 3300044719 Bacteria 11907
102 Ga0466970_0010606 3300044765 Bacteria 4679
103 Ga0466959_0005269 3300045049 Bacteria 8832
104 Ga0466959_0232237 3300045049 Bacteria 1276
105 Ga0466958_0180087 3300045836 Bacteria 1341
106 Ga0466958_0809513 3300045836 Bacteria 611
107 Ga0495627_067662 3300046453 Bacteria 1047
108 Ga0495592_0003261 3300046454 Bacteria 11634
109 Ga0495592_0020580 3300046454 Bacteria 5021
110 Ga0495592_0057304 3300046454 Bacteria 2876
111 Ga0495603_0131632 3300046455 Bacteria 1456
112 Ga0495590_0338393 3300046457 Bacteria 570
113 Ga0495629_0005722 3300046459 Bacteria 9276
114 Ga0495629_0014245 3300046459 Bacteria 5727
115 Ga0495629_0104734 3300046459 Bacteria 1973
116 Ga0495629_0192535 3300046459 Bacteria 1411
117 Ga0495638_0158390 3300046460 Bacteria 1308
118 Ga0495651_0000763 3300046462 Bacteria 24919
119 Ga0495651_0002231 3300046462 Bacteria 14956
120 Ga0495651_0021118 3300046462 Bacteria 5057
121 Ga0495653_0128521 3300046463 Bacteria 1797
122 Ga0495582_0021658 3300046473 Bacteria 3517
123 Ga0495639_0619830 3300046475 Bacteria 557
124 Ga0495662_0000655 3300046476 Bacteria 16257
125 Ga0495664_0000321 3300046477 Bacteria 23117
126 Ga0495664_0012448 3300046477 Bacteria 4819
127 Ga0495585_0007110 3300046492 Bacteria 6878
128 Ga0495585_0247294 3300046492 Bacteria 891
129 Ga0495594_0029064 3300046499 Bacteria 2986
130 Ga0495594_0208835 3300046499 Bacteria 1113
131 Ga0495594_0293472 3300046499 Bacteria 926
132 Ga0495594_0397279 3300046499 Bacteria 784
133 Ga0495607_0414666 3300046501 Bacteria 610
134 Ga0495618_0024934 3300046514 Bacteria 3709
135 Ga0495618_0239653 3300046514 Bacteria 1140
136 Ga0495628_0003092 3300046516 Bacteria 14920
137 Ga0495628_0040022 3300046516 Bacteria 3747
138 Ga0495628_0051496 3300046516 Bacteria 3255
139 Ga0495630_0038011 3300046517 Bacteria 3599
140 Ga0495632_0036847 3300046519 Bacteria 2486
141 Ga0495637_0261983 3300046520 Bacteria 620
142 Ga0495643_0001559 3300046522 Bacteria 20433
143 Ga0495666_0019331 3300046526 Bacteria 3382
144 Ga0495666_0150930 3300046526 Bacteria 1080
145 Ga0495652_0001972 3300046529 Bacteria 21850
146 Ga0495652_0012664 3300046529 Bacteria 7597
147 Ga0495652_0058927 3300046529 Bacteria 3250
148 Ga0495640_0004288 3300046533 Bacteria 11384
149 Ga0495640_0023555 3300046533 Bacteria 4482
150 Ga0495640_0095060 3300046533 Bacteria 1962
151 Ga0495586_0028721 3300046535 Bacteria 2976
152 Ga0495587_0002686 3300046536 Bacteria 11874
153 Ga0495587_0198558 3300046536 Bacteria 1135
154 Ga0495645_0010267 3300046543 Bacteria 6564
155 Ga0495645_0014588 3300046543 Bacteria 5578
156 Ga0495622_0009290 3300046557 Bacteria 4550
157 Ga0495622_0078564 3300046557 Bacteria 1519
158 Ga0495633_0062531 3300046558 Bacteria 1743
159 Ga0495667_0077875 3300046559 Bacteria 2156
160 Ga0495667_0504641 3300046559 Bacteria 758
161 Ga0495634_0001805 3300046642 Bacteria 18484
162 Ga0495634_0001949 3300046642 Bacteria 17626
163 Ga0495635_0002591 3300046663 Bacteria 12376
164 Ga0495588_0023199 3300046674 Bacteria 3071
165 Ga0495657_0003132 3300046675 Bacteria 13662
166 Ga0495657_0003783 3300046675 Bacteria 12244
167 Ga0495657_0246843 3300046675 Bacteria 1076
168 Ga0495623_0010102 3300046679 Bacteria 6110
169 Ga0495646_0000324 3300046680 Bacteria 24548
170 Ga0495646_0160281 3300046680 Bacteria 1246
171 Ga0495658_0012582 3300046683 Bacteria 4291
172 Ga0495658_0053996 3300046683 Bacteria 2284
173 Ga0495613_0000764 3300046689 Bacteria 25140
174 Ga0495613_0007476 3300046689 Bacteria 8138
175 Ga0495624_0057205 3300046690 Bacteria 2452
176 Ga0495624_0491816 3300046690 Bacteria 734
177 Ga0495589_0221298 3300046794 Bacteria 889
178 Ga0495600_0013455 3300046809 Bacteria 5141
179 Ga0495600_0024015 3300046809 Bacteria 3924
180 Ga0495600_0134630 3300046809 Bacteria 1605
181 Ga0495660_0044817 3300046810 Bacteria 2431
182 Ga0495581_0003747 3300047315 Bacteria 8754
183 Ga0495581_0189390 3300047315 Bacteria 1203
184 Ga0495604_0002587 3300047317 Bacteria 14490
185 Ga0495604_0005659 3300047317 Bacteria 9911
186 Ga0495604_0009237 3300047317 Bacteria 7806
187 Ga0495604_0061485 3300047317 Bacteria 2873
188 Ga0495604_0101019 3300047317 Bacteria 2119
189 Ga0495674_0064959 3300047319 Bacteria 3171
190 Ga0495676_0001601 3300047321 Bacteria 19648
191 Ga0495676_0016760 3300047321 Bacteria 6489
192 Ga0495683_0087122 3300047323 Bacteria 1517
193 Ga0495687_052574 3300047443 Bacteria 1721
194 Ga0495687_176892 3300047443 Bacteria 700
195 Ga0495675_0011158 3300047444 Bacteria 5635
196 Ga0495675_0039744 3300047444 Bacteria 2997
197 Ga0495675_0166594 3300047444 Bacteria 1355
198 Ga0495685_000247 3300047447 Bacteria 18692
199 Ga0495685_045921 3300047447 Bacteria 1487
200 Ga0495681_0000245 3300047470 Bacteria 45204
201 Ga0495684_0066920 3300047471 Bacteria 2732
202 Ga0495684_0786460 3300047471 Bacteria 623
203 Ga0495686_0129211 3300047472 Bacteria 1499
204 Ga0495593_0000138 3300047673 Bacteria 35243
205 Ga0495602_0025051 3300048088 Bacteria 5781
206 Ga0495614_0006346 3300048089 Bacteria 5313
207 Ga0495626_0425989 3300048091 Bacteria 511
208 Ga0496102_1110018 3300048905 Bacteria 711
209 Ga0501031_0064707 3300049568 Bacteria 2382
210 Ga0501031_0165661 3300049568 Bacteria 1445
211 Ga0501031_0226134 3300049568 Bacteria 1218
212 Ga0501031_0398317 3300049568 Bacteria 890
213 Ga0501032_0001172 3300049569 Bacteria 21019
214 Ga0501032_0007053 3300049569 Bacteria 8245
215 Ga0501032_0046104 3300049569 Bacteria 2946
216 Ga0501032_0053541 3300049569 Bacteria 2717
217 Ga0501032_0267690 3300049569 Bacteria 1107
218 Ga0501033_0002969 3300049570 Bacteria 14167
219 Ga0501033_0057326 3300049570 Bacteria 2879
220 Ga0501033_0067071 3300049570 Bacteria 2638
221 Ga0501033_0112251 3300049570 Bacteria 1983
222 Ga0501033_0223483 3300049570 Bacteria 1339
223 Ga0501034_0034144 3300049571 Bacteria 5157
224 Ga0501034_0038143 3300049571 Bacteria 4866
225 Ga0501034_0227905 3300049571 Bacteria 1813
226 Ga0501034_0362512 3300049571 Bacteria 1376
227 Ga0501034_0515996 3300049571 Bacteria 1107
228 Ga0501036_0007336 3300049572 Bacteria 8982
229 Ga0501036_0010662 3300049572 Bacteria 7594
230 Ga0501036_0018612 3300049572 Bacteria 5823
231 Ga0501036_0058793 3300049572 Bacteria 3257
232 Ga0501036_0325850 3300049572 Bacteria 1283
233 Ga0501036_0782298 3300049572 Bacteria 786
234 Ga0501036_1146357 3300049572 Bacteria 634
235 Ga0501036_1675781 3300049572 Bacteria 513
236 Ga0501037_0003263 3300049573 Bacteria 11775
237 Ga0501037_0070700 3300049573 Bacteria 2539
238 Ga0501037_0124770 3300049573 Bacteria 1849
239 Ga0501037_0226324 3300049573 Bacteria 1314
240 Ga0501037_0530212 3300049573 Bacteria 796
241 Ga0501037_0796224 3300049573 Bacteria 624
242 Ga0501038_0001438 3300049574 Bacteria 21853
243 Ga0501038_0003478 3300049574 Bacteria 14664
244 Ga0501038_0033094 3300049574 Bacteria 4554
245 Ga0501038_0051642 3300049574 Bacteria 3547
246 Ga0501038_0052118 3300049574 Bacteria 3528
247 Ga0501038_0206690 3300049574 Bacteria 1573
248 Ga0501039_0003832 3300049575 Bacteria 11293
249 Ga0501039_0007671 3300049575 Bacteria 8238
250 Ga0501039_0620076 3300049575 Bacteria 847
251 Ga0501039_1289912 3300049575 Bacteria 564
252 Ga0501040_0017680 3300049576 Bacteria 4732
253 Ga0501041_0004467 3300049577 Bacteria 8100
254 Ga0501042_0003791 3300049578 Bacteria 9558
255 Ga0501042_0161594 3300049578 Bacteria 1616
256 Ga0501043_0004177 3300049579 Bacteria 11803
257 Ga0501043_0008848 3300049579 Bacteria 7922
258 Ga0501043_0087439 3300049579 Bacteria 2449
259 Ga0501043_0253718 3300049579 Bacteria 1354
260 Ga0501043_1311448 3300049579 Bacteria 505
261 Ga0501046_0009632 3300049580 Bacteria 8329
262 Ga0501046_0248983 3300049580 Bacteria 1308
263 Ga0501046_0876403 3300049580 Bacteria 627
264 Ga0501047_0000029 3300049581 Bacteria 218396
265 Ga0501047_0000880 3300049581 Bacteria 30670
266 Ga0501047_0025316 3300049581 Bacteria 5703
267 Ga0501047_0078693 3300049581 Bacteria 3170
268 Ga0501047_0103062 3300049581 Bacteria 2733
269 Ga0501047_0110515 3300049581 Bacteria 2631
270 Ga0501047_0223004 3300049581 Bacteria 1741
271 Ga0501047_0249294 3300049581 Bacteria 1624
272 Ga0501047_0650634 3300049581 Bacteria 873
273 Ga0501048_0000605 3300049582 Bacteria 25519
274 Ga0501048_0095913 3300049582 Bacteria 2092
275 Ga0501067_0001602 3300049583 Bacteria 12400
276 Ga0501068_0007264 3300049584 Bacteria 6136
277 Ga0501069_0017456 3300049585 Bacteria 3862
278 Ga0501069_0458954 3300049585 Bacteria 758
279 Ga0501070_0003159 3300049586 Bacteria 14330
280 Ga0501070_0007711 3300049586 Bacteria 9124
281 Ga0501070_0106437 3300049586 Bacteria 2318
282 Ga0501070_0313232 3300049586 Bacteria 1277
283 Ga0501070_1322223 3300049586 Bacteria 550
284 Ga0501071_0139117 3300049587 Bacteria 1807
285 Ga0501072_0009913 3300049588 Bacteria 7243
286 Ga0501073_0019115 3300049589 Bacteria 4949
287 Ga0501074_0004536 3300049590 Bacteria 9939
288 Ga0501076_0609748 3300049592 Bacteria 900
289 Ga0501077_0003467 3300049593 Bacteria 9471
290 Ga0501079_0003829 3300049741 Bacteria 11117
291 Ga0501080_0032888 3300049742 Bacteria 4839
292 Ga0501080_0207713 3300049742 Bacteria 1795
293 Ga0501083_0001220 3300049744 Bacteria 17413
294 Ga0501083_0744334 3300049744 Bacteria 638
295 Ga0501035_0001220 3300049822 Bacteria 26803
296 Ga0501035_0019092 3300049822 Bacteria 6310
297 Ga0501035_0035183 3300049822 Bacteria 4546
298 Ga0501035_0213433 3300049822 Bacteria 1650
299 Ga0501035_0435631 3300049822 Bacteria 1086
300 Ga0501035_0529806 3300049822 Bacteria 967
301 Ga0501035_1052648 3300049822 Bacteria 637
302 Ga0501035_1121383 3300049822 Bacteria 613
303 Ga0501044_0001475 3300049823 Bacteria 27586
304 Ga0501044_0067583 3300049823 Bacteria 3641
305 Ga0501044_0074425 3300049823 Bacteria 3451
306 Ga0501044_0107871 3300049823 Bacteria 2795
307 Ga0501044_0108656 3300049823 Bacteria 2783
308 Ga0501044_0186838 3300049823 Bacteria 2036
309 Ga0501044_0249689 3300049823 Bacteria 1715
310 Ga0501044_0426016 3300049823 Bacteria 1236
311 Ga0501044_0442934 3300049823 Bacteria 1206
312 Ga0501044_0865370 3300049823 Bacteria 780
313 Ga0501045_0014208 3300049824 Bacteria 5640
314 Ga0501045_0092145 3300049824 Bacteria 2241
315 Ga0501045_0096265 3300049824 Bacteria 2190
316 nmdc:mga05p37_1966626_c1 3300050507 Bacteria 555
317 nmdc:mga05p37_4429_c1 3300050507 Bacteria 16411
318 nmdc:mga09592_519089_c1 3300050508 Unclassified 1025
319 nmdc:mga0qj67_13876_c1 3300050509 Bacteria 6083
320 nmdc:mga06r32_65053_c1 3300050510 Bacteria 3517
321 Ga0495601_0093977 3300053077 Bacteria 1932
322 Ga0495601_0338110 3300053077 Bacteria 979
323 Ga0495612_0143568 3300053078 Bacteria 1036
324 Ga0495655_0002515 3300053083 Bacteria 2921
325 Ga0495655_0305111 3300053083 Bacteria 548
326 Ga0495619_0040391 3300053085 Bacteria 3050
327 Ga0495619_1014034 3300053085 Bacteria 555
328 Ga0500578_0026331 3300053086 Bacteria 3731
329 Ga0500583_0281824 3300053092 Bacteria 816
330 Ga0500640_004306 3300053095 Bacteria 5151
331 Ga0500560_052704 3300053107 Bacteria 1309
332 Ga0500572_169246 3300053111 Bacteria 715
333 Ga0500614_236352 3300053123 Bacteria 568
334 Ga0500618_026201 3300053125 Bacteria 1393
335 Ga0500628_002591 3300053129 Bacteria 2983
336 Ga0500652_055184 3300053131 Bacteria 1627
337 Ga0500658_0001595 3300053134 Bacteria 9060
338 Ga0500561_0280863 3300053137 Bacteria 530
339 Ga0500573_0018017 3300053140 Bacteria 4024
340 Ga0500573_0021778 3300053140 Bacteria 3677
341 Ga0500573_0182497 3300053140 Bacteria 1127
342 Ga0500573_0522612 3300053140 Bacteria 531
343 Ga0500579_101266 3300053143 Bacteria 1500
344 Ga0500588_0023049 3300053146 Bacteria 1702
345 Ga0500600_0004486 3300053149 Bacteria 8205
346 Ga0500616_0019358 3300053153 Bacteria 3838
347 Ga0500624_001381 3300053157 Bacteria 4048
348 Ga0500633_0000206 3300053160 Bacteria 8321
349 Ga0500634_0024115 3300053161 Bacteria 3309
350 Ga0500636_0144392 3300053177 Bacteria 1314
351 Ga0500656_000060 3300053732 Bacteria 6255
352 Ga0500587_001861 3300053739 Bacteria 3006
353 Ga0501084_0135237 3300054114 Bacteria 2075
354 Ga0501082_0003043 3300060353 Bacteria 14648
355 Ga0466962_0007554 3300061719 Bacteria 5216
356 Ga0530510_1162425 3300061734 Bacteria 591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10360966 Ga0070658_103609662 63
2 3300005456 Ga0070678_102045398 Ga0070678_1020453982 63
3 3300005539 Ga0068853_100031220 Ga0068853_1000312204 63
4 3300005548 Ga0070665_100021142 Ga0070665_1000211427 63
5 3300005563 Ga0068855_100081097 Ga0068855_1000810975 63
6 3300005578 Ga0068854_100025414 Ga0068854_1000254142 63
7 3300005616 Ga0068852_100069348 Ga0068852_1000693483 63
8 3300009093 Ga0105240_10030692 Ga0105240_100306925 63
9 3300009174 Ga0105241_10001932 Ga0105241_100019329 63
10 3300009545 Ga0105237_10051961 Ga0105237_100519615 63
11 3300009551 Ga0105238_10031618 Ga0105238_100316184 63
12 3300010375 Ga0105239_10136173 Ga0105239_101361734 63
13 3300013296 Ga0157374_10219806 Ga0157374_102198064 63
14 3300013307 Ga0157372_11066139 Ga0157372_110661392 63
15 3300014745 Ga0157377_10988445 Ga0157377_109884452 63
16 3300020082 Ga0206353_11658457 Ga0206353_116584572 63
17 3300022467 Ga0224712_10659677 Ga0224712_106596772 63
18 3300025904 Ga0207647_10001499 Ga0207647_100014994 63
19 3300025909 Ga0207705_11370323 Ga0207705_113703232 63
20 3300025911 Ga0207654_10004974 Ga0207654_100049747 63
21 3300025913 Ga0207695_10000324 Ga0207695_1000032449 63
22 3300025914 Ga0207671_10000133 Ga0207671_1000013361 63
23 3300025924 Ga0207694_10000161 Ga0207694_1000016149 63
24 3300025949 Ga0207667_10075050 Ga0207667_100750504 63
25 3300025981 Ga0207640_10026573 Ga0207640_100265731 63
26 3300026041 Ga0207639_10064253 Ga0207639_100642534 63
27 3300026078 Ga0207702_10911029 Ga0207702_109110292 63
28 3300026142 Ga0207698_10070024 Ga0207698_100700243 63
29 3300028379 Ga0268266_10147424 Ga0268266_101474242 63
30 3300033179 Ga0307507_10242841 Ga0307507_102428412 63
31 3300044656 Ga0466969_0058995 Ga0466969_0058995_163_381 63
32 3300044693 Ga0466961_0299415 Ga0466961_0299415_309_527 63
33 3300044765 Ga0466970_0010606 Ga0466970_0010606_1960_2178 63
34 3300045049 Ga0466959_0232237 Ga0466959_0232237_994_1212 63
35 3300045836 Ga0466958_0180087 Ga0466958_0180087_62_280 63
36 3300046454 Ga0495592_0057304 Ga0495592_0057304_1998_2231 63
37 3300046462 Ga0495651_0000763 Ga0495651_0000763_15464_15697 63
38 3300046516 Ga0495628_0003092 Ga0495628_0003092_5920_6153 63
39 3300046529 Ga0495652_0001972 Ga0495652_0001972_19065_19298 63
40 3300046536 Ga0495587_0198558 Ga0495587_0198558_91_324 63
41 3300046543 Ga0495645_0014588 Ga0495645_0014588_902_1135 63
42 3300046557 Ga0495622_0009290 Ga0495622_0009290_4117_4350 63
43 3300046675 Ga0495657_0246843 Ga0495657_0246843_31_264 63
44 3300046680 Ga0495646_0160281 Ga0495646_0160281_807_1040 63
45 3300046809 Ga0495600_0134630 Ga0495600_0134630_65_298 63
46 3300047317 Ga0495604_0101019 Ga0495604_0101019_1250_1483 63
47 3300047471 Ga0495684_0786460 Ga0495684_0786460_257_490 63
48 3300053077 Ga0495601_0093977 Ga0495601_0093977_444_677 63
49 3300053085 Ga0495619_1014034 Ga0495619_1014034_252_485 63
50 iso_pu_bacteria 2643221631 2644176385 63
51 iso_pu_bacteria 2818991472 2819740516 63
52 iso_pu_bacteria 2935390628 2935392083 63
53 iso_pu_bacteria 3006321560 3006324815 63
54 iso_pu_bacteria 8025478263 8025481126 63
55 iso_pu_bacteria 8056447290 8056450039 63
56 3300005436 Ga0070713_102166821 Ga0070713_1021668211 64
57 3300006844 Ga0075428_100016824 Ga0075428_1000168249 64
58 3300006846 Ga0075430_100365369 Ga0075430_1003653692 64
59 3300006847 Ga0075431_100059569 Ga0075431_1000595696 64
60 3300006880 Ga0075429_100006522 Ga0075429_1000065227 64
61 3300009147 Ga0114129_10437701 Ga0114129_104377012 64
62 3300009551 Ga0105238_12324049 Ga0105238_123240492 64
63 3300010375 Ga0105239_11613225 Ga0105239_116132251 64
64 3300013308 Ga0157375_11563581 Ga0157375_115635812 64
65 3300025916 Ga0207663_11655162 Ga0207663_116551622 64
66 3300025928 Ga0207700_10472084 Ga0207700_104720842 64
67 3300025931 Ga0207644_11635985 Ga0207644_116359851 64
68 3300028379 Ga0268266_12007192 Ga0268266_120071921 64
69 3300044693 Ga0466961_0013639 Ga0466961_0013639_2848_3066 64
70 3300044694 Ga0466963_0173980 Ga0466963_0173980_1202_1417 64
71 3300045836 Ga0466958_0809513 Ga0466958_0809513_65_298 64
72 3300050507 nmdc:mga05p37_4429_c1 nmdc:mga05p37_4429_c1_8864_9070 64
73 3300050508 nmdc:mga09592_519089_c1 nmdc:mga09592_519089_c1_123_329 64
74 3300050509 nmdc:mga0qj67_13876_c1 nmdc:mga0qj67_13876_c1_5508_5714 64
75 3300050510 nmdc:mga06r32_65053_c1 nmdc:mga06r32_65053_c1_1154_1360 64
76 3300053077 Ga0495601_0338110 Ga0495601_0338110_682_900 64
77 3300053140 Ga0500573_0021778 Ga0500573_0021778_3190_3402 64
78 3300009147 Ga0114129_12328390 Ga0114129_123283902 65
79 3300050507 nmdc:mga05p37_1966626_c1 nmdc:mga05p37_1966626_c1_139_345 65
80 3300037312 Ga0395899_0009287 Ga0395899_0009287_2689_2889 66
81 3300002067 JGI24735J21928_10172176 JGI24735J21928_101721762 67
82 3300002075 JGI24738J21930_10155588 JGI24738J21930_101555881 67
83 3300003320 rootH2_10052506 rootH2_100525065 67
84 3300003578 Ga0006562J51391_1042851 Ga0006562J51391_10428512 67
85 3300005339 Ga0070660_101641336 Ga0070660_1016413362 67
86 3300005466 Ga0070685_10024886 Ga0070685_100248865 67
87 3300005539 Ga0068853_100020110 Ga0068853_1000201104 67
88 3300005548 Ga0070665_100064066 Ga0070665_1000640663 67
89 3300005614 Ga0068856_100210237 Ga0068856_1002102372 67
90 3300005937 Ga0081455_10037912 Ga0081455_100379122 67
91 3300009011 Ga0105251_10379163 Ga0105251_103791632 67
92 3300009092 Ga0105250_10568290 Ga0105250_105682902 67
93 3300009098 Ga0105245_10468926 Ga0105245_104689263 67
94 3300009174 Ga0105241_12200131 Ga0105241_122001312 67
95 3300009176 Ga0105242_12937479 Ga0105242_129374791 67
96 3300010375 Ga0105239_11456679 Ga0105239_114566791 67
97 3300011119 Ga0105246_10072736 Ga0105246_100727362 67
98 3300013297 Ga0157378_13009618 Ga0157378_130096182 67
99 3300013307 Ga0157372_10876882 Ga0157372_108768822 67
100 3300021388 Ga0213875_10025192 Ga0213875_100251922 67
101 3300025302 Ga0207426_1163673 Ga0207426_11636731 67
102 3300026067 Ga0207678_11451924 Ga0207678_114519242 67
103 3300026116 Ga0207674_11733307 Ga0207674_117333072 67
104 3300028379 Ga0268266_10034256 Ga0268266_100342563 67
105 3300028786 Ga0307517_10000616 Ga0307517_1000061637 67
106 3300028794 Ga0307515_10262260 Ga0307515_102622602 67
107 3300030521 Ga0307511_10107751 Ga0307511_101077513 67
108 3300030521 Ga0307511_10117365 Ga0307511_101173653 67
109 3300031456 Ga0307513_10035186 Ga0307513_100351866 67
110 3300031507 Ga0307509_10077065 Ga0307509_100770652 67
111 3300031507 Ga0307509_10941555 Ga0307509_109415551 67
112 3300031616 Ga0307508_10034575 Ga0307508_100345754 67
113 3300031616 Ga0307508_10043316 Ga0307508_100433165 67
114 3300031616 Ga0307508_10457442 Ga0307508_104574422 67
115 3300031649 Ga0307514_10052507 Ga0307514_100525073 67
116 3300031649 Ga0307514_10064722 Ga0307514_100647222 67
117 3300031649 Ga0307514_10211567 Ga0307514_102115673 67
118 3300031730 Ga0307516_10384574 Ga0307516_103845742 67
119 3300033179 Ga0307507_10057733 Ga0307507_100577334 67
120 3300033179 Ga0307507_10648684 Ga0307507_106486842 67
121 3300033180 Ga0307510_10516801 Ga0307510_105168012 67
122 3300037853 Ga0436364_1308106 Ga0436364_1308106_11935_12180 67
123 3300041456 Ga0451795_0218248 Ga0451795_0218248_104_307 67
124 3300041459 Ga0451800_0204734 Ga0451800_0204734_279_503 67
125 3300041486 Ga0451807_1465630 Ga0451807_1465630_319_543 67
126 3300042007 Ga0439449_0178683 Ga0439449_0178683_394_597 67
127 3300044656 Ga0466969_0004236 Ga0466969_0004236_1604_1822 67
128 3300044683 Ga0466965_0158237 Ga0466965_0158237_222_425 67
129 3300044684 Ga0466966_0042308 Ga0466966_0042308_57_275 67
130 3300044693 Ga0466961_0020409 Ga0466961_0020409_1584_1802 67
131 3300044706 Ga0466964_0121710 Ga0466964_0121710_186_395 67
132 3300044719 Ga0466971_0000945 Ga0466971_0000945_4103_4321 67
133 3300045049 Ga0466959_0005269 Ga0466959_0005269_6915_7133 67
134 3300046453 Ga0495627_067662 Ga0495627_067662_556_774 67
135 3300046454 Ga0495592_0003261 Ga0495592_0003261_2323_2541 67
136 3300046454 Ga0495592_0020580 Ga0495592_0020580_4774_4977 67
137 3300046455 Ga0495603_0131632 Ga0495603_0131632_960_1178 67
138 3300046457 Ga0495590_0338393 Ga0495590_0338393_39_257 67
139 3300046459 Ga0495629_0005722 Ga0495629_0005722_4352_4570 67
140 3300046459 Ga0495629_0014245 Ga0495629_0014245_1227_1430 67
141 3300046459 Ga0495629_0104734 Ga0495629_0104734_1709_1927 67
142 3300046459 Ga0495629_0192535 Ga0495629_0192535_16_231 67
143 3300046460 Ga0495638_0158390 Ga0495638_0158390_170_388 67
144 3300046462 Ga0495651_0002231 Ga0495651_0002231_9847_10050 67
145 3300046462 Ga0495651_0021118 Ga0495651_0021118_972_1190 67
146 3300046463 Ga0495653_0128521 Ga0495653_0128521_1499_1702 67
147 3300046473 Ga0495582_0021658 Ga0495582_0021658_2722_2925 67
148 3300046475 Ga0495639_0619830 Ga0495639_0619830_202_405 67
149 3300046476 Ga0495662_0000655 Ga0495662_0000655_4702_4905 67
150 3300046477 Ga0495664_0000321 Ga0495664_0000321_9466_9669 67
151 3300046477 Ga0495664_0012448 Ga0495664_0012448_395_613 67
152 3300046492 Ga0495585_0007110 Ga0495585_0007110_2440_2658 67
153 3300046492 Ga0495585_0247294 Ga0495585_0247294_41_259 67
154 3300046499 Ga0495594_0029064 Ga0495594_0029064_2487_2705 67
155 3300046499 Ga0495594_0208835 Ga0495594_0208835_882_1100 67
156 3300046499 Ga0495594_0293472 Ga0495594_0293472_520_747 67
157 3300046499 Ga0495594_0397279 Ga0495594_0397279_242_460 67
158 3300046501 Ga0495607_0414666 Ga0495607_0414666_54_272 67
159 3300046514 Ga0495618_0024934 Ga0495618_0024934_3437_3640 67
160 3300046514 Ga0495618_0239653 Ga0495618_0239653_139_357 67
161 3300046516 Ga0495628_0040022 Ga0495628_0040022_3149_3367 67
162 3300046516 Ga0495628_0051496 Ga0495628_0051496_2396_2599 67
163 3300046517 Ga0495630_0038011 Ga0495630_0038011_641_844 67
164 3300046519 Ga0495632_0036847 Ga0495632_0036847_2142_2360 67
165 3300046520 Ga0495637_0261983 Ga0495637_0261983_272_490 67
166 3300046522 Ga0495643_0001559 Ga0495643_0001559_6206_6424 67
167 3300046526 Ga0495666_0019331 Ga0495666_0019331_1229_1432 67
168 3300046526 Ga0495666_0150930 Ga0495666_0150930_614_832 67
169 3300046529 Ga0495652_0012664 Ga0495652_0012664_5090_5293 67
170 3300046529 Ga0495652_0058927 Ga0495652_0058927_133_351 67
171 3300046533 Ga0495640_0004288 Ga0495640_0004288_1818_2036 67
172 3300046533 Ga0495640_0023555 Ga0495640_0023555_947_1165 67
173 3300046533 Ga0495640_0095060 Ga0495640_0095060_657_860 67
174 3300046535 Ga0495586_0028721 Ga0495586_0028721_1980_2183 67
175 3300046536 Ga0495587_0002686 Ga0495587_0002686_5991_6194 67
176 3300046543 Ga0495645_0010267 Ga0495645_0010267_4703_4906 67
177 3300046557 Ga0495622_0078564 Ga0495622_0078564_1260_1463 67
178 3300046558 Ga0495633_0062531 Ga0495633_0062531_1441_1659 67
179 3300046559 Ga0495667_0077875 Ga0495667_0077875_223_426 67
180 3300046559 Ga0495667_0504641 Ga0495667_0504641_461_679 67
181 3300046642 Ga0495634_0001805 Ga0495634_0001805_15659_15862 67
182 3300046642 Ga0495634_0001949 Ga0495634_0001949_2493_2711 67
183 3300046663 Ga0495635_0002591 Ga0495635_0002591_6797_7000 67
184 3300046674 Ga0495588_0023199 Ga0495588_0023199_1543_1761 67
185 3300046675 Ga0495657_0003132 Ga0495657_0003132_8714_8932 67
186 3300046675 Ga0495657_0003783 Ga0495657_0003783_2564_2767 67
187 3300046679 Ga0495623_0010102 Ga0495623_0010102_4806_5045 67
188 3300046680 Ga0495646_0000324 Ga0495646_0000324_6012_6215 67
189 3300046683 Ga0495658_0012582 Ga0495658_0012582_880_1083 67
190 3300046683 Ga0495658_0053996 Ga0495658_0053996_1296_1514 67
191 3300046689 Ga0495613_0000764 Ga0495613_0000764_18906_19109 67
192 3300046689 Ga0495613_0007476 Ga0495613_0007476_1601_1819 67
193 3300046690 Ga0495624_0057205 Ga0495624_0057205_2015_2233 67
194 3300046690 Ga0495624_0491816 Ga0495624_0491816_244_447 67
195 3300046794 Ga0495589_0221298 Ga0495589_0221298_175_393 67
196 3300046809 Ga0495600_0013455 Ga0495600_0013455_4327_4545 67
197 3300046809 Ga0495600_0024015 Ga0495600_0024015_2623_2826 67
198 3300046810 Ga0495660_0044817 Ga0495660_0044817_501_719 67
199 3300047315 Ga0495581_0003747 Ga0495581_0003747_4764_4967 67
200 3300047315 Ga0495581_0189390 Ga0495581_0189390_652_870 67
201 3300047317 Ga0495604_0002587 Ga0495604_0002587_4765_4968 67
202 3300047317 Ga0495604_0005659 Ga0495604_0005659_471_689 67
203 3300047317 Ga0495604_0009237 Ga0495604_0009237_6311_6550 67
204 3300047317 Ga0495604_0061485 Ga0495604_0061485_715_933 67
205 3300047319 Ga0495674_0064959 Ga0495674_0064959_2928_3131 67
206 3300047321 Ga0495676_0001601 Ga0495676_0001601_5627_5845 67
207 3300047321 Ga0495676_0016760 Ga0495676_0016760_296_499 67
208 3300047323 Ga0495683_0087122 Ga0495683_0087122_170_388 67
209 3300047443 Ga0495687_052574 Ga0495687_052574_63_281 67
210 3300047443 Ga0495687_176892 Ga0495687_176892_50_268 67
211 3300047444 Ga0495675_0011158 Ga0495675_0011158_1472_1711 67
212 3300047444 Ga0495675_0039744 Ga0495675_0039744_167_370 67
213 3300047444 Ga0495675_0166594 Ga0495675_0166594_220_438 67
214 3300047447 Ga0495685_000247 Ga0495685_000247_6308_6526 67
215 3300047447 Ga0495685_045921 Ga0495685_045921_270_488 67
216 3300047470 Ga0495681_0000245 Ga0495681_0000245_34615_34833 67
217 3300047471 Ga0495684_0066920 Ga0495684_0066920_1234_1437 67
218 3300047472 Ga0495686_0129211 Ga0495686_0129211_121_339 67
219 3300047673 Ga0495593_0000138 Ga0495593_0000138_32418_32621 67
220 3300048088 Ga0495602_0025051 Ga0495602_0025051_183_386 67
221 3300048089 Ga0495614_0006346 Ga0495614_0006346_1722_1925 67
222 3300048091 Ga0495626_0425989 Ga0495626_0425989_273_491 67
223 3300048905 Ga0496102_1110018 Ga0496102_1110018_254_490 67
224 3300049568 Ga0501031_0064707 Ga0501031_0064707_2074_2292 67
225 3300049568 Ga0501031_0165661 Ga0501031_0165661_782_985 67
226 3300049568 Ga0501031_0226134 Ga0501031_0226134_909_1127 67
227 3300049568 Ga0501031_0398317 Ga0501031_0398317_28_249 67
228 3300049569 Ga0501032_0001172 Ga0501032_0001172_10404_10625 67
229 3300049569 Ga0501032_0007053 Ga0501032_0007053_7457_7675 67
230 3300049569 Ga0501032_0046104 Ga0501032_0046104_362_565 67
231 3300049569 Ga0501032_0053541 Ga0501032_0053541_547_780 67
232 3300049569 Ga0501032_0267690 Ga0501032_0267690_452_685 67
233 3300049570 Ga0501033_0002969 Ga0501033_0002969_1518_1739 67
234 3300049570 Ga0501033_0057326 Ga0501033_0057326_592_825 67
235 3300049570 Ga0501033_0067071 Ga0501033_0067071_137_352 67
236 3300049570 Ga0501033_0112251 Ga0501033_0112251_523_741 67
237 3300049570 Ga0501033_0223483 Ga0501033_0223483_490_723 67
238 3300049571 Ga0501034_0034144 Ga0501034_0034144_3220_3438 67
239 3300049571 Ga0501034_0038143 Ga0501034_0038143_667_888 67
240 3300049571 Ga0501034_0227905 Ga0501034_0227905_129_332 67
241 3300049571 Ga0501034_0362512 Ga0501034_0362512_790_1023 67
242 3300049571 Ga0501034_0515996 Ga0501034_0515996_400_633 67
243 3300049572 Ga0501036_0007336 Ga0501036_0007336_7987_8220 67
244 3300049572 Ga0501036_0010662 Ga0501036_0010662_742_975 67
245 3300049572 Ga0501036_0018612 Ga0501036_0018612_3963_4184 67
246 3300049572 Ga0501036_0058793 Ga0501036_0058793_3009_3227 67
247 3300049572 Ga0501036_0325850 Ga0501036_0325850_738_941 67
248 3300049572 Ga0501036_0782298 Ga0501036_0782298_555_770 67
249 3300049572 Ga0501036_1146357 Ga0501036_1146357_110_313 67
250 3300049572 Ga0501036_1675781 Ga0501036_1675781_116_343 67
251 3300049573 Ga0501037_0003263 Ga0501037_0003263_10888_11109 67
252 3300049573 Ga0501037_0070700 Ga0501037_0070700_2236_2454 67
253 3300049573 Ga0501037_0124770 Ga0501037_0124770_243_476 67
254 3300049573 Ga0501037_0226324 Ga0501037_0226324_974_1177 67
255 3300049573 Ga0501037_0530212 Ga0501037_0530212_233_436 67
256 3300049573 Ga0501037_0796224 Ga0501037_0796224_176_391 67
257 3300049574 Ga0501038_0001438 Ga0501038_0001438_16577_16780 67
258 3300049574 Ga0501038_0003478 Ga0501038_0003478_10555_10776 67
259 3300049574 Ga0501038_0033094 Ga0501038_0033094_1058_1276 67
260 3300049574 Ga0501038_0051642 Ga0501038_0051642_437_652 67
261 3300049574 Ga0501038_0052118 Ga0501038_0052118_3035_3268 67
262 3300049574 Ga0501038_0206690 Ga0501038_0206690_867_1100 67
263 3300049575 Ga0501039_0003832 Ga0501039_0003832_185_406 67
264 3300049575 Ga0501039_0007671 Ga0501039_0007671_7390_7623 67
265 3300049575 Ga0501039_0620076 Ga0501039_0620076_536_769 67
266 3300049575 Ga0501039_1289912 Ga0501039_1289912_78_293 67
267 3300049576 Ga0501040_0017680 Ga0501040_0017680_2336_2557 67
268 3300049577 Ga0501041_0004467 Ga0501041_0004467_3965_4186 67
269 3300049578 Ga0501042_0003791 Ga0501042_0003791_5231_5452 67
270 3300049578 Ga0501042_0161594 Ga0501042_0161594_782_1018 67
271 3300049579 Ga0501043_0004177 Ga0501043_0004177_695_916 67
272 3300049579 Ga0501043_0008848 Ga0501043_0008848_619_852 67
273 3300049579 Ga0501043_0087439 Ga0501043_0087439_1239_1454 67
274 3300049579 Ga0501043_0253718 Ga0501043_0253718_395_598 67
275 3300049579 Ga0501043_1311448 Ga0501043_1311448_21_239 67
276 3300049580 Ga0501046_0009632 Ga0501046_0009632_667_888 67
277 3300049580 Ga0501046_0248983 Ga0501046_0248983_736_954 67
278 3300049580 Ga0501046_0876403 Ga0501046_0876403_403_606 67
279 3300049581 Ga0501047_0000029 Ga0501047_0000029_53457_53693 67
280 3300049581 Ga0501047_0000880 Ga0501047_0000880_5161_5382 67
281 3300049581 Ga0501047_0025316 Ga0501047_0025316_5206_5424 67
282 3300049581 Ga0501047_0078693 Ga0501047_0078693_2182_2385 67
283 3300049581 Ga0501047_0103062 Ga0501047_0103062_2017_2232 67
284 3300049581 Ga0501047_0110515 Ga0501047_0110515_248_466 67
285 3300049581 Ga0501047_0223004 Ga0501047_0223004_633_860 67
286 3300049581 Ga0501047_0249294 Ga0501047_0249294_982_1185 67
287 3300049581 Ga0501047_0650634 Ga0501047_0650634_121_354 67
288 3300049582 Ga0501048_0000605 Ga0501048_0000605_9969_10190 67
289 3300049582 Ga0501048_0095913 Ga0501048_0095913_657_860 67
290 3300049583 Ga0501067_0001602 Ga0501067_0001602_6716_6937 67
291 3300049584 Ga0501068_0007264 Ga0501068_0007264_3491_3712 67
292 3300049585 Ga0501069_0017456 Ga0501069_0017456_1089_1310 67
293 3300049585 Ga0501069_0458954 Ga0501069_0458954_219_422 67
294 3300049586 Ga0501070_0003159 Ga0501070_0003159_6843_7064 67
295 3300049586 Ga0501070_0007711 Ga0501070_0007711_2439_2672 67
296 3300049586 Ga0501070_0106437 Ga0501070_0106437_709_912 67
297 3300049586 Ga0501070_0313232 Ga0501070_0313232_109_327 67
298 3300049586 Ga0501070_1322223 Ga0501070_1322223_273_488 67
299 3300049587 Ga0501071_0139117 Ga0501071_0139117_1402_1623 67
300 3300049588 Ga0501072_0009913 Ga0501072_0009913_1518_1739 67
301 3300049589 Ga0501073_0019115 Ga0501073_0019115_2553_2774 67
302 3300049590 Ga0501074_0004536 Ga0501074_0004536_7166_7387 67
303 3300049592 Ga0501076_0609748 Ga0501076_0609748_630_851 67
304 3300049593 Ga0501077_0003467 Ga0501077_0003467_1195_1416 67
305 3300049741 Ga0501079_0003829 Ga0501079_0003829_5551_5772 67
306 3300049742 Ga0501080_0032888 Ga0501080_0032888_3253_3456 67
307 3300049742 Ga0501080_0207713 Ga0501080_0207713_185_406 67
308 3300049744 Ga0501083_0001220 Ga0501083_0001220_4904_5125 67
309 3300049744 Ga0501083_0744334 Ga0501083_0744334_379_582 67
310 3300049822 Ga0501035_0001220 Ga0501035_0001220_10487_10708 67
311 3300049822 Ga0501035_0019092 Ga0501035_0019092_3455_3673 67
312 3300049822 Ga0501035_0035183 Ga0501035_0035183_1672_1905 67
313 3300049822 Ga0501035_0213433 Ga0501035_0213433_46_249 67
314 3300049822 Ga0501035_0435631 Ga0501035_0435631_450_653 67
315 3300049822 Ga0501035_0529806 Ga0501035_0529806_554_772 67
316 3300049822 Ga0501035_1052648 Ga0501035_1052648_191_409 67
317 3300049822 Ga0501035_1121383 Ga0501035_1121383_23_256 67
318 3300049823 Ga0501044_0001475 Ga0501044_0001475_11069_11290 67
319 3300049823 Ga0501044_0067583 Ga0501044_0067583_2642_2875 67
320 3300049823 Ga0501044_0074425 Ga0501044_0074425_277_495 67
321 3300049823 Ga0501044_0107871 Ga0501044_0107871_2541_2759 67
322 3300049823 Ga0501044_0108656 Ga0501044_0108656_399_602 67
323 3300049823 Ga0501044_0186838 Ga0501044_0186838_829_1032 67
324 3300049823 Ga0501044_0249689 Ga0501044_0249689_1477_1692 67
325 3300049823 Ga0501044_0426016 Ga0501044_0426016_456_689 67
326 3300049823 Ga0501044_0442934 Ga0501044_0442934_227_445 67
327 3300049823 Ga0501044_0865370 Ga0501044_0865370_415_651 67
328 3300049824 Ga0501045_0014208 Ga0501045_0014208_185_406 67
329 3300049824 Ga0501045_0092145 Ga0501045_0092145_145_360 67
330 3300049824 Ga0501045_0096265 Ga0501045_0096265_1624_1857 67
331 3300053078 Ga0495612_0143568 Ga0495612_0143568_60_263 67
332 3300053083 Ga0495655_0002515 Ga0495655_0002515_1641_1859 67
333 3300053083 Ga0495655_0305111 Ga0495655_0305111_269_472 67
334 3300053085 Ga0495619_0040391 Ga0495619_0040391_2762_2965 67
335 3300053086 Ga0500578_0026331 Ga0500578_0026331_210_428 67
336 3300053092 Ga0500583_0281824 Ga0500583_0281824_563_766 67
337 3300053095 Ga0500640_004306 Ga0500640_004306_1719_1922 67
338 3300053107 Ga0500560_052704 Ga0500560_052704_42_260 67
339 3300053111 Ga0500572_169246 Ga0500572_169246_10_213 67
340 3300053123 Ga0500614_236352 Ga0500614_236352_318_536 67
341 3300053125 Ga0500618_026201 Ga0500618_026201_1178_1381 67
342 3300053129 Ga0500628_002591 Ga0500628_002591_94_312 67
343 3300053131 Ga0500652_055184 Ga0500652_055184_1193_1411 67
344 3300053134 Ga0500658_0001595 Ga0500658_0001595_3668_3886 67
345 3300053137 Ga0500561_0280863 Ga0500561_0280863_45_263 67
346 3300053140 Ga0500573_0018017 Ga0500573_0018017_47_265 67
347 3300053140 Ga0500573_0182497 Ga0500573_0182497_207_410 67
348 3300053140 Ga0500573_0522612 Ga0500573_0522612_279_482 67
349 3300053143 Ga0500579_101266 Ga0500579_101266_94_312 67
350 3300053146 Ga0500588_0023049 Ga0500588_0023049_1183_1401 67
351 3300053149 Ga0500600_0004486 Ga0500600_0004486_3669_3887 67
352 3300053153 Ga0500616_0019358 Ga0500616_0019358_80_298 67
353 3300053157 Ga0500624_001381 Ga0500624_001381_1321_1524 67
354 3300053160 Ga0500633_0000206 Ga0500633_0000206_6798_7016 67
355 3300053161 Ga0500634_0024115 Ga0500634_0024115_203_421 67
356 3300053177 Ga0500636_0144392 Ga0500636_0144392_78_296 67
357 3300053732 Ga0500656_000060 Ga0500656_000060_4825_5043 67
358 3300053739 Ga0500587_001861 Ga0500587_001861_2714_2932 67
359 3300054114 Ga0501084_0135237 Ga0501084_0135237_211_432 67
360 3300060353 Ga0501082_0003043 Ga0501082_0003043_5285_5506 67
361 3300061719 Ga0466962_0007554 Ga0466962_0007554_3929_4147 67
362 3300061734 Ga0530510_1162425 Ga0530510_1162425_81_302 67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lss-assembly1.cif.gz_A solution structure of the r. rickettsii cold shock-like protein 0.8326 1 65
5jx4-assembly1.cif.gz_A crystal structure of e36-g37del mutant of the bacillus caldolyticus cold shock protein. 0.8124 1 65
2mo1-assembly1.cif.gz_A backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, tacsp with dt7 0.8079 2 65
2lss-assembly1.cif.gz_A solution structure of the r. rickettsii cold shock-like protein 0.8006 1 65
3i2z-assembly3.cif.gz_A structure of cold shock protein e from salmonella typhimurium 0.7935 1 65
ID Description Score Start End Superfamily
2lssA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8326 1 65 2.40.50.140
5jx4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8123 1 65 2.40.50.140
2lssA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8006 1 65 2.40.50.140
af_Q4DCA9_18_92_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7991 1 64 2.40.50.140
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7984 3 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1H7XSL0-F1-model_v4 Phosphoenolpyruvate guanylyltransferase (PEP guanylyltransferase) (EC 2.7.7.105) 1 1 67 GO:0005525
GO:0043814
GO:0052645
AF-A0A397R6Q9-F1-model_v4 deleted 0.9972 1 67
AF-A0A4R4TUR3-F1-model_v4 2-phospho-L-lactate guanylyltransferase 0.9971 1 67
AF-A0A2S4XT72-F1-model_v4 2-phospho-L-lactate guanylyltransferase 0.9966 1 67
AF-A0A387HH31-F1-model_v4 2-phospho-L-lactate guanylyltransferase 0.9961 1 67

Feature Viewer

pLDDT pTM Quality
94.65 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map