F422420

General Info

Members Datasets Scaffolds Average Seq Length
361 283 722 319

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221714|2644631384
Length 380
Sequence ARRWRVGAAGIAVLGLTLTACGGAKVGDSSSDAGGSGSSAKCGAFNLAVNPWVGYEANAAVIAYVAQNDLGCKVTKKDLKEEIAWQGFGTGEVDAVVENWGHDDLKKKYITGQKTAVDAGATGNEGLIGWYVPPWLAKEHPDITDWKNLNKYAAEFKTSESGGKGQLLDGDPSYVTNDEALVKNLKLGYKVVYAGSETALIQSFRKAEKNKEWVIGYFYEPQWFMSEVPLVKVKLPDYKEGCDADAEKVACDYPVYKLDKIVAKKFAESGSPAYDLVKKFNWTNDDQNVVAKYIAXRQDDPRGRGEEVGRRQPRQGGRLDQVAAQTGRGKPVGPCPVGGVRGMRAAHRASPCPGPVVPLFSEVSGPLTPTCAEGTLSCAT

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
101 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
102 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
122 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
123 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
124 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
125 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
126 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
127 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
128 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
226 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
227 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
228 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2643221714 Streptomyces sp. Root264 Isolate Unclassified
238 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
239 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
240 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
241 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
242 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
243 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
244 2643221647 Streptomyces sp. Root369 Isolate Unclassified
245 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
246 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
247 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
248 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
249 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
250 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
251 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
252 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
253 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
254 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
255 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
256 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
257 2867428634 Streptomyces sp. RP5T Isolate Unclassified
258 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
259 2891562705 Microbispora tritici MT50 Isolate Unclassified
260 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
261 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
262 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
263 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
264 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
265 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
266 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
267 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
268 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
269 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
270 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
271 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
272 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
273 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
274 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
275 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
276 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
277 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
278 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
279 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
280 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
281 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
282 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
283 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.15
Metatranscriptomes 0.55
Isolates 13.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0.55
Rhizoplane 3.05
Rhizosphere 78.12
Stem 0
Stem Tuber 0.28
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10008937 3300001989 Bacteria 3737
2 JGI24737J22298_10008835 3300001990 Bacteria 3362
3 JGI24738J21930_10006968 3300002075 Bacteria 2627
4 JGI24738J21930_10008103 3300002075 Bacteria 2399
5 rootH1_10005666 3300003323 Bacteria 3299
6 JGI25407J50210_10004594 3300003373 Bacteria 3361
7 Ga0058861_10070806 3300004800 Bacteria 1097
8 Ga0058862_10113689 3300004803 Bacteria 1443
9 Ga0070658_10209461 3300005327 Bacteria 1647
10 Ga0070683_100119830 3300005329 Bacteria 2485
11 Ga0070682_100038336 3300005337 Bacteria 2939
12 Ga0070689_100174450 3300005340 Bacteria 1743
13 Ga0070687_100005381 3300005343 Bacteria 5175
14 Ga0070661_100236813 3300005344 Bacteria 1404
15 Ga0070661_100348635 3300005344 Bacteria 1161
16 Ga0070692_10024802 3300005345 Bacteria 2951
17 Ga0070668_100004352 3300005347 Bacteria 10504
18 Ga0070675_100354930 3300005354 Bacteria 1301
19 Ga0070674_100073420 3300005356 Bacteria 2425
20 Ga0070659_100048968 3300005366 Bacteria 3321
21 Ga0070659_100063102 3300005366 Bacteria 2931
22 Ga0070703_10030898 3300005406 Bacteria 1617
23 Ga0070709_10218883 3300005434 Bacteria 1357
24 Ga0070710_10000115 3300005437 Bacteria 37911
25 Ga0070701_10006559 3300005438 Bacteria 4906
26 Ga0070701_10087711 3300005438 Bacteria 1698
27 Ga0070705_100014014 3300005440 Bacteria 4113
28 Ga0070700_100028788 3300005441 Bacteria 3308
29 Ga0070694_100007712 3300005444 Bacteria 6570
30 Ga0068867_100186717 3300005459 Bacteria 1651
31 Ga0070672_100054722 3300005543 Bacteria 3125
32 Ga0070672_100073368 3300005543 Bacteria 2727
33 Ga0070686_100265184 3300005544 Bacteria 1261
34 Ga0070695_100019573 3300005545 Bacteria 4122
35 Ga0070696_100004872 3300005546 Bacteria 8969
36 Ga0070693_100163472 3300005547 Bacteria 1420
37 Ga0070664_100219305 3300005564 Bacteria 1702
38 Ga0068854_100210914 3300005578 Bacteria 1532
39 Ga0070702_100044836 3300005615 Bacteria 2498
40 Ga0068864_100163996 3300005618 Bacteria 2022
41 Ga0068866_10031941 3300005718 Bacteria 2541
42 Ga0068860_100012252 3300005843 Bacteria 8450
43 Ga0068862_100049268 3300005844 Bacteria 3598
44 Ga0081455_10043219 3300005937 Bacteria 3944
45 Ga0081538_10001232 3300005981 Bacteria 26831
46 Ga0070717_10074006 3300006028 Bacteria 2848
47 Ga0075363_100075395 3300006048 Bacteria 1838
48 Ga0075363_100128908 3300006048 Bacteria 1418
49 Ga0075369_10078803 3300006186 Bacteria 1459
50 Ga0075370_10168491 3300006353 Bacteria 1287
51 Ga0075428_100008576 3300006844 Bacteria 11338
52 Ga0075430_100023384 3300006846 Bacteria 5260
53 Ga0075431_100001501 3300006847 Bacteria 21610
54 Ga0075431_100048533 3300006847 Bacteria 4379
55 Ga0075429_100000350 3300006880 Bacteria 33659
56 Ga0068865_100094766 3300006881 Bacteria 2173
57 Ga0111539_10053172 3300009094 Bacteria 4821
58 Ga0105243_10015326 3300009148 Bacteria 5798
59 Ga0105242_10081954 3300009176 Bacteria 2699
60 Ga0105248_10116101 3300009177 Bacteria 3019
61 Ga0105237_10422439 3300009545 Bacteria 1338
62 Ga0105238_10114993 3300009551 Bacteria 2670
63 Ga0105238_10248753 3300009551 Bacteria 1756
64 Ga0105249_10004033 3300009553 Bacteria 12670
65 Ga0105249_10123546 3300009553 Bacteria 2463
66 Ga0105246_10019268 3300011119 Bacteria 4358
67 Ga0105246_10163398 3300011119 Bacteria 1698
68 Ga0157374_10237549 3300013296 Bacteria 1791
69 Ga0157372_10172034 3300013307 Bacteria 2506
70 Ga0157372_10371419 3300013307 Bacteria 1666
71 Ga0157375_10010569 3300013308 Bacteria 8127
72 Ga0163163_10277866 3300014325 Bacteria 1726
73 Ga0157377_10063637 3300014745 Bacteria 2113
74 Ga0183367_1003 3300015688 Bacteria 814276
75 Ga0163161_10006905 3300017792 Bacteria 7853
76 Ga0163161_10117441 3300017792 Bacteria 1995
77 Ga0209051_1031756 3300025303 Bacteria 2026
78 Ga0207655_1054810 3300025728 Bacteria 1582
79 Ga0207692_10000913 3300025898 Bacteria 10675
80 Ga0207688_10091974 3300025901 Bacteria 1743
81 Ga0207647_10007465 3300025904 Bacteria 7896
82 Ga0207643_10008964 3300025908 Bacteria 5371
83 Ga0207705_10157997 3300025909 Bacteria 1702
84 Ga0207707_10089786 3300025912 Bacteria 2686
85 Ga0207662_10060895 3300025918 Bacteria 2265
86 Ga0207662_10087080 3300025918 Bacteria 1915
87 Ga0207662_10110101 3300025918 Bacteria 1716
88 Ga0207649_10208808 3300025920 Bacteria 1384
89 Ga0207694_10167474 3300025924 Bacteria 1778
90 Ga0207644_10051349 3300025931 Bacteria 2960
91 Ga0207690_10030428 3300025932 Bacteria 3444
92 Ga0207690_10070924 3300025932 Bacteria 2402
93 Ga0207686_10052101 3300025934 Bacteria 2553
94 Ga0207709_10005242 3300025935 Bacteria 7374
95 Ga0207709_10032368 3300025935 Bacteria 3061
96 Ga0207709_10253136 3300025935 Bacteria 1287
97 Ga0207670_10192858 3300025936 Bacteria 1543
98 Ga0207704_10207391 3300025938 Bacteria 1439
99 Ga0207704_10321553 3300025938 Bacteria 1194
100 Ga0207691_10004612 3300025940 Bacteria 13342
101 Ga0207691_10044861 3300025940 Bacteria 4068
102 Ga0207711_10405938 3300025941 Bacteria 1266
103 Ga0207679_10504393 3300025945 Bacteria 1080
104 Ga0207667_10228249 3300025949 Bacteria 1907
105 Ga0207712_10039096 3300025961 Bacteria 3249
106 Ga0207668_10002403 3300025972 Bacteria 10952
107 Ga0207677_10387115 3300026023 Bacteria 1182
108 Ga0207639_10132166 3300026041 Bacteria 2068
109 Ga0207708_10000421 3300026075 Bacteria 33075
110 Ga0207708_10035241 3300026075 Bacteria 3808
111 Ga0207702_10034298 3300026078 Bacteria 4242
112 Ga0207675_100003105 3300026118 Bacteria 16284
113 Ga0207698_10072914 3300026142 Bacteria 2731
114 Ga0207428_10015526 3300027907 Bacteria 6585
115 Ga0268265_10035078 3300028380 Bacteria 3662
116 Ga0268264_10229054 3300028381 Bacteria 1715
117 Ga0307517_10006525 3300028786 Bacteria 17263
118 Ga0307517_10067789 3300028786 Bacteria 3261
119 Ga0307515_10001780 3300028794 Bacteria 47995
120 Ga0307515_10001813 3300028794 Bacteria 47671
121 Ga0307515_10047305 3300028794 Bacteria 6543
122 Ga0307515_10106200 3300028794 Bacteria 3333
123 Ga0307515_10154977 3300028794 Bacteria 2370
124 Ga0307512_10003521 3300030522 Bacteria 18091
125 Ga0307512_10004688 3300030522 Bacteria 14809
126 Ga0307512_10009473 3300030522 Bacteria 9372
127 Ga0316177_1102975 3300030731 Bacteria 5142
128 Ga0316176_1141758 3300030732 Bacteria 3720
129 Ga0316180_1172135 3300030736 Bacteria 2242
130 Ga0307513_10008772 3300031456 Bacteria 12877
131 Ga0307513_10062667 3300031456 Bacteria 3929
132 Ga0307513_10126493 3300031456 Bacteria 2510
133 Ga0307508_10008760 3300031616 Bacteria 9339
134 Ga0307508_10034451 3300031616 Bacteria 4565
135 Ga0307508_10238469 3300031616 Bacteria 1416
136 Ga0307508_10239980 3300031616 Bacteria 1410
137 Ga0307514_10062531 3300031649 Bacteria 2831
138 Ga0307514_10130091 3300031649 Bacteria 1735
139 Ga0316579_10000086 3300031691 Bacteria 23939
140 Ga0307516_10009277 3300031730 Bacteria 10999
141 Ga0307516_10015485 3300031730 Bacteria 8020
142 Ga0307516_10019608 3300031730 Bacteria 7001
143 Ga0307410_10077478 3300031852 Bacteria 2324
144 Ga0307407_10004578 3300031903 Bacteria 5889
145 Ga0307412_10031049 3300031911 Bacteria 3370
146 Ga0307409_100012112 3300031995 Bacteria 5477
147 Ga0307416_100012302 3300032002 Bacteria 5759
148 Ga0307411_10214625 3300032005 Bacteria 1488
149 Ga0307415_100051455 3300032126 Bacteria 2795
150 Ga0307507_10045004 3300033179 Bacteria 4350
151 Ga0307507_10063961 3300033179 Bacteria 3399
152 Ga0307507_10071054 3300033179 Bacteria 3151
153 Ga0307510_10086975 3300033180 Bacteria 2994
154 Ga0395900_0106894 3300037418 Bacteria 2875
155 Ga0395900_0313330 3300037418 Bacteria 1552
156 Ga0395898_0300364 3300037466 Bacteria 1532
157 Ga0451853_0626948 3300041512 Bacteria 4512
158 Ga0451853_2202826 3300041512 Bacteria 1527
159 Ga0439449_0081866 3300042007 Bacteria 1190
160 Ga0439457_000915 3300042014 Bacteria 8892
161 Ga0450894_000087 3300042131 Bacteria 15272
162 Ga0450896_001630 3300042133 Bacteria 2800
163 Ga0450898_011164 3300042134 Bacteria 1466
164 Ga0450899_003203 3300042135 Bacteria 1762
165 Ga0450903_000150 3300042138 Bacteria 15238
166 Ga0450906_002025 3300042145 Bacteria 4421
167 Ga0450907_011671 3300042146 Bacteria 1459
168 Ga0439458_0000574 3300042157 Bacteria 9483
169 Ga0450908_011869 3300042184 Bacteria 1587
170 Ga0466972_0002809 3300044658 Bacteria 8631
171 Ga0466972_0003596 3300044658 Bacteria 7707
172 Ga0466972_0010543 3300044658 Bacteria 4637
173 Ga0466972_0028325 3300044658 Bacteria 2764
174 Ga0466972_0171832 3300044658 Bacteria 1017
175 Ga0466965_0004281 3300044683 Bacteria 6346
176 Ga0466965_0046417 3300044683 Bacteria 2150
177 Ga0466965_0074068 3300044683 Bacteria 1715
178 Ga0466966_0015291 3300044684 Bacteria 5075
179 Ga0466966_0015963 3300044684 Bacteria 4964
180 Ga0466961_0001887 3300044693 Bacteria 13038
181 Ga0466963_0006450 3300044694 Bacteria 6939
182 Ga0466971_0000938 3300044719 Bacteria 11979
183 Ga0466971_0022300 3300044719 Bacteria 2821
184 Ga0466970_0055654 3300044765 Bacteria 2113
185 Ga0466957_0037069 3300044842 Bacteria 2934
186 Ga0466960_0004230 3300044901 Bacteria 5586
187 Ga0466960_0126233 3300044901 Bacteria 1345
188 Ga0466959_0054755 3300045049 Bacteria 2913
189 Ga0451576_0369866 3300045051 Bacteria 1502
190 Ga0466958_0000144 3300045836 Bacteria 24551
191 Ga0466967_0009161 3300045976 Bacteria 7325
192 Ga0495592_0015446 3300046454 Bacteria 5791
193 Ga0495603_0005587 3300046455 Bacteria 7509
194 Ga0495603_0181238 3300046455 Bacteria 1218
195 Ga0495638_0022811 3300046460 Bacteria 4104
196 Ga0495651_0001329 3300046462 Bacteria 19158
197 Ga0495662_0018696 3300046476 Bacteria 3355
198 Ga0495662_0032702 3300046476 Bacteria 2513
199 Ga0495664_0001037 3300046477 Bacteria 14354
200 Ga0495594_0149359 3300046499 Bacteria 1326
201 Ga0495594_0152234 3300046499 Bacteria 1313
202 Ga0495618_0060678 3300046514 Bacteria 2398
203 Ga0495628_0030916 3300046516 Bacteria 4332
204 Ga0495632_0020917 3300046519 Bacteria 3535
205 Ga0495586_0058172 3300046535 Bacteria 2099
206 Ga0495587_0011062 3300046536 Bacteria 5721
207 Ga0495645_0006292 3300046543 Bacteria 8235
208 Ga0495634_0010820 3300046642 Bacteria 6672
209 Ga0495625_0265281 3300046660 Bacteria 1110
210 Ga0495635_0001067 3300046663 Bacteria 18162
211 Ga0495635_0330027 3300046663 Bacteria 1020
212 Ga0495588_0001544 3300046674 Bacteria 9841
213 Ga0495588_0001903 3300046674 Bacteria 8911
214 Ga0495657_0001313 3300046675 Bacteria 21641
215 Ga0495657_0125433 3300046675 Bacteria 1613
216 Ga0495646_0011152 3300046680 Bacteria 5708
217 Ga0495613_0001628 3300046689 Bacteria 17085
218 Ga0495613_0009877 3300046689 Bacteria 7095
219 Ga0495613_0092588 3300046689 Bacteria 2188
220 Ga0495600_0021741 3300046809 Bacteria 4113
221 Ga0495581_0008112 3300047315 Bacteria 6081
222 Ga0495604_0001193 3300047317 Bacteria 21440
223 Ga0495604_0034275 3300047317 Bacteria 4017
224 Ga0495636_0117031 3300047318 Bacteria 1176
225 Ga0495674_0248568 3300047319 Bacteria 1464
226 Ga0495676_0008203 3300047321 Bacteria 9580
227 Ga0495676_0244751 3300047321 Bacteria 1226
228 Ga0495687_001075 3300047443 Bacteria 26898
229 Ga0495687_001718 3300047443 Bacteria 19399
230 Ga0495685_014930 3300047447 Bacteria 2644
231 Ga0495681_0001237 3300047470 Bacteria 19403
232 Ga0495684_0054769 3300047471 Bacteria 3042
233 Ga0495593_0003685 3300047673 Bacteria 9147
234 Ga0495593_0005096 3300047673 Bacteria 7769
235 Ga0495602_0043385 3300048088 Bacteria 4090
236 Ga0495614_0004148 3300048089 Bacteria 6525
237 Ga0496100_0000785 3300048903 Bacteria 15108
238 Ga0496102_0028268 3300048905 Bacteria 5007
239 Ga0496102_0390077 3300048905 Bacteria 1310
240 Ga0496102_0470759 3300048905 Bacteria 1177
241 Ga0496106_0001538 3300048909 Bacteria 17357
242 Ga0496106_0015304 3300048909 Bacteria 5675
243 Ga0496107_0001034 3300048910 Bacteria 16636
244 Ga0496109_0151776 3300048912 Bacteria 2169
245 Ga0496109_0283836 3300048912 Bacteria 1560
246 Ga0496110_0041108 3300048913 Bacteria 4033
247 Ga0496110_0086380 3300048913 Bacteria 2801
248 Ga0501033_0008579 3300049570 Bacteria 7908
249 Ga0501033_0162630 3300049570 Bacteria 1606
250 Ga0501034_0109207 3300049571 Bacteria 2757
251 Ga0501034_0109785 3300049571 Bacteria 2749
252 Ga0501034_0201738 3300049571 Bacteria 1947
253 Ga0501036_0018773 3300049572 Bacteria 5799
254 Ga0501037_0009679 3300049573 Bacteria 7074
255 Ga0501037_0109578 3300049573 Bacteria 1990
256 Ga0501038_0007954 3300049574 Bacteria 9767
257 Ga0501038_0016578 3300049574 Bacteria 6679
258 Ga0501039_0029483 3300049575 Bacteria 4226
259 Ga0501040_0016692 3300049576 Bacteria 4865
260 Ga0501041_0001057 3300049577 Bacteria 15059
261 Ga0501043_0271982 3300049579 Bacteria 1300
262 Ga0501047_0055323 3300049581 Bacteria 3837
263 Ga0501048_0006894 3300049582 Bacteria 8635
264 Ga0501067_0006935 3300049583 Bacteria 6286
265 Ga0501068_0210165 3300049584 Bacteria 1235
266 Ga0501069_0023687 3300049585 Bacteria 3347
267 Ga0501069_0068923 3300049585 Bacteria 1980
268 Ga0501070_0196713 3300049586 Bacteria 1656
269 Ga0501071_0002330 3300049587 Bacteria 11464
270 Ga0501072_0007404 3300049588 Bacteria 8328
271 Ga0501074_0004289 3300049590 Bacteria 10181
272 Ga0501076_0018313 3300049592 Bacteria 5336
273 Ga0501076_0068534 3300049592 Bacteria 2834
274 Ga0501077_0007458 3300049593 Bacteria 6748
275 Ga0501206_008072 3300049653 Bacteria 1389
276 Ga0501080_0031007 3300049742 Bacteria 4982
277 Ga0501081_0004122 3300049743 Bacteria 9312
278 Ga0501035_0100133 3300049822 Bacteria 2544
279 Ga0501035_0155081 3300049822 Bacteria 1985
280 Ga0501044_0085136 3300049823 Bacteria 3194
281 Ga0501044_0428855 3300049823 Bacteria 1231
282 Ga0501045_0017714 3300049824 Bacteria 5058
283 nmdc:mga00v17_159913_c1 3300050491 Bacteria 1449
284 nmdc:mga05p37_3158_c1 3300050507 Bacteria 19174
285 nmdc:mga09592_4125_c1 3300050508 Bacteria 11736
286 nmdc:mga0qj67_28179_c1 3300050509 Bacteria 4358
287 nmdc:mga06r32_2321_c1 3300050510 Bacteria 17031
288 nmdc:mga06r32_251_c1 3300050510 Bacteria 44202
289 nmdc:mga08y16_7365_c1 3300050511 Bacteria 11540
290 nmdc:mga0n895_41828_c1 3300050512 Bacteria 4456
291 nmdc:mga0a205_76950_c1 3300050515 Bacteria 3224
292 Ga0495601_0012139 3300053077 Bacteria 5165
293 Ga0495595_0139453 3300053084 Bacteria 1189
294 Ga0495619_0175841 3300053085 Bacteria 1481
295 Ga0500644_0040930 3300053088 Bacteria 1536
296 Ga0500583_0008988 3300053092 Bacteria 3624
297 Ga0500651_0015059 3300053093 Bacteria 4742
298 Ga0500640_003370 3300053095 Bacteria 5564
299 Ga0500641_0028618 3300053096 Bacteria 2178
300 Ga0500650_0019849 3300053098 Bacteria 2940
301 Ga0500553_060509 3300053101 Bacteria 1780
302 Ga0500560_001497 3300053107 Bacteria 4086
303 Ga0500594_0012866 3300053118 Bacteria 1980
304 Ga0500652_048132 3300053131 Bacteria 1734
305 Ga0500577_0078229 3300053142 Bacteria 1313
306 Ga0500588_0049249 3300053146 Bacteria 1306
307 Ga0500633_0046296 3300053160 Bacteria 1485
308 Ga0501084_0005964 3300054114 Bacteria 10029
309 Ga0501084_0119529 3300054114 Bacteria 2215
310 Ga0501082_0013204 3300060353 Bacteria 7103
311 Ga0466962_0000712 3300061719 Bacteria 14819
312 Ga0466962_0036229 3300061719 Bacteria 2361
313 Ga0530510_0134651 3300061734 Bacteria 1819
314 2644631384 2643221714 Bacteria 9015452
315 2515494657 2515154088 Bacteria 5526283
316 2515718652 2515154129 Bacteria 5584369
317 2515758977 2515154137 Bacteria 5711575
318 2516086121 2515154202 Bacteria 5471270
319 2516089960 2515154203 Bacteria 5458536
320 2585309630 2582581313 Bacteria 10042643
321 2644264354 2643221647 Bacteria 10741251
322 2644441160 2643221678 Bacteria 9540101
323 2785346547 2784746763 Bacteria 9783172
324 2785366804 2784746768 Bacteria 10036182
325 2786667861 2786546132 Bacteria 10419719
326 2808846562 2808606359 Bacteria 9866990
327 2808917841 2808606375 Bacteria 9466072
328 2812354263 2811994879 Bacteria 9313447
329 2844851767 2844849076 Bacteria 4091819
330 2856745807 2856741275 Bacteria 8096094
331 2862282590 2862281513 Bacteria 9621493
332 2862392045 2862382967 Bacteria 10317375
333 2863410856 2863404153 Bacteria 9672205
334 2867438009 2867428634 Bacteria 9590268
335 2877683742 2877676314 Bacteria 9512378
336 2891567270 2891562705 Bacteria 8039471
337 2899373357 2899370129 Bacteria 6781179
338 2912723870 2912715099 Bacteria 9460473
339 2919059939 2919059106 Bacteria 4991624
340 2939649243 2939647034 Bacteria 4681660
341 2946026121 2946024296 Bacteria 3508095
342 2946071437 2946064051 Bacteria 8957905
343 2946072838 2946072368 Bacteria 8999607
344 2946080011 2946072368 Bacteria 8999607
345 2947224842 2947224130 Bacteria 9938529
346 2954389036 2954380949 Bacteria 10050426
347 2954674001 2954673503 Bacteria 9685905
348 2954689988 2954682443 Bacteria 9862841
349 2954699774 2954691527 Bacteria 10720516
350 2954702424 2954701450 Bacteria 10834262
351 2954718704 2954711539 Bacteria 10867210
352 2954728675 2954721474 Bacteria 10456478
353 2954733137 2954731030 Bacteria 10243860
354 2954747571 2954740390 Bacteria 10229294
355 2954752017 2954749733 Bacteria 10366972
356 2954766688 2954759201 Bacteria 9358192
357 2990064621 2990059506 Bacteria 9321252
358 3006487838 3006486233 Bacteria 8157040
359 8008564983 8008558824 Bacteria 10610750
360 8047716435 8047710418 Bacteria 11023148
361 8048412513 8048406513 Bacteria 8936924
362 JGI24739J22299_10008937
363 JGI24737J22298_10008835
364 JGI24738J21930_10006968
365 JGI24738J21930_10008103
366 rootH1_10005666
367 JGI25407J50210_10004594
368 Ga0058861_10070806
369 Ga0058862_10113689
370 Ga0070658_10209461
371 Ga0070683_100119830
372 Ga0070682_100038336
373 Ga0070689_100174450
374 Ga0070687_100005381
375 Ga0070661_100236813
376 Ga0070661_100348635
377 Ga0070692_10024802
378 Ga0070668_100004352
379 Ga0070675_100354930
380 Ga0070674_100073420
381 Ga0070659_100048968
382 Ga0070659_100063102
383 Ga0070703_10030898
384 Ga0070709_10218883
385 Ga0070710_10000115
386 Ga0070701_10006559
387 Ga0070701_10087711
388 Ga0070705_100014014
389 Ga0070700_100028788
390 Ga0070694_100007712
391 Ga0068867_100186717
392 Ga0070672_100054722
393 Ga0070672_100073368
394 Ga0070686_100265184
395 Ga0070695_100019573
396 Ga0070696_100004872
397 Ga0070693_100163472
398 Ga0070664_100219305
399 Ga0068854_100210914
400 Ga0070702_100044836
401 Ga0068864_100163996
402 Ga0068866_10031941
403 Ga0068860_100012252
404 Ga0068862_100049268
405 Ga0081455_10043219
406 Ga0081538_10001232
407 Ga0070717_10074006
408 Ga0075363_100075395
409 Ga0075363_100128908
410 Ga0075369_10078803
411 Ga0075370_10168491
412 Ga0075428_100008576
413 Ga0075430_100023384
414 Ga0075431_100001501
415 Ga0075431_100048533
416 Ga0075429_100000350
417 Ga0068865_100094766
418 Ga0111539_10053172
419 Ga0105243_10015326
420 Ga0105242_10081954
421 Ga0105248_10116101
422 Ga0105237_10422439
423 Ga0105238_10114993
424 Ga0105238_10248753
425 Ga0105249_10004033
426 Ga0105249_10123546
427 Ga0105246_10019268
428 Ga0105246_10163398
429 Ga0157374_10237549
430 Ga0157372_10172034
431 Ga0157372_10371419
432 Ga0157375_10010569
433 Ga0163163_10277866
434 Ga0157377_10063637
435 Ga0183367_1003
436 Ga0163161_10006905
437 Ga0163161_10117441
438 Ga0209051_1031756
439 Ga0207655_1054810
440 Ga0207692_10000913
441 Ga0207688_10091974
442 Ga0207647_10007465
443 Ga0207643_10008964
444 Ga0207705_10157997
445 Ga0207707_10089786
446 Ga0207662_10060895
447 Ga0207662_10087080
448 Ga0207662_10110101
449 Ga0207649_10208808
450 Ga0207694_10167474
451 Ga0207644_10051349
452 Ga0207690_10030428
453 Ga0207690_10070924
454 Ga0207686_10052101
455 Ga0207709_10005242
456 Ga0207709_10032368
457 Ga0207709_10253136
458 Ga0207670_10192858
459 Ga0207704_10207391
460 Ga0207704_10321553
461 Ga0207691_10004612
462 Ga0207691_10044861
463 Ga0207711_10405938
464 Ga0207679_10504393
465 Ga0207667_10228249
466 Ga0207712_10039096
467 Ga0207668_10002403
468 Ga0207677_10387115
469 Ga0207639_10132166
470 Ga0207708_10000421
471 Ga0207708_10035241
472 Ga0207702_10034298
473 Ga0207675_100003105
474 Ga0207698_10072914
475 Ga0207428_10015526
476 Ga0268265_10035078
477 Ga0268264_10229054
478 Ga0307517_10006525
479 Ga0307517_10067789
480 Ga0307515_10001780
481 Ga0307515_10001813
482 Ga0307515_10047305
483 Ga0307515_10106200
484 Ga0307515_10154977
485 Ga0307512_10003521
486 Ga0307512_10004688
487 Ga0307512_10009473
488 Ga0316177_1102975
489 Ga0316176_1141758
490 Ga0316180_1172135
491 Ga0307513_10008772
492 Ga0307513_10062667
493 Ga0307513_10126493
494 Ga0307508_10008760
495 Ga0307508_10034451
496 Ga0307508_10238469
497 Ga0307508_10239980
498 Ga0307514_10062531
499 Ga0307514_10130091
500 Ga0316579_10000086
501 Ga0307516_10009277
502 Ga0307516_10015485
503 Ga0307516_10019608
504 Ga0307410_10077478
505 Ga0307407_10004578
506 Ga0307412_10031049
507 Ga0307409_100012112
508 Ga0307416_100012302
509 Ga0307411_10214625
510 Ga0307415_100051455
511 Ga0307507_10045004
512 Ga0307507_10063961
513 Ga0307507_10071054
514 Ga0307510_10086975
515 Ga0395900_0106894
516 Ga0395900_0313330
517 Ga0395898_0300364
518 Ga0451853_0626948
519 Ga0451853_2202826
520 Ga0439449_0081866
521 Ga0439457_000915
522 Ga0450894_000087
523 Ga0450896_001630
524 Ga0450898_011164
525 Ga0450899_003203
526 Ga0450903_000150
527 Ga0450906_002025
528 Ga0450907_011671
529 Ga0439458_0000574
530 Ga0450908_011869
531 Ga0466972_0002809
532 Ga0466972_0003596
533 Ga0466972_0010543
534 Ga0466972_0028325
535 Ga0466972_0171832
536 Ga0466965_0004281
537 Ga0466965_0046417
538 Ga0466965_0074068
539 Ga0466966_0015291
540 Ga0466966_0015963
541 Ga0466961_0001887
542 Ga0466963_0006450
543 Ga0466971_0000938
544 Ga0466971_0022300
545 Ga0466970_0055654
546 Ga0466957_0037069
547 Ga0466960_0004230
548 Ga0466960_0126233
549 Ga0466959_0054755
550 Ga0451576_0369866
551 Ga0466958_0000144
552 Ga0466967_0009161
553 Ga0495592_0015446
554 Ga0495603_0005587
555 Ga0495603_0181238
556 Ga0495638_0022811
557 Ga0495651_0001329
558 Ga0495662_0018696
559 Ga0495662_0032702
560 Ga0495664_0001037
561 Ga0495594_0149359
562 Ga0495594_0152234
563 Ga0495618_0060678
564 Ga0495628_0030916
565 Ga0495632_0020917
566 Ga0495586_0058172
567 Ga0495587_0011062
568 Ga0495645_0006292
569 Ga0495634_0010820
570 Ga0495625_0265281
571 Ga0495635_0001067
572 Ga0495635_0330027
573 Ga0495588_0001544
574 Ga0495588_0001903
575 Ga0495657_0001313
576 Ga0495657_0125433
577 Ga0495646_0011152
578 Ga0495613_0001628
579 Ga0495613_0009877
580 Ga0495613_0092588
581 Ga0495600_0021741
582 Ga0495581_0008112
583 Ga0495604_0001193
584 Ga0495604_0034275
585 Ga0495636_0117031
586 Ga0495674_0248568
587 Ga0495676_0008203
588 Ga0495676_0244751
589 Ga0495687_001075
590 Ga0495687_001718
591 Ga0495685_014930
592 Ga0495681_0001237
593 Ga0495684_0054769
594 Ga0495593_0003685
595 Ga0495593_0005096
596 Ga0495602_0043385
597 Ga0495614_0004148
598 Ga0496100_0000785
599 Ga0496102_0028268
600 Ga0496102_0390077
601 Ga0496102_0470759
602 Ga0496106_0001538
603 Ga0496106_0015304
604 Ga0496107_0001034
605 Ga0496109_0151776
606 Ga0496109_0283836
607 Ga0496110_0041108
608 Ga0496110_0086380
609 Ga0501033_0008579
610 Ga0501033_0162630
611 Ga0501034_0109207
612 Ga0501034_0109785
613 Ga0501034_0201738
614 Ga0501036_0018773
615 Ga0501037_0009679
616 Ga0501037_0109578
617 Ga0501038_0007954
618 Ga0501038_0016578
619 Ga0501039_0029483
620 Ga0501040_0016692
621 Ga0501041_0001057
622 Ga0501043_0271982
623 Ga0501047_0055323
624 Ga0501048_0006894
625 Ga0501067_0006935
626 Ga0501068_0210165
627 Ga0501069_0023687
628 Ga0501069_0068923
629 Ga0501070_0196713
630 Ga0501071_0002330
631 Ga0501072_0007404
632 Ga0501074_0004289
633 Ga0501076_0018313
634 Ga0501076_0068534
635 Ga0501077_0007458
636 Ga0501206_008072
637 Ga0501080_0031007
638 Ga0501081_0004122
639 Ga0501035_0100133
640 Ga0501035_0155081
641 Ga0501044_0085136
642 Ga0501044_0428855
643 Ga0501045_0017714
644 nmdc:mga00v17_159913_c1
645 nmdc:mga05p37_3158_c1
646 nmdc:mga09592_4125_c1
647 nmdc:mga0qj67_28179_c1
648 nmdc:mga06r32_2321_c1
649 nmdc:mga06r32_251_c1
650 nmdc:mga08y16_7365_c1
651 nmdc:mga0n895_41828_c1
652 nmdc:mga0a205_76950_c1
653 Ga0495601_0012139
654 Ga0495595_0139453
655 Ga0495619_0175841
656 Ga0500644_0040930
657 Ga0500583_0008988
658 Ga0500651_0015059
659 Ga0500640_003370
660 Ga0500641_0028618
661 Ga0500650_0019849
662 Ga0500553_060509
663 Ga0500560_001497
664 Ga0500594_0012866
665 Ga0500652_048132
666 Ga0500577_0078229
667 Ga0500588_0049249
668 Ga0500633_0046296
669 Ga0501084_0005964
670 Ga0501084_0119529
671 Ga0501082_0013204
672 Ga0466962_0000712
673 Ga0466962_0036229
674 Ga0530510_0134651
675 2644631384
676 2515494657
677 2515718652
678 2515758977
679 2516086121
680 2516089960
681 2585309630
682 2644264354
683 2644441160
684 2785346547
685 2785366804
686 2786667861
687 2808846562
688 2808917841
689 2812354263
690 2844851767
691 2856745807
692 2862282590
693 2862392045
694 2863410856
695 2867438009
696 2877683742
697 2891567270
698 2899373357
699 2912723870
700 2919059939
701 2939649243
702 2946026121
703 2946071437
704 2946072838
705 2946080011
706 2947224842
707 2954389036
708 2954674001
709 2954689988
710 2954699774
711 2954702424
712 2954718704
713 2954728675
714 2954733137
715 2954747571
716 2954752017
717 2954766688
718 2990064621
719 3006487838
720 8008564983
721 8047716435
722 8048412513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

44

308

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xz6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8783 36 320
3l6h-assembly1.cif.gz_A crystal structure of lactococcal opuac in its closed-liganded conformation complexed with glycine betaine 0.864 43 320
4xz6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8615 36 320
3l6h-assembly1.cif.gz_A crystal structure of lactococcal opuac in its closed-liganded conformation complexed with glycine betaine 0.8546 43 320
7yle-assembly1.cif.gz_A rndmpx in complex with dmsp 0.8437 40 320
ID Description Score Start End Superfamily
af_Q6ESV8_25_257_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9177 43 75 3.40.50.2000
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9006 43 320 3.40.190.10
af_B6SRY5_19_277_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8987 43 75 3.40.50.2000
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8832 43 320 3.40.190.10
3tmgD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Glycine betaine-binding periplasmic protein; domain 2 0.8702 126 233 3.40.190.100
ID Description Score Start End GO Terms
AF-A0A1H4KWY8-F1-model_v4 Glycine betaine/proline transport system substrate-binding protein 0.9921 53 320 GO:0022857
GO:0043190
AF-A0A1I5EY64-F1-model_v4 Substrate binding domain of ABC-type glycine betaine transport system 0.9915 128 320 GO:0022857
GO:0043190
AF-A0A1H4KWY8-F1-model_v4 Glycine betaine/proline transport system substrate-binding protein 0.9848 53 320 GO:0022857
GO:0043190
AF-A0A1I5EY64-F1-model_v4 Substrate binding domain of ABC-type glycine betaine transport system 0.9814 128 320 GO:0022857
GO:0043190
AF-A0A545AL69-F1-model_v4 Glycine/betaine ABC transporter substrate-binding protein 0.9758 44 320 GO:0022857
GO:0043190

Map