F422499

General Info

Members Datasets Scaffolds Average Seq Length
362 269 724 252

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100112059|Ga0070659_1001120592
Length 274
Sequence MRRRLTYRMFDRLTNRRETGVSDEVLTEYTDGIAVLTINRPEARNAVNRAVAEALAAALDELDGRDDLAVGVITGSGGTFCSGMDLKAFLTGERPTVDGRGFGGLTQAPPSKPLIAAVEGYALAGGCEIVLACDMVVAAENARFGIPEVTRGLVAAAGGLMRLPERIPYQVAMEYALTGAMMDAPRAHALGLVNRLTPPGDALDGALTLARAVAKNAPLAVRATKKVIVSASQWSAAEEWERQGEIIGHVFTSQDAMEGARAFAEKRAPNWQGR

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
245 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
246 2643221561 Nocardioides sp. Root151 Isolate Unclassified
247 2643221696 Nocardioides sp. Root140 Isolate Unclassified
248 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
249 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
250 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
251 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
252 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
253 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
254 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
255 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
256 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
257 2862574272 Streptomyces sp. AcE210 Isolate Nodule
258 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
259 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
260 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
261 2922554459 Rhodococcus sp. 66b Isolate Unclassified
262 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
263 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
264 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
265 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
266 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
267 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
268 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
269 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.82
Metatranscriptomes 0
Isolates 7.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0.28
Rhizoplane 10.22
Rhizosphere 77.62
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100112059 3300005366 Bacteria 2203
2 Ga0070683_100179819 3300005329 Bacteria 2007
3 Ga0070690_100006089 3300005330 Bacteria 6827
4 Ga0070670_100065428 3300005331 Bacteria 3119
5 Ga0070670_100129107 3300005331 Bacteria 2182
6 Ga0068869_100221627 3300005334 Bacteria 1499
7 Ga0070682_100084683 3300005337 Bacteria 2060
8 Ga0068868_100075341 3300005338 Bacteria 2696
9 Ga0070689_100090779 3300005340 Bacteria 2407
10 Ga0070691_10077042 3300005341 Bacteria 1627
11 Ga0070687_100026393 3300005343 Bacteria 2796
12 Ga0070692_10036202 3300005345 Bacteria 2503
13 Ga0070669_100006613 3300005353 Bacteria 8345
14 Ga0070675_100118771 3300005354 Bacteria 2245
15 Ga0070675_100403623 3300005354 Bacteria 1220
16 Ga0070671_100003466 3300005355 Bacteria 12315
17 Ga0070673_100171255 3300005364 Bacteria 1853
18 Ga0070688_100003699 3300005365 Bacteria 7908
19 Ga0070709_10022648 3300005434 Bacteria 3678
20 Ga0070714_100004056 3300005435 Bacteria 11006
21 Ga0070714_100124458 3300005435 Bacteria 2296
22 Ga0070713_100028558 3300005436 Bacteria 4405
23 Ga0070713_100048623 3300005436 Bacteria 3494
24 Ga0070713_100419321 3300005436 Bacteria 1253
25 Ga0070710_10009910 3300005437 Bacteria 4670
26 Ga0070711_100054900 3300005439 Bacteria 2750
27 Ga0070711_100424900 3300005439 Bacteria 1083
28 Ga0070700_100047579 3300005441 Bacteria 2654
29 Ga0070708_100031018 3300005445 Bacteria 4624
30 Ga0070708_100386277 3300005445 Bacteria 1320
31 Ga0070663_100367358 3300005455 Bacteria 1168
32 Ga0070662_100126180 3300005457 Unclassified 1967
33 Ga0070685_10256816 3300005466 Bacteria 1160
34 Ga0070707_100002228 3300005468 Bacteria 18516
35 Ga0070707_100050718 3300005468 Bacteria 3978
36 Ga0070698_100025238 3300005471 Bacteria 6192
37 Ga0070698_100036218 3300005471 Bacteria 5100
38 Ga0070698_100153217 3300005471 Bacteria 2251
39 Ga0070699_100043222 3300005518 Bacteria 3901
40 Ga0070684_100035227 3300005535 Bacteria 4284
41 Ga0070684_100495877 3300005535 Bacteria 1131
42 Ga0070672_100389265 3300005543 Bacteria 1193
43 Ga0070696_100223135 3300005546 Bacteria 1415
44 Ga0070693_100076981 3300005547 Bacteria 1978
45 Ga0070665_100611933 3300005548 Bacteria 1102
46 Ga0070704_100119329 3300005549 Bacteria 2023
47 Ga0070664_100048401 3300005564 Bacteria 3593
48 Ga0068857_100058076 3300005577 Bacteria 3435
49 Ga0068854_100080158 3300005578 Bacteria 2408
50 Ga0068856_100191655 3300005614 Bacteria 2058
51 Ga0068856_100253723 3300005614 Bacteria 1774
52 Ga0070702_100352164 3300005615 Bacteria 1037
53 Ga0068852_100129321 3300005616 Bacteria 2323
54 Ga0068859_100584153 3300005617 Bacteria 1211
55 Ga0068864_100000139 3300005618 Bacteria 69907
56 Ga0068864_100011242 3300005618 Bacteria 7397
57 Ga0068864_100043375 3300005618 Bacteria 3851
58 Ga0068866_10023482 3300005718 Bacteria 2870
59 Ga0068851_10276592 3300005834 Bacteria 959
60 Ga0068863_100000218 3300005841 Bacteria 61402
61 Ga0068863_100129946 3300005841 Bacteria 2404
62 Ga0068863_100144168 3300005841 Bacteria 2277
63 Ga0068858_100000107 3300005842 Bacteria 87216
64 Ga0068858_100048331 3300005842 Bacteria 3943
65 Ga0068860_100351577 3300005843 Bacteria 1450
66 Ga0068862_100000015 3300005844 Bacteria 250184
67 Ga0068862_100041369 3300005844 Bacteria 3920
68 Ga0081455_10004357 3300005937 Bacteria 15935
69 Ga0070717_10007876 3300006028 Bacteria 7933
70 Ga0075365_10108829 3300006038 Bacteria 1903
71 Ga0075365_10175872 3300006038 Bacteria 1495
72 Ga0075365_10238725 3300006038 Bacteria 1276
73 Ga0075363_100226844 3300006048 Bacteria 1072
74 Ga0070715_10009202 3300006163 Bacteria 3473
75 Ga0070716_100076461 3300006173 Bacteria 1984
76 Ga0075370_10010160 3300006353 Bacteria 4907
77 Ga0075428_100078164 3300006844 Bacteria 3612
78 Ga0075430_100048160 3300006846 Bacteria 3599
79 Ga0075430_100343400 3300006846 Bacteria 1233
80 Ga0075431_100128124 3300006847 Bacteria 2619
81 Ga0075429_100046181 3300006880 Bacteria 3790
82 Ga0075429_100055965 3300006880 Bacteria 3433
83 Ga0068865_100414933 3300006881 Bacteria 1105
84 Ga0097620_100584143 3300006931 Bacteria 1211
85 Ga0105251_10117420 3300009011 Bacteria 1209
86 Ga0111539_10180608 3300009094 Bacteria 2464
87 Ga0111539_10230261 3300009094 Bacteria 2158
88 Ga0105245_10052503 3300009098 Unclassified 3656
89 Ga0105247_10006136 3300009101 Bacteria 7465
90 Ga0105247_10282407 3300009101 Bacteria 1145
91 Ga0114129_10010048 3300009147 Bacteria 13493
92 Ga0114129_10221124 3300009147 Bacteria 2554
93 Ga0105242_10385772 3300009176 Bacteria 1303
94 Ga0105248_10014645 3300009177 Bacteria 8629
95 Ga0105248_10024362 3300009177 Bacteria 6731
96 Ga0105248_10052928 3300009177 Bacteria 4555
97 Ga0105237_10045203 3300009545 Bacteria 4433
98 Ga0105238_10284257 3300009551 Bacteria 1636
99 Ga0105249_10000071 3300009553 Bacteria 146512
100 Ga0105249_10087609 3300009553 Bacteria 2905
101 Ga0105246_10145444 3300011119 Bacteria 1788
102 Ga0157370_10000584 3300013104 Bacteria 45472
103 Ga0157369_10058932 3300013105 Bacteria 4141
104 Ga0157369_10511185 3300013105 Bacteria 1243
105 Ga0157378_10098305 3300013297 Bacteria 2669
106 Ga0157375_10406218 3300013308 Bacteria 1528
107 Ga0163163_10012435 3300014325 Bacteria 7753
108 Ga0163163_10020842 3300014325 Bacteria 6179
109 Ga0163163_10190716 3300014325 Bacteria 2098
110 Ga0163163_10387558 3300014325 Bacteria 1455
111 Ga0157380_10063861 3300014326 Bacteria 2954
112 Ga0157377_10002152 3300014745 Bacteria 8653
113 Ga0157379_10041918 3300014968 Bacteria 4086
114 Ga0157379_10047226 3300014968 Bacteria 3840
115 Ga0157379_10174825 3300014968 Bacteria 1939
116 Ga0157379_10248790 3300014968 Bacteria 1613
117 Ga0157376_10176484 3300014969 Bacteria 1949
118 Ga0213876_10001603 3300021384 Bacteria 13888
119 Ga0209147_102238 3300025229 Bacteria 5144
120 Ga0207656_10021616 3300025321 Bacteria 2573
121 Ga0207642_10122176 3300025899 Bacteria 1345
122 Ga0207710_10000056 3300025900 Bacteria 178147
123 Ga0207710_10004754 3300025900 Bacteria 5888
124 Ga0207688_10000161 3300025901 Bacteria 29192
125 Ga0207685_10061857 3300025905 Bacteria 1486
126 Ga0207699_10004553 3300025906 Bacteria 6624
127 Ga0207643_10000392 3300025908 Bacteria 29123
128 Ga0207684_10033887 3300025910 Bacteria 4343
129 Ga0207693_10010134 3300025915 Bacteria 7656
130 Ga0207663_10110095 3300025916 Bacteria 1867
131 Ga0207662_10000435 3300025918 Bacteria 18504
132 Ga0207657_10064493 3300025919 Bacteria 3126
133 Ga0207646_10041625 3300025922 Bacteria 4129
134 Ga0207646_10044579 3300025922 Bacteria 3981
135 Ga0207681_10019481 3300025923 Bacteria 4287
136 Ga0207694_10633743 3300025924 Bacteria 900
137 Ga0207650_10043040 3300025925 Bacteria 3313
138 Ga0207650_10115667 3300025925 Bacteria 2082
139 Ga0207650_10146526 3300025925 Bacteria 1860
140 Ga0207659_10031264 3300025926 Bacteria 3642
141 Ga0207687_10410352 3300025927 Bacteria 1116
142 Ga0207700_10006630 3300025928 Bacteria 7017
143 Ga0207700_10117235 3300025928 Bacteria 2153
144 Ga0207700_10158715 3300025928 Bacteria 1876
145 Ga0207664_10001206 3300025929 Bacteria 17173
146 Ga0207664_10826771 3300025929 Bacteria 833
147 Ga0207644_10100462 3300025931 Bacteria 2172
148 Ga0207706_10010039 3300025933 Bacteria 8677
149 Ga0207686_10041236 3300025934 Bacteria 2813
150 Ga0207670_10211811 3300025936 Bacteria 1478
151 Ga0207669_10030372 3300025937 Bacteria 3002
152 Ga0207704_10097449 3300025938 Bacteria 1950
153 Ga0207665_10010983 3300025939 Bacteria 5943
154 Ga0207691_10005169 3300025940 Bacteria 12596
155 Ga0207711_10037830 3300025941 Bacteria 4101
156 Ga0207689_10002121 3300025942 Bacteria 18651
157 Ga0207651_10208464 3300025960 Bacteria 1571
158 Ga0207712_10000028 3300025961 Bacteria 250190
159 Ga0207712_10013678 3300025961 Bacteria 5203
160 Ga0207677_10226747 3300026023 Bacteria 1502
161 Ga0207703_10000561 3300026035 Bacteria 38204
162 Ga0207703_10051264 3300026035 Bacteria 3343
163 Ga0207703_10186796 3300026035 Bacteria 1833
164 Ga0207678_10110705 3300026067 Bacteria 2343
165 Ga0207708_10001167 3300026075 Bacteria 19753
166 Ga0207641_10000019 3300026088 Bacteria 295899
167 Ga0207641_10027229 3300026088 Bacteria 4721
168 Ga0207648_10001178 3300026089 Bacteria 29263
169 Ga0207676_10000326 3300026095 Bacteria 41138
170 Ga0207676_10013532 3300026095 Bacteria 5857
171 Ga0207676_10014785 3300026095 Bacteria 5622
172 Ga0207674_10097424 3300026116 Bacteria 2925
173 Ga0207675_100000190 3300026118 Bacteria 55772
174 Ga0209974_10007947 3300027876 Bacteria 3638
175 Ga0268266_10123108 3300028379 Bacteria 2310
176 Ga0268265_10000023 3300028380 Bacteria 268530
177 Ga0268265_10047490 3300028380 Bacteria 3217
178 Ga0268264_10163157 3300028381 Bacteria 2009
179 Ga0265337_1000606 3300028556 Bacteria 18871
180 Ga0265326_10002356 3300028558 Bacteria 6379
181 Ga0265319_1002772 3300028563 Bacteria 9396
182 Ga0265334_10000753 3300028573 Bacteria 16206
183 Ga0265323_10003164 3300028653 Bacteria 7331
184 Ga0265336_10002560 3300028666 Bacteria 7437
185 Ga0265338_10003263 3300028800 Bacteria 23059
186 Ga0265324_10004230 3300029957 Bacteria 6563
187 Ga0265332_10001416 3300031238 Bacteria 13500
188 Ga0265320_10024199 3300031240 Bacteria 3216
189 Ga0265325_10015560 3300031241 Bacteria 4275
190 Ga0265340_10001575 3300031247 Bacteria 13080
191 Ga0265339_10112015 3300031249 Bacteria 1411
192 Ga0265331_10116504 3300031250 Bacteria 1223
193 Ga0265316_10003419 3300031344 Bacteria 16065
194 Ga0265314_10036643 3300031711 Bacteria 3561
195 Ga0265342_10001585 3300031712 Bacteria 20992
196 Ga0373944_0060964 3300035089 Bacteria 1210
197 Ga0373923_0004934 3300035111 Bacteria 4483
198 Ga0373936_0029433 3300035113 Bacteria 2162
199 Ga0373945_0012299 3300035116 Bacteria 2840
200 Ga0373945_0149001 3300035116 Bacteria 947
201 Ga0373953_0030662 3300035117 Bacteria 2086
202 Ga0373956_0033707 3300035119 Bacteria 2252
203 Ga0373942_0061241 3300035207 Bacteria 1079
204 Ga0373961_0073319 3300035241 Bacteria 1063
205 Ga0316574_0104017 3300035398 Bacteria 1818
206 Ga0373931_0380827 3300035691 Bacteria 889
207 Ga0373927_0118200 3300035695 Bacteria 1729
208 Ga0373947_0177887 3300035725 Bacteria 1383
209 Ga0373925_0262386 3300037068 Bacteria 1388
210 Ga0436365_1263598 3300039437 Bacteria 19546
211 Ga0436360_1204762 3300039438 Bacteria 1351
212 Ga0466967_0080708 3300045976 Bacteria 2936
213 Ga0495617_041158 3300046452 Bacteria 1545
214 Ga0495603_0001739 3300046455 Bacteria 12825
215 Ga0495603_0042839 3300046455 Bacteria 2704
216 Ga0495629_0088970 3300046459 Bacteria 2154
217 Ga0495580_0040417 3300046472 Bacteria 3331
218 Ga0495639_0164401 3300046475 Bacteria 1075
219 Ga0495662_0037208 3300046476 Bacteria 2350
220 Ga0495584_0133468 3300046491 Bacteria 1260
221 Ga0495585_0086912 3300046492 Bacteria 1688
222 Ga0495607_0050995 3300046501 Bacteria 2406
223 Ga0495618_0065793 3300046514 Bacteria 2304
224 Ga0495618_0338416 3300046514 Bacteria 929
225 Ga0495628_0091529 3300046516 Bacteria 2354
226 Ga0495630_0326027 3300046517 Bacteria 1174
227 Ga0495644_0003510 3300046523 Bacteria 6202
228 Ga0495663_0044746 3300046525 Bacteria 1356
229 Ga0495665_0010598 3300046531 Bacteria 4991
230 Ga0495598_0051103 3300046537 Bacteria 1244
231 Ga0495598_0096793 3300046537 Bacteria 971
232 Ga0495609_0095058 3300046538 Bacteria 1294
233 Ga0495622_0008178 3300046557 Bacteria 4845
234 Ga0495633_0048671 3300046558 Bacteria 2001
235 Ga0495656_0013988 3300046615 Bacteria 2999
236 Ga0495668_0000203 3300046616 Bacteria 87014
237 Ga0495668_0048441 3300046616 Bacteria 2358
238 Ga0495659_0014546 3300046664 Bacteria 2577
239 Ga0495588_0030666 3300046674 Bacteria 2703
240 Ga0495623_0090587 3300046679 Bacteria 1878
241 Ga0495658_0007785 3300046683 Bacteria 5304
242 Ga0495613_0062973 3300046689 Bacteria 2714
243 Ga0495624_0062450 3300046690 Bacteria 2330
244 Ga0495670_0018036 3300046691 Bacteria 3477
245 Ga0495671_0027435 3300046692 Bacteria 2942
246 Ga0495581_0007121 3300047315 Bacteria 6478
247 Ga0495581_0021010 3300047315 Bacteria 3787
248 Ga0495581_0046991 3300047315 Bacteria 2495
249 Ga0495604_0089318 3300047317 Bacteria 2291
250 Ga0495674_0149920 3300047319 Bacteria 1956
251 Ga0495674_0267822 3300047319 Bacteria 1402
252 Ga0495672_0070240 3300047320 Bacteria 1985
253 Ga0495672_0169598 3300047320 Bacteria 1114
254 Ga0495676_0049798 3300047321 Bacteria 3364
255 Ga0495676_0089298 3300047321 Bacteria 2309
256 Ga0495675_0002691 3300047444 Bacteria 10645
257 Ga0495679_013411 3300047446 Bacteria 3079
258 Ga0495593_0182767 3300047673 Bacteria 1056
259 Ga0495602_0252744 3300048088 Bacteria 1312
260 Ga0496100_0105742 3300048903 Bacteria 1947
261 Ga0496100_0167703 3300048903 Bacteria 1579
262 Ga0496100_0279732 3300048903 Bacteria 1243
263 Ga0496100_0315743 3300048903 Bacteria 1173
264 Ga0496101_0025553 3300048904 Bacteria 4099
265 Ga0496101_0139551 3300048904 Bacteria 1846
266 Ga0496101_0217202 3300048904 Bacteria 1483
267 Ga0496102_0008735 3300048905 Bacteria 8693
268 Ga0496102_0069210 3300048905 Bacteria 3239
269 Ga0496103_0000462 3300048906 Bacteria 34543
270 Ga0496103_0025682 3300048906 Bacteria 3562
271 Ga0496103_0281691 3300048906 Bacteria 1069
272 Ga0496104_0015421 3300048907 Bacteria 6920
273 Ga0496104_0027334 3300048907 Bacteria 5279
274 Ga0496105_0025823 3300048908 Bacteria 4785
275 Ga0496105_0342319 3300048908 Bacteria 1195
276 Ga0496106_0106625 3300048909 Bacteria 2178
277 Ga0496107_0019685 3300048910 Bacteria 4762
278 Ga0496107_0060230 3300048910 Bacteria 2747
279 Ga0496108_0000218 3300048911 Bacteria 52071
280 Ga0496108_0039100 3300048911 Bacteria 3954
281 Ga0496108_0440938 3300048911 Bacteria 1137
282 Ga0496108_0767135 3300048911 Bacteria 833
283 Ga0496109_0000394 3300048912 Bacteria 39667
284 Ga0496109_0026318 3300048912 Bacteria 5187
285 Ga0496110_0018569 3300048913 Bacteria 5832
286 Ga0496110_0067021 3300048913 Bacteria 3175
287 Ga0496110_0136665 3300048913 Bacteria 2215
288 Ga0496111_0041156 3300048914 Bacteria 3315
289 Ga0496112_0014367 3300048915 Bacteria 7340
290 Ga0496112_0222822 3300048915 Bacteria 1841
291 Ga0496113_0000244 3300048916 Bacteria 25657
292 Ga0496113_0010882 3300048916 Bacteria 6035
293 Ga0496113_0023828 3300048916 Bacteria 4344
294 Ga0496114_0142454 3300048917 Bacteria 2076
295 Ga0496115_0020947 3300048918 Bacteria 5045
296 Ga0496115_0137303 3300048918 Bacteria 2016
297 Ga0496116_0004736 3300048919 Bacteria 12849
298 Ga0496117_0036859 3300048920 Bacteria 3652
299 Ga0496118_0019636 3300048921 Bacteria 6031
300 Ga0496118_0041268 3300048921 Bacteria 3656
301 Ga0496119_0006634 3300048922 Bacteria 10653
302 Ga0496119_0027706 3300048922 Bacteria 3887
303 Ga0496121_0000181 3300048924 Bacteria 140533
304 Ga0496121_0000974 3300048924 Bacteria 51284
305 Ga0496121_0002765 3300048924 Bacteria 26029
306 Ga0496124_0001145 3300048927 Bacteria 41583
307 Ga0496125_0002996 3300048928 Bacteria 21140
308 Ga0496125_0130132 3300048928 Bacteria 1773
309 Ga0496126_0000022 3300048929 Bacteria 464393
310 Ga0496126_0003174 3300048929 Bacteria 21152
311 Ga0496126_0020174 3300048929 Bacteria 6541
312 Ga0496126_0031615 3300048929 Bacteria 4996
313 Ga0501032_0049232 3300049569 Bacteria 2843
314 Ga0501036_0804445 3300049572 Bacteria 774
315 Ga0501043_0389641 3300049579 Bacteria 1054
316 Ga0501046_0143089 3300049580 Bacteria 1808
317 Ga0501075_0090170 3300049591 Bacteria 2326
318 Ga0501076_0237732 3300049592 Bacteria 1490
319 Ga0501044_0013286 3300049823 Bacteria 8915
320 nmdc:mga0yw44_149088_c1 3300050492 Bacteria 1525
321 nmdc:mga0yw44_435760_c1 3300050492 Bacteria 888
322 nmdc:mga06z11_12012_c1 3300050494 Bacteria 3044
323 nmdc:mga07m45_86556_c1 3300050496 Bacteria 1793
324 nmdc:mga05p37_14605_c1 3300050507 Bacteria 9433
325 nmdc:mga05p37_220288_c1 3300050507 Bacteria 2290
326 nmdc:mga09592_10058_c1 3300050508 Bacteria 7691
327 nmdc:mga09592_163033_c1 3300050508 Bacteria 1926
328 nmdc:mga09592_85608_c1 3300050508 Bacteria 2688
329 nmdc:mga06r32_141628_c1 3300050510 Bacteria 2381
330 nmdc:mga06r32_150319_c1 3300050510 Bacteria 2307
331 nmdc:mga08y16_265539_c1 3300050511 Bacteria 1772
332 nmdc:mga0n895_17808_c1 3300050512 Bacteria 6558
333 Ga0495619_0097472 3300053085 Bacteria 1998
334 Ga0500643_001132 3300053087 Bacteria 15908
335 Ga0500651_0012380 3300053093 Bacteria 5173
336 Ga0501082_0344679 3300060353 Bacteria 1298
337 2523384633 2523231044 Bacteria 6434991
338 2566993210 2565956761 Bacteria 6601618
339 2643827009 2643221561 Bacteria 4984412
340 2644534356 2643221696 Bacteria 5431823
341 2692318022 2690316117 Bacteria 6800650
342 2738889408 2738541308 Bacteria 7020677
343 2753036924 2751185725 Bacteria 5740550
344 2753324794 2751185792 Bacteria 5739090
345 2808980022 2808606385 Bacteria 6711065
346 2808995590 2808606388 Bacteria 6706662
347 2847423475 2847417321 Bacteria 6913799
348 2852617711 2852612431 Bacteria 6885235
349 2852672925 2852667396 Bacteria 6885555
350 2862574764 2862574272 Bacteria 10567477
351 2891559357 2891554331 Bacteria 8812224
352 2904537278 2904535858 Bacteria 6308016
353 2919712989 2919709256 Bacteria 4318106
354 2922559923 2922554459 Bacteria 6683962
355 2954720758 2954711539 Bacteria 10867210
356 2954730310 2954721474 Bacteria 10456478
357 2954731730 2954731030 Bacteria 10243860
358 2954749024 2954740390 Bacteria 10229294
359 2954750442 2954749733 Bacteria 10366972
360 3003670738 3003665799 Bacteria 7279786
361 8055071172 8055066027 Bacteria 9479577
362 8056214549 8056207758 Bacteria 8639239
363 Ga0070659_100112059
364 Ga0070683_100179819
365 Ga0070690_100006089
366 Ga0070670_100065428
367 Ga0070670_100129107
368 Ga0068869_100221627
369 Ga0070682_100084683
370 Ga0068868_100075341
371 Ga0070689_100090779
372 Ga0070691_10077042
373 Ga0070687_100026393
374 Ga0070692_10036202
375 Ga0070669_100006613
376 Ga0070675_100118771
377 Ga0070675_100403623
378 Ga0070671_100003466
379 Ga0070673_100171255
380 Ga0070688_100003699
381 Ga0070709_10022648
382 Ga0070714_100004056
383 Ga0070714_100124458
384 Ga0070713_100028558
385 Ga0070713_100048623
386 Ga0070713_100419321
387 Ga0070710_10009910
388 Ga0070711_100054900
389 Ga0070711_100424900
390 Ga0070700_100047579
391 Ga0070708_100031018
392 Ga0070708_100386277
393 Ga0070663_100367358
394 Ga0070662_100126180
395 Ga0070685_10256816
396 Ga0070707_100002228
397 Ga0070707_100050718
398 Ga0070698_100025238
399 Ga0070698_100036218
400 Ga0070698_100153217
401 Ga0070699_100043222
402 Ga0070684_100035227
403 Ga0070684_100495877
404 Ga0070672_100389265
405 Ga0070696_100223135
406 Ga0070693_100076981
407 Ga0070665_100611933
408 Ga0070704_100119329
409 Ga0070664_100048401
410 Ga0068857_100058076
411 Ga0068854_100080158
412 Ga0068856_100191655
413 Ga0068856_100253723
414 Ga0070702_100352164
415 Ga0068852_100129321
416 Ga0068859_100584153
417 Ga0068864_100000139
418 Ga0068864_100011242
419 Ga0068864_100043375
420 Ga0068866_10023482
421 Ga0068851_10276592
422 Ga0068863_100000218
423 Ga0068863_100129946
424 Ga0068863_100144168
425 Ga0068858_100000107
426 Ga0068858_100048331
427 Ga0068860_100351577
428 Ga0068862_100000015
429 Ga0068862_100041369
430 Ga0081455_10004357
431 Ga0070717_10007876
432 Ga0075365_10108829
433 Ga0075365_10175872
434 Ga0075365_10238725
435 Ga0075363_100226844
436 Ga0070715_10009202
437 Ga0070716_100076461
438 Ga0075370_10010160
439 Ga0075428_100078164
440 Ga0075430_100048160
441 Ga0075430_100343400
442 Ga0075431_100128124
443 Ga0075429_100046181
444 Ga0075429_100055965
445 Ga0068865_100414933
446 Ga0097620_100584143
447 Ga0105251_10117420
448 Ga0111539_10180608
449 Ga0111539_10230261
450 Ga0105245_10052503
451 Ga0105247_10006136
452 Ga0105247_10282407
453 Ga0114129_10010048
454 Ga0114129_10221124
455 Ga0105242_10385772
456 Ga0105248_10014645
457 Ga0105248_10024362
458 Ga0105248_10052928
459 Ga0105237_10045203
460 Ga0105238_10284257
461 Ga0105249_10000071
462 Ga0105249_10087609
463 Ga0105246_10145444
464 Ga0157370_10000584
465 Ga0157369_10058932
466 Ga0157369_10511185
467 Ga0157378_10098305
468 Ga0157375_10406218
469 Ga0163163_10012435
470 Ga0163163_10020842
471 Ga0163163_10190716
472 Ga0163163_10387558
473 Ga0157380_10063861
474 Ga0157377_10002152
475 Ga0157379_10041918
476 Ga0157379_10047226
477 Ga0157379_10174825
478 Ga0157379_10248790
479 Ga0157376_10176484
480 Ga0213876_10001603
481 Ga0209147_102238
482 Ga0207656_10021616
483 Ga0207642_10122176
484 Ga0207710_10000056
485 Ga0207710_10004754
486 Ga0207688_10000161
487 Ga0207685_10061857
488 Ga0207699_10004553
489 Ga0207643_10000392
490 Ga0207684_10033887
491 Ga0207693_10010134
492 Ga0207663_10110095
493 Ga0207662_10000435
494 Ga0207657_10064493
495 Ga0207646_10041625
496 Ga0207646_10044579
497 Ga0207681_10019481
498 Ga0207694_10633743
499 Ga0207650_10043040
500 Ga0207650_10115667
501 Ga0207650_10146526
502 Ga0207659_10031264
503 Ga0207687_10410352
504 Ga0207700_10006630
505 Ga0207700_10117235
506 Ga0207700_10158715
507 Ga0207664_10001206
508 Ga0207664_10826771
509 Ga0207644_10100462
510 Ga0207706_10010039
511 Ga0207686_10041236
512 Ga0207670_10211811
513 Ga0207669_10030372
514 Ga0207704_10097449
515 Ga0207665_10010983
516 Ga0207691_10005169
517 Ga0207711_10037830
518 Ga0207689_10002121
519 Ga0207651_10208464
520 Ga0207712_10000028
521 Ga0207712_10013678
522 Ga0207677_10226747
523 Ga0207703_10000561
524 Ga0207703_10051264
525 Ga0207703_10186796
526 Ga0207678_10110705
527 Ga0207708_10001167
528 Ga0207641_10000019
529 Ga0207641_10027229
530 Ga0207648_10001178
531 Ga0207676_10000326
532 Ga0207676_10013532
533 Ga0207676_10014785
534 Ga0207674_10097424
535 Ga0207675_100000190
536 Ga0209974_10007947
537 Ga0268266_10123108
538 Ga0268265_10000023
539 Ga0268265_10047490
540 Ga0268264_10163157
541 Ga0265337_1000606
542 Ga0265326_10002356
543 Ga0265319_1002772
544 Ga0265334_10000753
545 Ga0265323_10003164
546 Ga0265336_10002560
547 Ga0265338_10003263
548 Ga0265324_10004230
549 Ga0265332_10001416
550 Ga0265320_10024199
551 Ga0265325_10015560
552 Ga0265340_10001575
553 Ga0265339_10112015
554 Ga0265331_10116504
555 Ga0265316_10003419
556 Ga0265314_10036643
557 Ga0265342_10001585
558 Ga0373944_0060964
559 Ga0373923_0004934
560 Ga0373936_0029433
561 Ga0373945_0012299
562 Ga0373945_0149001
563 Ga0373953_0030662
564 Ga0373956_0033707
565 Ga0373942_0061241
566 Ga0373961_0073319
567 Ga0316574_0104017
568 Ga0373931_0380827
569 Ga0373927_0118200
570 Ga0373947_0177887
571 Ga0373925_0262386
572 Ga0436365_1263598
573 Ga0436360_1204762
574 Ga0466967_0080708
575 Ga0495617_041158
576 Ga0495603_0001739
577 Ga0495603_0042839
578 Ga0495629_0088970
579 Ga0495580_0040417
580 Ga0495639_0164401
581 Ga0495662_0037208
582 Ga0495584_0133468
583 Ga0495585_0086912
584 Ga0495607_0050995
585 Ga0495618_0065793
586 Ga0495618_0338416
587 Ga0495628_0091529
588 Ga0495630_0326027
589 Ga0495644_0003510
590 Ga0495663_0044746
591 Ga0495665_0010598
592 Ga0495598_0051103
593 Ga0495598_0096793
594 Ga0495609_0095058
595 Ga0495622_0008178
596 Ga0495633_0048671
597 Ga0495656_0013988
598 Ga0495668_0000203
599 Ga0495668_0048441
600 Ga0495659_0014546
601 Ga0495588_0030666
602 Ga0495623_0090587
603 Ga0495658_0007785
604 Ga0495613_0062973
605 Ga0495624_0062450
606 Ga0495670_0018036
607 Ga0495671_0027435
608 Ga0495581_0007121
609 Ga0495581_0021010
610 Ga0495581_0046991
611 Ga0495604_0089318
612 Ga0495674_0149920
613 Ga0495674_0267822
614 Ga0495672_0070240
615 Ga0495672_0169598
616 Ga0495676_0049798
617 Ga0495676_0089298
618 Ga0495675_0002691
619 Ga0495679_013411
620 Ga0495593_0182767
621 Ga0495602_0252744
622 Ga0496100_0105742
623 Ga0496100_0167703
624 Ga0496100_0279732
625 Ga0496100_0315743
626 Ga0496101_0025553
627 Ga0496101_0139551
628 Ga0496101_0217202
629 Ga0496102_0008735
630 Ga0496102_0069210
631 Ga0496103_0000462
632 Ga0496103_0025682
633 Ga0496103_0281691
634 Ga0496104_0015421
635 Ga0496104_0027334
636 Ga0496105_0025823
637 Ga0496105_0342319
638 Ga0496106_0106625
639 Ga0496107_0019685
640 Ga0496107_0060230
641 Ga0496108_0000218
642 Ga0496108_0039100
643 Ga0496108_0440938
644 Ga0496108_0767135
645 Ga0496109_0000394
646 Ga0496109_0026318
647 Ga0496110_0018569
648 Ga0496110_0067021
649 Ga0496110_0136665
650 Ga0496111_0041156
651 Ga0496112_0014367
652 Ga0496112_0222822
653 Ga0496113_0000244
654 Ga0496113_0010882
655 Ga0496113_0023828
656 Ga0496114_0142454
657 Ga0496115_0020947
658 Ga0496115_0137303
659 Ga0496116_0004736
660 Ga0496117_0036859
661 Ga0496118_0019636
662 Ga0496118_0041268
663 Ga0496119_0006634
664 Ga0496119_0027706
665 Ga0496121_0000181
666 Ga0496121_0000974
667 Ga0496121_0002765
668 Ga0496124_0001145
669 Ga0496125_0002996
670 Ga0496125_0130132
671 Ga0496126_0000022
672 Ga0496126_0003174
673 Ga0496126_0020174
674 Ga0496126_0031615
675 Ga0501032_0049232
676 Ga0501036_0804445
677 Ga0501043_0389641
678 Ga0501046_0143089
679 Ga0501075_0090170
680 Ga0501076_0237732
681 Ga0501044_0013286
682 nmdc:mga0yw44_149088_c1
683 nmdc:mga0yw44_435760_c1
684 nmdc:mga06z11_12012_c1
685 nmdc:mga07m45_86556_c1
686 nmdc:mga05p37_14605_c1
687 nmdc:mga05p37_220288_c1
688 nmdc:mga09592_10058_c1
689 nmdc:mga09592_163033_c1
690 nmdc:mga09592_85608_c1
691 nmdc:mga06r32_141628_c1
692 nmdc:mga06r32_150319_c1
693 nmdc:mga08y16_265539_c1
694 nmdc:mga0n895_17808_c1
695 Ga0495619_0097472
696 Ga0500643_001132
697 Ga0500651_0012380
698 Ga0501082_0344679
699 2523384633
700 2566993210
701 2643827009
702 2644534356
703 2692318022
704 2738889408
705 2753036924
706 2753324794
707 2808980022
708 2808995590
709 2847423475
710 2852617711
711 2852672925
712 2862574764
713 2891559357
714 2904537278
715 2919712989
716 2922559923
717 2954720758
718 2954730310
719 2954731730
720 2954749024
721 2954750442
722 3003670738
723 8055071172
724 8056214549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

28

274

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

33

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fzw-assembly1.cif.gz_B crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9632 1 249
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9594 3 249
4fzw-assembly1.cif.gz_B crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9594 1 249
3pzk-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis crotonase in apo form 0.9554 3 247
4fjw-assembly1.cif.gz_D crystal structure of the apo form of the e131q mtb crotonase 0.9547 3 246
ID Description Score Start End Superfamily
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9788 87 188 3.90.226.20
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9787 1 59 3.30.300.220
2qq3D02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9681 193 248 1.10.12.10
2pbpA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9663 193 248 1.10.12.10
af_P76082_198_255_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9646 192 249 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A7W7VFA8-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9839 1 249 GO:0004300
GO:0006635
AF-A0A4Q3DQ29-F1-model_v4 Enoyl-CoA hydratase 0.9817 1 249 GO:0006635
GO:0016829
AF-A0A844HVA6-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9812 1 249 GO:0006635
GO:0016836
GO:0016853
AF-A0A7W7VFA8-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.98 1 249 GO:0004300
GO:0006635
AF-A0A7K2P749-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9796 22 249 GO:0006635
GO:0016829
GO:0016853

Map