F422348

General Info

Members Datasets Scaffolds Average Seq Length
361 200 361 144

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0664999|Ga0495625_0664999_109_594
Length 161
Sequence LRWKRLNKLQQGHANFLGIAALMFVAGIGIPLMATLNAGLGRQLASPAAATFILYVVGLALSLGVMLAAGGFPAAEKFQGIRPHFYMGAVFVVFYIVSITWAAPKIGVGNAIFFVLLGQLFAAAAIDHYGLWGAVQSAITPKRVLGIAVMALGVYLARKPV

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
191 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.9
Nodule 0.55
Rhizoplane 4.16
Rhizosphere 73.96
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000198 3300001904 Bacteria 10805
2 JGI24735J21928_10052236 3300002067 Bacteria 1179
3 rootH2_10112850 3300003320 Bacteria 1009
4 Ga0065715_10238875 3300005293 Bacteria 1206
5 Ga0070658_10021251 3300005327 Bacteria 5200
6 Ga0070658_10037757 3300005327 Bacteria 3894
7 Ga0070658_10058617 3300005327 Bacteria 3134
8 Ga0070658_10153960 3300005327 Bacteria 1926
9 Ga0070658_10337480 3300005327 Bacteria 1289
10 Ga0070658_11269668 3300005327 Bacteria 640
11 Ga0070670_100069491 3300005331 Bacteria 3023
12 Ga0070670_100086921 3300005331 Bacteria 2686
13 Ga0070670_100190679 3300005331 Bacteria 1781
14 Ga0070670_101327726 3300005331 Bacteria 659
15 Ga0068869_100040353 3300005334 Bacteria 3337
16 Ga0068869_100543342 3300005334 Bacteria 975
17 Ga0070666_10074668 3300005335 Bacteria 2311
18 Ga0070666_10444991 3300005335 Bacteria 935
19 Ga0070680_101968601 3300005336 Bacteria 506
20 Ga0068868_100019275 3300005338 Bacteria 5110
21 Ga0068868_100312812 3300005338 Bacteria 1336
22 Ga0070660_100250779 3300005339 Bacteria 1443
23 Ga0070660_100383464 3300005339 Bacteria 1160
24 Ga0070660_100391105 3300005339 Bacteria 1149
25 Ga0070660_100497774 3300005339 Bacteria 1014
26 Ga0070660_100509269 3300005339 Bacteria 1002
27 Ga0070660_100991778 3300005339 Bacteria 710
28 Ga0070661_100301784 3300005344 Bacteria 1247
29 Ga0070661_100749742 3300005344 Bacteria 798
30 Ga0070661_101446974 3300005344 Bacteria 579
31 Ga0070661_101696372 3300005344 Bacteria 535
32 Ga0070668_100596857 3300005347 Bacteria 965
33 Ga0070669_100011083 3300005353 Bacteria 6399
34 Ga0070669_101259084 3300005353 Bacteria 640
35 Ga0070675_100306135 3300005354 Bacteria 1401
36 Ga0070671_100043824 3300005355 Bacteria 3718
37 Ga0070671_100284318 3300005355 Bacteria 1407
38 Ga0070671_100410850 3300005355 Bacteria 1158
39 Ga0070674_100229878 3300005356 Bacteria 1447
40 Ga0070673_100177445 3300005364 Bacteria 1822
41 Ga0070673_100335536 3300005364 Bacteria 1338
42 Ga0070688_101725046 3300005365 Bacteria 513
43 Ga0070659_100128277 3300005366 Bacteria 2058
44 Ga0070659_100622828 3300005366 Bacteria 929
45 Ga0070659_100672567 3300005366 Bacteria 894
46 Ga0070659_100681328 3300005366 Bacteria 888
47 Ga0070659_100790957 3300005366 Bacteria 824
48 Ga0070659_101279190 3300005366 Bacteria 650
49 Ga0070667_100000913 3300005367 Bacteria 27292
50 Ga0070667_100114202 3300005367 Bacteria 2344
51 Ga0070667_100131563 3300005367 Bacteria 2184
52 Ga0070663_100007649 3300005455 Bacteria 6591
53 Ga0070681_11221668 3300005458 Bacteria 674
54 Ga0070679_100540966 3300005530 Bacteria 1108
55 Ga0070679_100605916 3300005530 Unclassified 1038
56 Ga0070679_100667248 3300005530 Bacteria 982
57 Ga0070679_100682872 3300005530 Unclassified 969
58 Ga0070684_101807981 3300005535 Bacteria 576
59 Ga0068853_100141396 3300005539 Bacteria 2161
60 Ga0068853_100695405 3300005539 Bacteria 970
61 Ga0070672_100061183 3300005543 Bacteria 2967
62 Ga0070686_100052219 3300005544 Bacteria 2606
63 Ga0070695_101048205 3300005545 Bacteria 665
64 Ga0070665_100000380 3300005548 Bacteria 65676
65 Ga0070665_100524010 3300005548 Bacteria 1197
66 Ga0070664_100713630 3300005564 Bacteria 935
67 Ga0068852_100030985 3300005616 Bacteria 4407
68 Ga0068852_100048915 3300005616 Bacteria 3615
69 Ga0068852_100218526 3300005616 Bacteria 1811
70 Ga0068852_100865908 3300005616 Bacteria 920
71 Ga0068859_100137571 3300005617 Bacteria 2516
72 Ga0068866_10042565 3300005718 Bacteria 2261
73 Ga0068863_100002473 3300005841 Bacteria 18361
74 Ga0068863_100090224 3300005841 Bacteria 2906
75 Ga0068858_100066440 3300005842 Bacteria 3338
76 Ga0068858_100127615 3300005842 Bacteria 2383
77 Ga0068860_100084759 3300005843 Bacteria 3014
78 Ga0068860_100156818 3300005843 Bacteria 2194
79 Ga0068862_100057161 3300005844 Bacteria 3344
80 Ga0068862_100165534 3300005844 Bacteria 1976
81 Ga0068862_102518005 3300005844 Unclassified 526
82 Ga0075365_10060856 3300006038 Bacteria 2520
83 Ga0075368_10020393 3300006042 Bacteria 2510
84 Ga0075368_10212612 3300006042 Bacteria 820
85 Ga0075363_100000173 3300006048 Bacteria 16829
86 Ga0075363_100010112 3300006048 Bacteria 4462
87 Ga0075364_10016248 3300006051 Bacteria 4629
88 Ga0075364_10070852 3300006051 Bacteria 2295
89 Ga0075362_10000007 3300006177 Bacteria 116409
90 Ga0075362_10003596 3300006177 Bacteria 5449
91 Ga0075367_10012128 3300006178 Bacteria 4585
92 Ga0075369_10001870 3300006186 Bacteria 7356
93 Ga0075369_10017890 3300006186 Bacteria 2880
94 Ga0075369_10035128 3300006186 Bacteria 2130
95 Ga0075366_10000068 3300006195 Bacteria 39441
96 Ga0075366_10104925 3300006195 Bacteria 1698
97 Ga0097621_100153847 3300006237 Bacteria 1973
98 Ga0075370_10000030 3300006353 Bacteria 48013
99 Ga0075370_10332850 3300006353 Bacteria 905
100 Ga0097620_100137568 3300006931 Bacteria 2516
101 Ga0079104_1030900 3300006946 Bacteria 1333
102 Ga0105251_10017597 3300009011 Bacteria 3825
103 Ga0105240_10314262 3300009093 Bacteria 1788
104 Ga0111539_10226262 3300009094 Bacteria 2179
105 Ga0105245_10038581 3300009098 Bacteria 4250
106 Ga0105243_11669543 3300009148 Unclassified 665
107 Ga0105242_10299683 3300009176 Bacteria 1467
108 Ga0105248_10160651 3300009177 Bacteria 2535
109 Ga0105248_10254269 3300009177 Bacteria 1977
110 Ga0105248_10523285 3300009177 Bacteria 1337
111 Ga0105248_11468185 3300009177 Bacteria 772
112 Ga0105238_10262214 3300009551 Bacteria 1708
113 Ga0105238_11081054 3300009551 Bacteria 824
114 Ga0105239_10688017 3300010375 Bacteria 1169
115 Ga0157373_10014410 3300013100 Bacteria 5796
116 Ga0157373_10268047 3300013100 Bacteria 1209
117 Ga0157371_10363239 3300013102 Bacteria 1055
118 Ga0157370_10100333 3300013104 Bacteria 2712
119 Ga0157369_10000751 3300013105 Bacteria 41778
120 Ga0157369_10888237 3300013105 Bacteria 914
121 Ga0157374_10204252 3300013296 Bacteria 1936
122 Ga0157374_10516268 3300013296 Bacteria 1200
123 Ga0157374_10823353 3300013296 Bacteria 945
124 Ga0157374_10869202 3300013296 Bacteria 919
125 Ga0157378_10291232 3300013297 Bacteria 1577
126 Ga0157378_10565382 3300013297 Bacteria 1144
127 Ga0163162_10623759 3300013306 Bacteria 1203
128 Ga0157375_10121153 3300013308 Bacteria 2725
129 Ga0157376_10386440 3300014969 Bacteria 1350
130 Ga0163161_10070834 3300017792 Bacteria 2550
131 Ga0213875_10003627 3300021388 Bacteria 8727
132 Ga0207697_10050083 3300025315 Bacteria 1724
133 Ga0207713_1004263 3300025735 Bacteria 9336
134 Ga0207688_10441131 3300025901 Bacteria 811
135 Ga0207680_10176735 3300025903 Bacteria 1441
136 Ga0207680_10275699 3300025903 Bacteria 1167
137 Ga0207680_10357463 3300025903 Bacteria 1027
138 Ga0207647_10023526 3300025904 Bacteria 4074
139 Ga0207645_10084916 3300025907 Bacteria 2032
140 Ga0207645_10132231 3300025907 Bacteria 1624
141 Ga0207705_10031910 3300025909 Bacteria 3763
142 Ga0207705_10045859 3300025909 Bacteria 3141
143 Ga0207705_10071263 3300025909 Bacteria 2519
144 Ga0207705_10114819 3300025909 Bacteria 1992
145 Ga0207705_10166334 3300025909 Bacteria 1659
146 Ga0207705_10826008 3300025909 Bacteria 719
147 Ga0207707_10216900 3300025912 Bacteria 1666
148 Ga0207695_10003918 3300025913 Bacteria 20595
149 Ga0207695_10272231 3300025913 Bacteria 1589
150 Ga0207660_10226042 3300025917 Bacteria 1470
151 Ga0207660_11607140 3300025917 Bacteria 524
152 Ga0207657_10158083 3300025919 Bacteria 1842
153 Ga0207657_10247620 3300025919 Bacteria 1422
154 Ga0207657_10477669 3300025919 Bacteria 977
155 Ga0207657_10879278 3300025919 Bacteria 691
156 Ga0207649_10143068 3300025920 Bacteria 1639
157 Ga0207649_10591722 3300025920 Bacteria 852
158 Ga0207649_11073915 3300025920 Bacteria 635
159 Ga0207652_10076046 3300025921 Bacteria 2927
160 Ga0207652_10087145 3300025921 Bacteria 2738
161 Ga0207652_10276311 3300025921 Bacteria 1515
162 Ga0207652_10572983 3300025921 Bacteria 1014
163 Ga0207681_10000336 3300025923 Bacteria 33758
164 Ga0207681_10961907 3300025923 Bacteria 716
165 Ga0207694_10471136 3300025924 Bacteria 1050
166 Ga0207650_10433575 3300025925 Bacteria 1092
167 Ga0207659_10156683 3300025926 Bacteria 1784
168 Ga0207687_10139906 3300025927 Bacteria 1835
169 Ga0207644_10000518 3300025931 Bacteria 24946
170 Ga0207644_10098411 3300025931 Bacteria 2192
171 Ga0207644_10178122 3300025931 Bacteria 1664
172 Ga0207690_10038248 3300025932 Bacteria 3121
173 Ga0207690_10360227 3300025932 Bacteria 1152
174 Ga0207690_10572907 3300025932 Bacteria 919
175 Ga0207706_10541166 3300025933 Bacteria 1003
176 Ga0207709_10973642 3300025935 Unclassified 692
177 Ga0207704_10433865 3300025938 Bacteria 1045
178 Ga0207711_10019821 3300025941 Bacteria 5605
179 Ga0207711_10096597 3300025941 Bacteria 2608
180 Ga0207711_10345342 3300025941 Bacteria 1378
181 Ga0207689_10063037 3300025942 Bacteria 3049
182 Ga0207661_11766224 3300025944 Bacteria 564
183 Ga0207667_10119934 3300025949 Bacteria 2710
184 Ga0207651_10235782 3300025960 Bacteria 1488
185 Ga0207651_10334401 3300025960 Bacteria 1270
186 Ga0207640_10002112 3300025981 Bacteria 10675
187 Ga0207640_10107009 3300025981 Bacteria 1974
188 Ga0207640_10778894 3300025981 Bacteria 827
189 Ga0207658_10000925 3300025986 Bacteria 24287
190 Ga0207658_10008557 3300025986 Bacteria 6961
191 Ga0207658_10068292 3300025986 Bacteria 2681
192 Ga0207677_10015901 3300026023 Bacteria 4442
193 Ga0207677_10295418 3300026023 Bacteria 1336
194 Ga0207703_10093666 3300026035 Bacteria 2530
195 Ga0207639_10050741 3300026041 Bacteria 3152
196 Ga0207639_10193153 3300026041 Bacteria 1740
197 Ga0207639_10665553 3300026041 Bacteria 964
198 Ga0207678_10012646 3300026067 Bacteria 7415
199 Ga0207702_10911623 3300026078 Bacteria 871
200 Ga0207702_10947085 3300026078 Bacteria 854
201 Ga0207641_10186167 3300026088 Bacteria 1905
202 Ga0207648_10006195 3300026089 Bacteria 11911
203 Ga0207676_11050205 3300026095 Bacteria 804
204 Ga0207674_11137924 3300026116 Bacteria 750
205 Ga0207698_10007569 3300026142 Bacteria 6808
206 Ga0207698_10011414 3300026142 Bacteria 5760
207 Ga0207698_10446662 3300026142 Bacteria 1247
208 Ga0207698_10459207 3300026142 Bacteria 1231
209 Ga0207698_10598935 3300026142 Bacteria 1086
210 Ga0207698_10920759 3300026142 Bacteria 882
211 Ga0209281_1018936 3300027111 Bacteria 1367
212 Ga0209813_10000065 3300027866 Bacteria 42169
213 Ga0268266_10000256 3300028379 Bacteria 89436
214 Ga0268266_10000462 3300028379 Bacteria 59105
215 Ga0268266_10201578 3300028379 Bacteria 1821
216 Ga0268266_10402008 3300028379 Bacteria 1295
217 Ga0268266_10778065 3300028379 Bacteria 924
218 Ga0268265_10021814 3300028380 Bacteria 4492
219 Ga0268265_10024697 3300028380 Bacteria 4256
220 Ga0268264_10019326 3300028381 Bacteria 5568
221 Ga0268264_10115111 3300028381 Bacteria 2362
222 Ga0265340_10008055 3300031247 Bacteria 5707
223 Ga0307513_10192591 3300031456 Bacteria 1889
224 Ga0307408_100040196 3300031548 Bacteria 3311
225 Ga0307408_100076289 3300031548 Bacteria 2493
226 Ga0307410_10054461 3300031852 Bacteria 2712
227 Ga0307406_10060530 3300031901 Bacteria 2442
228 Ga0307412_10981214 3300031911 Bacteria 745
229 Ga0307409_100085897 3300031995 Bacteria 2559
230 Ga0307409_100467845 3300031995 Bacteria 1220
231 Ga0307416_100173903 3300032002 Bacteria 2009
232 Ga0307416_100415495 3300032002 Bacteria 1387
233 Ga0307416_102299698 3300032002 Bacteria 639
234 Ga0307414_10616199 3300032004 Bacteria 975
235 Ga0307411_10077624 3300032005 Bacteria 2274
236 Ga0307415_100108362 3300032126 Bacteria 2055
237 Ga0373932_0076954 3300035112 Bacteria 1046
238 Ga0373962_0092527 3300035242 Bacteria 933
239 Ga0395899_0017557 3300037312 Bacteria 5452
240 Ga0395899_0023565 3300037312 Bacteria 4660
241 Ga0395899_0094071 3300037312 Bacteria 2169
242 Ga0395900_0005612 3300037418 Bacteria 13121
243 Ga0395900_0031464 3300037418 Bacteria 5452
244 Ga0395900_0173581 3300037418 Bacteria 2193
245 Ga0395900_0371362 3300037418 Bacteria 1400
246 Ga0395900_0731733 3300037418 Bacteria 921
247 Ga0395898_0236477 3300037466 Bacteria 1742
248 Ga0395898_0239608 3300037466 Bacteria 1730
249 Ga0395898_1545567 3300037466 Bacteria 589
250 Ga0395905_0006568 3300037471 Bacteria 11683
251 Ga0395905_0047857 3300037471 Bacteria 4007
252 Ga0395905_0402935 3300037471 Bacteria 1263
253 Ga0395905_0501355 3300037471 Bacteria 1114
254 Ga0395905_0629815 3300037471 Bacteria 974
255 Ga0436364_0767650 3300037853 Bacteria 28654
256 Ga0436364_1493545 3300037853 Bacteria 778
257 Ga0395901_0042824 3300038443 Bacteria 4695
258 Ga0395901_0053353 3300038443 Bacteria 4200
259 Ga0395901_0351437 3300038443 Bacteria 1521
260 Ga0395901_0628983 3300038443 Bacteria 1079
261 Ga0451795_0047766 3300041456 Bacteria 706
262 Ga0451841_0169092 3300041498 Bacteria 877
263 Ga0451853_2738878 3300041512 Bacteria 738
264 Ga0466969_0091774 3300044656 Bacteria 1438
265 Ga0466969_0463773 3300044656 Bacteria 577
266 Ga0466966_0002694 3300044684 Bacteria 11641
267 Ga0466966_0028666 3300044684 Bacteria 3624
268 Ga0466961_0002989 3300044693 Bacteria 10500
269 Ga0466963_0236928 3300044694 Bacteria 1279
270 Ga0466963_0561052 3300044694 Bacteria 806
271 Ga0466971_0125497 3300044719 Bacteria 1189
272 Ga0466970_0115686 3300044765 Bacteria 1466
273 Ga0466957_0201754 3300044842 Bacteria 1306
274 Ga0466959_0043011 3300045049 Bacteria 3331
275 Ga0466959_0138895 3300045049 Bacteria 1718
276 Ga0466958_0001757 3300045836 Bacteria 10500
277 Ga0466958_0486751 3300045836 Bacteria 800
278 Ga0495638_0074690 3300046460 Bacteria 2067
279 Ga0495638_0108521 3300046460 Bacteria 1651
280 Ga0495643_0012885 3300046522 Bacteria 5030
281 Ga0495642_0195383 3300046528 Bacteria 882
282 Ga0495668_0011713 3300046616 Bacteria 5235
283 Ga0495668_0034863 3300046616 Bacteria 2821
284 Ga0495668_0316535 3300046616 Bacteria 856
285 Ga0495625_0068282 3300046660 Bacteria 2499
286 Ga0495625_0664999 3300046660 Bacteria 619
287 Ga0495669_0000425 3300046684 Bacteria 20076
288 Ga0495669_0007790 3300046684 Bacteria 4497
289 Ga0495669_0666846 3300046684 Bacteria 506
290 Ga0495686_0321938 3300047472 Bacteria 847
291 Ga0496100_0991521 3300048903 Unclassified 661
292 Ga0496102_0925135 3300048905 Bacteria 793
293 Ga0496102_1319428 3300048905 Bacteria 641
294 Ga0496103_0029626 3300048906 Bacteria 3327
295 Ga0496107_0324777 3300048910 Bacteria 1145
296 Ga0496108_0230774 3300048911 Bacteria 1609
297 Ga0496108_0305737 3300048911 Bacteria 1385
298 Ga0496109_0361460 3300048912 Bacteria 1371
299 Ga0496109_0716011 3300048912 Bacteria 938
300 Ga0496110_0386581 3300048913 Bacteria 1275
301 Ga0496110_0470344 3300048913 Bacteria 1145
302 Ga0496111_0121332 3300048914 Bacteria 1930
303 Ga0496112_0183733 3300048915 Bacteria 2055
304 Ga0496113_0255919 3300048916 Bacteria 1398
305 Ga0496116_0120041 3300048919 Bacteria 1524
306 Ga0496117_0068162 3300048920 Bacteria 2403
307 Ga0496117_0249745 3300048920 Bacteria 968
308 Ga0496120_0202519 3300048923 Bacteria 960
309 Ga0496121_0007534 3300048924 Bacteria 13124
310 Ga0496124_0198943 3300048927 Bacteria 1526
311 Ga0496124_0322821 3300048927 Bacteria 1104
312 Ga0496125_0028378 3300048928 Bacteria 5056
313 Ga0496126_0258662 3300048929 Bacteria 1448
314 Ga0501224_023135 3300049664 Bacteria 928
315 Ga0501253_041524 3300049683 Bacteria 929
316 Ga0501221_132729 3300049704 Bacteria 646
317 nmdc:mga03683_23520_c1 3300050489 Bacteria 2401
318 nmdc:mga03683_40_c2 3300050489 Bacteria 62024
319 nmdc:mga03683_6332_c2 3300050489 Bacteria 2104
320 nmdc:mga03n38_14649_c1 3300050490 Bacteria 3011
321 nmdc:mga03n38_592768_c1 3300050490 Bacteria 631
322 nmdc:mga00v17_23562_c1 3300050491 Bacteria 3561
323 nmdc:mga00v17_53171_c1 3300050491 Bacteria 2468
324 nmdc:mga0yw44_12750_c1 3300050492 Bacteria 4395
325 nmdc:mga0k408_67_c1 3300050493 Bacteria 51250
326 nmdc:mga0k408_69547_c1 3300050493 Bacteria 2055
327 nmdc:mga06z11_1164_c1 3300050494 Bacteria 9631
328 nmdc:mga04h51_179826_c1 3300050495 Bacteria 823
329 nmdc:mga04h51_216_c1 3300050495 Bacteria 15525
330 nmdc:mga07m45_23_c1 3300050496 Bacteria 115627
331 nmdc:mga07m45_52459_c1 3300050496 Bacteria 2302
332 nmdc:mga07m45_537358_c1 3300050496 Bacteria 676
333 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
334 nmdc:mga08y16_324302_c1 3300050511 Bacteria 1585
335 nmdc:mga0sz30_315_c2 3300050516 Bacteria 16720
336 nmdc:mga0sz30_53537_c1 3300050516 Bacteria 1715
337 nmdc:mga0sz30_722_c1 3300050516 Bacteria 12180
338 Ga0500643_000001 3300053087 Bacteria 1440111
339 Ga0500643_025805 3300053087 Bacteria 1848
340 Ga0500643_026945 3300053087 Bacteria 1793
341 Ga0500646_0268593 3300053090 Unclassified 605
342 Ga0500566_0114833 3300053094 Bacteria 1459
343 Ga0500555_003905 3300053103 Bacteria 4242
344 Ga0500556_0288268 3300053104 Bacteria 643
345 Ga0500594_0217146 3300053118 Bacteria 631
346 Ga0500607_002238 3300053121 Bacteria 15977
347 Ga0500607_046778 3300053121 Bacteria 2318
348 Ga0500608_141151 3300053122 Bacteria 1068
349 Ga0500559_0002061 3300053136 Bacteria 10751
350 Ga0500559_0027499 3300053136 Bacteria 2427
351 Ga0500559_0247725 3300053136 Bacteria 840
352 Ga0500564_359450 3300053138 Bacteria 539
353 Ga0500568_0083304 3300053139 Bacteria 1212
354 Ga0500590_070178 3300053148 Bacteria 1742
355 Ga0500616_0001676 3300053153 Bacteria 20414
356 Ga0500622_0009697 3300053156 Bacteria 5320
357 Ga0500625_147566 3300053729 Bacteria 892
358 Ga0500645_005354 3300053730 Bacteria 4745
359 Ga0500645_017483 3300053730 Bacteria 2247
360 Ga0500645_030214 3300053730 Bacteria 1631
361 Ga0466962_0005218 3300061719 Bacteria 6248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100086921 Ga0070670_1000869212 116
2 3300026142 Ga0207698_10920759 Ga0207698_109207592 122
3 3300025315 Ga0207697_10050083 Ga0207697_100500832 124
4 3300013102 Ga0157371_10363239 Ga0157371_103632392 127
5 3300037853 Ga0436364_1493545 Ga0436364_1493545_110_571 128
6 3300005293 Ga0065715_10238875 Ga0065715_102388752 129
7 3300005353 Ga0070669_101259084 Ga0070669_1012590841 129
8 3300005355 Ga0070671_100410850 Ga0070671_1004108502 129
9 3300005365 Ga0070688_101725046 Ga0070688_1017250461 129
10 3300025919 Ga0207657_10477669 Ga0207657_104776692 129
11 3300044684 Ga0466966_0028666 Ga0466966_0028666_963_1424 129
12 3300045049 Ga0466959_0138895 Ga0466959_0138895_1089_1550 129
13 3300005327 Ga0070658_10021251 Ga0070658_100212513 130
14 3300005331 Ga0070670_101327726 Ga0070670_1013277261 130
15 3300005334 Ga0068869_100040353 Ga0068869_1000403533 130
16 3300005335 Ga0070666_10074668 Ga0070666_100746682 130
17 3300005338 Ga0068868_100312812 Ga0068868_1003128123 130
18 3300005339 Ga0070660_100991778 Ga0070660_1009917781 130
19 3300005344 Ga0070661_100301784 Ga0070661_1003017842 130
20 3300005347 Ga0070668_100596857 Ga0070668_1005968573 130
21 3300005354 Ga0070675_100306135 Ga0070675_1003061351 130
22 3300005356 Ga0070674_100229878 Ga0070674_1002298782 130
23 3300005364 Ga0070673_100177445 Ga0070673_1001774451 130
24 3300005364 Ga0070673_100335536 Ga0070673_1003355362 130
25 3300005366 Ga0070659_100672567 Ga0070659_1006725673 130
26 3300005367 Ga0070667_100131563 Ga0070667_1001315633 130
27 3300005458 Ga0070681_11221668 Ga0070681_112216681 130
28 3300005543 Ga0070672_100061183 Ga0070672_1000611831 130
29 3300005544 Ga0070686_100052219 Ga0070686_1000522192 130
30 3300005616 Ga0068852_100030985 Ga0068852_1000309852 130
31 3300005616 Ga0068852_100048915 Ga0068852_1000489153 130
32 3300005718 Ga0068866_10042565 Ga0068866_100425652 130
33 3300005841 Ga0068863_100090224 Ga0068863_1000902242 130
34 3300005842 Ga0068858_100127615 Ga0068858_1001276153 130
35 3300006237 Ga0097621_100153847 Ga0097621_1001538472 130
36 3300009098 Ga0105245_10038581 Ga0105245_100385812 130
37 3300009176 Ga0105242_10299683 Ga0105242_102996833 130
38 3300009177 Ga0105248_10523285 Ga0105248_105232853 130
39 3300009551 Ga0105238_10262214 Ga0105238_102622142 130
40 3300010375 Ga0105239_10688017 Ga0105239_106880172 130
41 3300013105 Ga0157369_10888237 Ga0157369_108882372 130
42 3300013296 Ga0157374_10823353 Ga0157374_108233531 130
43 3300013296 Ga0157374_10869202 Ga0157374_108692021 130
44 3300013297 Ga0157378_10291232 Ga0157378_102912322 130
45 3300013297 Ga0157378_10565382 Ga0157378_105653822 130
46 3300013306 Ga0163162_10623759 Ga0163162_106237592 130
47 3300013308 Ga0157375_10121153 Ga0157375_101211533 130
48 3300014969 Ga0157376_10386440 Ga0157376_103864402 130
49 3300025903 Ga0207680_10176735 Ga0207680_101767352 130
50 3300025903 Ga0207680_10275699 Ga0207680_102756992 130
51 3300025907 Ga0207645_10084916 Ga0207645_100849162 130
52 3300025907 Ga0207645_10132231 Ga0207645_101322312 130
53 3300025909 Ga0207705_10031910 Ga0207705_100319103 130
54 3300025912 Ga0207707_10216900 Ga0207707_102169002 130
55 3300025919 Ga0207657_10879278 Ga0207657_108792781 130
56 3300025920 Ga0207649_11073915 Ga0207649_110739151 130
57 3300025923 Ga0207681_10961907 Ga0207681_109619072 130
58 3300025924 Ga0207694_10471136 Ga0207694_104711361 130
59 3300025926 Ga0207659_10156683 Ga0207659_101566832 130
60 3300025927 Ga0207687_10139906 Ga0207687_101399062 130
61 3300025931 Ga0207644_10098411 Ga0207644_100984113 130
62 3300025931 Ga0207644_10178122 Ga0207644_101781223 130
63 3300025932 Ga0207690_10572907 Ga0207690_105729071 130
64 3300025933 Ga0207706_10541166 Ga0207706_105411662 130
65 3300025938 Ga0207704_10433865 Ga0207704_104338652 130
66 3300025941 Ga0207711_10019821 Ga0207711_100198214 130
67 3300025941 Ga0207711_10345342 Ga0207711_103453422 130
68 3300025942 Ga0207689_10063037 Ga0207689_100630373 130
69 3300025960 Ga0207651_10235782 Ga0207651_102357823 130
70 3300025960 Ga0207651_10334401 Ga0207651_103344011 130
71 3300025981 Ga0207640_10107009 Ga0207640_101070093 130
72 3300025981 Ga0207640_10778894 Ga0207640_107788942 130
73 3300025986 Ga0207658_10068292 Ga0207658_100682923 130
74 3300026023 Ga0207677_10015901 Ga0207677_100159015 130
75 3300026023 Ga0207677_10295418 Ga0207677_102954183 130
76 3300026035 Ga0207703_10093666 Ga0207703_100936662 130
77 3300026041 Ga0207639_10193153 Ga0207639_101931532 130
78 3300026041 Ga0207639_10665553 Ga0207639_106655532 130
79 3300026088 Ga0207641_10186167 Ga0207641_101861672 130
80 3300026089 Ga0207648_10006195 Ga0207648_1000619510 130
81 3300026095 Ga0207676_11050205 Ga0207676_110502052 130
82 3300026116 Ga0207674_11137924 Ga0207674_111379242 130
83 3300026142 Ga0207698_10011414 Ga0207698_100114144 130
84 3300026142 Ga0207698_10446662 Ga0207698_104466623 130
85 3300026142 Ga0207698_10598935 Ga0207698_105989353 130
86 3300028379 Ga0268266_10201578 Ga0268266_102015782 130
87 3300028379 Ga0268266_10402008 Ga0268266_104020082 130
88 3300028379 Ga0268266_10778065 Ga0268266_107780652 130
89 3300035242 Ga0373962_0092527 Ga0373962_0092527_230_691 130
90 3300046616 Ga0495668_0011713 Ga0495668_0011713_680_1144 130
91 3300046684 Ga0495669_0007790 Ga0495669_0007790_592_1056 130
92 3300048903 Ga0496100_0991521 Ga0496100_0991521_67_528 130
93 3300048905 Ga0496102_0925135 Ga0496102_0925135_298_759 130
94 3300048910 Ga0496107_0324777 Ga0496107_0324777_197_658 130
95 3300048911 Ga0496108_0230774 Ga0496108_0230774_147_608 130
96 3300048911 Ga0496108_0305737 Ga0496108_0305737_71_532 130
97 3300048912 Ga0496109_0361460 Ga0496109_0361460_384_845 130
98 3300048912 Ga0496109_0716011 Ga0496109_0716011_349_810 130
99 3300048913 Ga0496110_0386581 Ga0496110_0386581_198_659 130
100 3300048913 Ga0496110_0470344 Ga0496110_0470344_501_962 130
101 3300048914 Ga0496111_0121332 Ga0496111_0121332_540_1001 130
102 3300048915 Ga0496112_0183733 Ga0496112_0183733_1017_1478 130
103 3300048916 Ga0496113_0255919 Ga0496113_0255919_82_543 130
104 3300046616 Ga0495668_0034863 Ga0495668_0034863_1774_2235 132
105 3300025917 Ga0207660_10226042 Ga0207660_102260422 134
106 3300037418 Ga0395900_0173581 Ga0395900_0173581_798_1259 134
107 3300037471 Ga0395905_0402935 Ga0395905_0402935_669_1130 134
108 3300038443 Ga0395901_0351437 Ga0395901_0351437_629_1090 134
109 3300005344 Ga0070661_101446974 Ga0070661_1014469741 135
110 3300046460 Ga0495638_0108521 Ga0495638_0108521_180_623 135
111 3300005331 Ga0070670_100069491 Ga0070670_1000694912 137
112 3300005335 Ga0070666_10444991 Ga0070666_104449912 137
113 3300005353 Ga0070669_100011083 Ga0070669_1000110832 137
114 3300005355 Ga0070671_100043824 Ga0070671_1000438244 137
115 3300005367 Ga0070667_100114202 Ga0070667_1001142023 137
116 3300005841 Ga0068863_100002473 Ga0068863_10000247315 137
117 3300005842 Ga0068858_100066440 Ga0068858_1000664402 137
118 3300005843 Ga0068860_100084759 Ga0068860_1000847592 137
119 3300005844 Ga0068862_100057161 Ga0068862_1000571613 137
120 3300005844 Ga0068862_100165534 Ga0068862_1001655342 137
121 3300006038 Ga0075365_10060856 Ga0075365_100608562 137
122 3300006042 Ga0075368_10020393 Ga0075368_100203932 137
123 3300006048 Ga0075363_100010112 Ga0075363_1000101122 137
124 3300006051 Ga0075364_10070852 Ga0075364_100708522 137
125 3300006177 Ga0075362_10003596 Ga0075362_100035962 137
126 3300006178 Ga0075367_10012128 Ga0075367_100121284 137
127 3300006186 Ga0075369_10017890 Ga0075369_100178902 137
128 3300006195 Ga0075366_10104925 Ga0075366_101049252 137
129 3300006353 Ga0075370_10332850 Ga0075370_103328502 137
130 3300006946 Ga0079104_1030900 Ga0079104_10309002 137
131 3300009011 Ga0105251_10017597 Ga0105251_100175973 137
132 3300009177 Ga0105248_10160651 Ga0105248_101606512 137
133 3300009177 Ga0105248_11468185 Ga0105248_114681852 137
134 3300017792 Ga0163161_10070834 Ga0163161_100708342 137
135 3300025735 Ga0207713_1004263 Ga0207713_10042634 137
136 3300025903 Ga0207680_10357463 Ga0207680_103574632 137
137 3300025931 Ga0207644_10000518 Ga0207644_100005184 137
138 3300025986 Ga0207658_10008557 Ga0207658_100085578 137
139 3300027111 Ga0209281_1018936 Ga0209281_10189362 137
140 3300027866 Ga0209813_10000065 Ga0209813_1000006535 137
141 3300028380 Ga0268265_10021814 Ga0268265_100218144 137
142 3300028380 Ga0268265_10024697 Ga0268265_100246972 137
143 3300028381 Ga0268264_10019326 Ga0268264_100193264 137
144 3300048905 Ga0496102_1319428 Ga0496102_1319428_166_585 137
145 3300048906 Ga0496103_0029626 Ga0496103_0029626_2600_3019 137
146 3300048919 Ga0496116_0120041 Ga0496116_0120041_805_1224 137
147 3300048920 Ga0496117_0068162 Ga0496117_0068162_522_941 137
148 3300048920 Ga0496117_0249745 Ga0496117_0249745_484_903 137
149 3300048923 Ga0496120_0202519 Ga0496120_0202519_282_701 137
150 3300048924 Ga0496121_0007534 Ga0496121_0007534_11519_11938 137
151 3300048927 Ga0496124_0198943 Ga0496124_0198943_383_799 137
152 3300048927 Ga0496124_0322821 Ga0496124_0322821_568_987 137
153 3300048928 Ga0496125_0028378 Ga0496125_0028378_2896_3315 137
154 3300048929 Ga0496126_0258662 Ga0496126_0258662_258_677 137
155 3300053138 Ga0500564_359450 Ga0500564_359450_28_444 137
156 3300037312 Ga0395899_0023565 Ga0395899_0023565_937_1398 138
157 3300037418 Ga0395900_0005612 Ga0395900_0005612_2272_2733 138
158 3300037466 Ga0395898_0236477 Ga0395898_0236477_623_1084 138
159 3300037466 Ga0395898_1545567 Ga0395898_1545567_114_575 138
160 3300037471 Ga0395905_0501355 Ga0395905_0501355_614_1075 138
161 3300038443 Ga0395901_0042824 Ga0395901_0042824_2194_2655 138
162 3300005334 Ga0068869_100543342 Ga0068869_1005433422 139
163 3300005844 Ga0068862_102518005 Ga0068862_1025180051 139
164 3300009148 Ga0105243_11669543 Ga0105243_116695431 139
165 3300025935 Ga0207709_10973642 Ga0207709_109736421 139
166 3300031995 Ga0307409_100467845 Ga0307409_1004678452 139
167 3300032002 Ga0307416_102299698 Ga0307416_1022996982 139
168 3300025925 Ga0207650_10433575 Ga0207650_104335752 142
169 3300026078 Ga0207702_10947085 Ga0207702_109470852 143
170 3300013296 Ga0157374_10516268 Ga0157374_105162682 145
171 3300005617 Ga0068859_100137571 Ga0068859_1001375711 146
172 3300006931 Ga0097620_100137568 Ga0097620_1001375681 146
173 3300009177 Ga0105248_10254269 Ga0105248_102542693 146
174 3300025941 Ga0207711_10096597 Ga0207711_100965973 146
175 3300053153 Ga0500616_0001676 Ga0500616_0001676_15410_15853 146
176 3300005545 Ga0070695_101048205 Ga0070695_1010482051 147
177 3300031247 Ga0265340_10008055 Ga0265340_100080552 147
178 3300031456 Ga0307513_10192591 Ga0307513_101925912 147
179 3300047472 Ga0495686_0321938 Ga0495686_0321938_151_627 147
180 3300053090 Ga0500646_0268593 Ga0500646_0268593_69_518 147
181 3300053103 Ga0500555_003905 Ga0500555_003905_2433_2912 147
182 3300005355 Ga0070671_100284318 Ga0070671_1002843182 149
183 3300005367 Ga0070667_100000913 Ga0070667_10000091323 149
184 3300005843 Ga0068860_100156818 Ga0068860_1001568182 149
185 3300006186 Ga0075369_10035128 Ga0075369_100351284 149
186 3300025923 Ga0207681_10000336 Ga0207681_1000033631 149
187 3300025986 Ga0207658_10000925 Ga0207658_1000092515 149
188 3300028379 Ga0268266_10000462 Ga0268266_1000046215 149
189 3300028381 Ga0268264_10115111 Ga0268264_101151112 149
190 3300035112 Ga0373932_0076954 Ga0373932_0076954_367_822 149
191 3300041512 Ga0451853_2738878 Ga0451853_2738878_178_633 149
192 3300050516 nmdc:mga0sz30_53537_c1 nmdc:mga0sz30_53537_c1_1156_1608 149
193 3300053136 Ga0500559_0247725 Ga0500559_0247725_30_485 149
194 3300053148 Ga0500590_070178 Ga0500590_070178_592_1047 149
195 3300053729 Ga0500625_147566 Ga0500625_147566_128_583 149
196 3300005366 Ga0070659_100681328 Ga0070659_1006813282 150
197 3300006042 Ga0075368_10212612 Ga0075368_102126122 150
198 3300006048 Ga0075363_100000173 Ga0075363_10000017315 150
199 3300006051 Ga0075364_10016248 Ga0075364_100162485 150
200 3300006177 Ga0075362_10000007 Ga0075362_1000000780 150
201 3300006186 Ga0075369_10001870 Ga0075369_100018702 150
202 3300006195 Ga0075366_10000068 Ga0075366_100000689 150
203 3300006353 Ga0075370_10000030 Ga0075370_1000003026 150
204 3300009094 Ga0111539_10226262 Ga0111539_102262622 150
205 3300025901 Ga0207688_10441131 Ga0207688_104411312 150
206 3300041498 Ga0451841_0169092 Ga0451841_0169092_144_602 150
207 3300046616 Ga0495668_0316535 Ga0495668_0316535_221_679 150
208 3300049664 Ga0501224_023135 Ga0501224_023135_367_825 150
209 3300049683 Ga0501253_041524 Ga0501253_041524_205_663 150
210 3300050489 nmdc:mga03683_40_c2 nmdc:mga03683_40_c2_57308_57766 150
211 3300050489 nmdc:mga03683_6332_c2 nmdc:mga03683_6332_c2_1591_2046 150
212 3300050490 nmdc:mga03n38_14649_c1 nmdc:mga03n38_14649_c1_1332_1790 150
213 3300050491 nmdc:mga00v17_23562_c1 nmdc:mga00v17_23562_c1_1514_1969 150
214 3300050493 nmdc:mga0k408_67_c1 nmdc:mga0k408_67_c1_9571_10029 150
215 3300050495 nmdc:mga04h51_179826_c1 nmdc:mga04h51_179826_c1_297_755 150
216 3300050496 nmdc:mga07m45_52459_c1 nmdc:mga07m45_52459_c1_1499_1957 150
217 3300050496 nmdc:mga07m45_8_c1 nmdc:mga07m45_8_c1_73006_73464 150
218 3300050511 nmdc:mga08y16_324302_c1 nmdc:mga08y16_324302_c1_529_987 150
219 3300050516 nmdc:mga0sz30_315_c2 nmdc:mga0sz30_315_c2_9934_10392 150
220 3300053087 Ga0500643_026945 Ga0500643_026945_625_1083 150
221 3300053094 Ga0500566_0114833 Ga0500566_0114833_68_526 150
222 3300053121 Ga0500607_002238 Ga0500607_002238_1057_1515 150
223 3300053122 Ga0500608_141151 Ga0500608_141151_146_604 150
224 3300053136 Ga0500559_0027499 Ga0500559_0027499_1124_1582 150
225 3300053139 Ga0500568_0083304 Ga0500568_0083304_244_699 150
226 3300053730 Ga0500645_017483 Ga0500645_017483_896_1354 150
227 3300001904 JGI24736J21556_1000198 JGI24736J21556_100019811 151
228 3300002067 JGI24735J21928_10052236 JGI24735J21928_100522362 151
229 3300003320 rootH2_10112850 rootH2_101128501 151
230 3300005327 Ga0070658_10037757 Ga0070658_100377574 151
231 3300005327 Ga0070658_10058617 Ga0070658_100586173 151
232 3300005327 Ga0070658_10153960 Ga0070658_101539602 151
233 3300005327 Ga0070658_10337480 Ga0070658_103374802 151
234 3300005327 Ga0070658_11269668 Ga0070658_112696681 151
235 3300005331 Ga0070670_100190679 Ga0070670_1001906794 151
236 3300005336 Ga0070680_101968601 Ga0070680_1019686011 151
237 3300005338 Ga0068868_100019275 Ga0068868_1000192755 151
238 3300005339 Ga0070660_100250779 Ga0070660_1002507792 151
239 3300005339 Ga0070660_100383464 Ga0070660_1003834643 151
240 3300005339 Ga0070660_100391105 Ga0070660_1003911051 151
241 3300005339 Ga0070660_100497774 Ga0070660_1004977742 151
242 3300005339 Ga0070660_100509269 Ga0070660_1005092692 151
243 3300005344 Ga0070661_100749742 Ga0070661_1007497422 151
244 3300005344 Ga0070661_101696372 Ga0070661_1016963721 151
245 3300005366 Ga0070659_100128277 Ga0070659_1001282772 151
246 3300005366 Ga0070659_100622828 Ga0070659_1006228282 151
247 3300005366 Ga0070659_100790957 Ga0070659_1007909571 151
248 3300005366 Ga0070659_101279190 Ga0070659_1012791901 151
249 3300005455 Ga0070663_100007649 Ga0070663_1000076495 151
250 3300005530 Ga0070679_100540966 Ga0070679_1005409661 151
251 3300005530 Ga0070679_100605916 Ga0070679_1006059162 151
252 3300005530 Ga0070679_100667248 Ga0070679_1006672481 151
253 3300005530 Ga0070679_100682872 Ga0070679_1006828721 151
254 3300005535 Ga0070684_101807981 Ga0070684_1018079811 151
255 3300005539 Ga0068853_100141396 Ga0068853_1001413963 151
256 3300005539 Ga0068853_100695405 Ga0068853_1006954052 151
257 3300005548 Ga0070665_100000380 Ga0070665_10000038063 151
258 3300005548 Ga0070665_100524010 Ga0070665_1005240102 151
259 3300005564 Ga0070664_100713630 Ga0070664_1007136302 151
260 3300005616 Ga0068852_100218526 Ga0068852_1002185263 151
261 3300005616 Ga0068852_100865908 Ga0068852_1008659081 151
262 3300009093 Ga0105240_10314262 Ga0105240_103142623 151
263 3300009551 Ga0105238_11081054 Ga0105238_110810541 151
264 3300013100 Ga0157373_10014410 Ga0157373_100144104 151
265 3300013100 Ga0157373_10268047 Ga0157373_102680472 151
266 3300013104 Ga0157370_10100333 Ga0157370_101003333 151
267 3300013105 Ga0157369_10000751 Ga0157369_1000075128 151
268 3300013296 Ga0157374_10204252 Ga0157374_102042524 151
269 3300021388 Ga0213875_10003627 Ga0213875_100036275 151
270 3300025904 Ga0207647_10023526 Ga0207647_100235263 151
271 3300025909 Ga0207705_10045859 Ga0207705_100458593 151
272 3300025909 Ga0207705_10071263 Ga0207705_100712634 151
273 3300025909 Ga0207705_10114819 Ga0207705_101148194 151
274 3300025909 Ga0207705_10166334 Ga0207705_101663342 151
275 3300025909 Ga0207705_10826008 Ga0207705_108260081 151
276 3300025913 Ga0207695_10003918 Ga0207695_100039183 151
277 3300025913 Ga0207695_10272231 Ga0207695_102722312 151
278 3300025917 Ga0207660_11607140 Ga0207660_116071401 151
279 3300025919 Ga0207657_10158083 Ga0207657_101580832 151
280 3300025919 Ga0207657_10247620 Ga0207657_102476202 151
281 3300025920 Ga0207649_10143068 Ga0207649_101430682 151
282 3300025920 Ga0207649_10591722 Ga0207649_105917222 151
283 3300025921 Ga0207652_10076046 Ga0207652_100760462 151
284 3300025921 Ga0207652_10087145 Ga0207652_100871451 151
285 3300025921 Ga0207652_10276311 Ga0207652_102763112 151
286 3300025921 Ga0207652_10572983 Ga0207652_105729833 151
287 3300025932 Ga0207690_10038248 Ga0207690_100382482 151
288 3300025932 Ga0207690_10360227 Ga0207690_103602272 151
289 3300025944 Ga0207661_11766224 Ga0207661_117662241 151
290 3300025949 Ga0207667_10119934 Ga0207667_101199344 151
291 3300025981 Ga0207640_10002112 Ga0207640_1000211212 151
292 3300026041 Ga0207639_10050741 Ga0207639_100507414 151
293 3300026067 Ga0207678_10012646 Ga0207678_100126463 151
294 3300026078 Ga0207702_10911623 Ga0207702_109116233 151
295 3300026142 Ga0207698_10007569 Ga0207698_100075693 151
296 3300026142 Ga0207698_10459207 Ga0207698_104592072 151
297 3300028379 Ga0268266_10000256 Ga0268266_1000025639 151
298 3300031548 Ga0307408_100040196 Ga0307408_1000401962 151
299 3300031548 Ga0307408_100076289 Ga0307408_1000762892 151
300 3300031852 Ga0307410_10054461 Ga0307410_100544612 151
301 3300031901 Ga0307406_10060530 Ga0307406_100605302 151
302 3300031911 Ga0307412_10981214 Ga0307412_109812142 151
303 3300031995 Ga0307409_100085897 Ga0307409_1000858973 151
304 3300032002 Ga0307416_100173903 Ga0307416_1001739032 151
305 3300032002 Ga0307416_100415495 Ga0307416_1004154952 151
306 3300032004 Ga0307414_10616199 Ga0307414_106161992 151
307 3300032005 Ga0307411_10077624 Ga0307411_100776242 151
308 3300032126 Ga0307415_100108362 Ga0307415_1001083622 151
309 3300037312 Ga0395899_0017557 Ga0395899_0017557_3851_4309 151
310 3300037312 Ga0395899_0094071 Ga0395899_0094071_1378_1839 151
311 3300037418 Ga0395900_0031464 Ga0395900_0031464_783_1244 151
312 3300037418 Ga0395900_0371362 Ga0395900_0371362_314_772 151
313 3300037418 Ga0395900_0731733 Ga0395900_0731733_431_895 151
314 3300037466 Ga0395898_0239608 Ga0395898_0239608_621_1076 151
315 3300037471 Ga0395905_0006568 Ga0395905_0006568_590_1051 151
316 3300037471 Ga0395905_0047857 Ga0395905_0047857_440_904 151
317 3300037471 Ga0395905_0629815 Ga0395905_0629815_411_875 151
318 3300037853 Ga0436364_0767650 Ga0436364_0767650_20555_21016 151
319 3300038443 Ga0395901_0053353 Ga0395901_0053353_1791_2252 151
320 3300038443 Ga0395901_0628983 Ga0395901_0628983_34_495 151
321 3300041456 Ga0451795_0047766 Ga0451795_0047766_216_677 151
322 3300044656 Ga0466969_0091774 Ga0466969_0091774_431_889 151
323 3300044656 Ga0466969_0463773 Ga0466969_0463773_90_548 151
324 3300044684 Ga0466966_0002694 Ga0466966_0002694_5237_5695 151
325 3300044693 Ga0466961_0002989 Ga0466961_0002989_608_1066 151
326 3300044694 Ga0466963_0236928 Ga0466963_0236928_261_719 151
327 3300044694 Ga0466963_0561052 Ga0466963_0561052_123_581 151
328 3300044719 Ga0466971_0125497 Ga0466971_0125497_366_824 151
329 3300044765 Ga0466970_0115686 Ga0466970_0115686_456_914 151
330 3300044842 Ga0466957_0201754 Ga0466957_0201754_419_877 151
331 3300045049 Ga0466959_0043011 Ga0466959_0043011_1672_2130 151
332 3300045836 Ga0466958_0001757 Ga0466958_0001757_9435_9893 151
333 3300045836 Ga0466958_0486751 Ga0466958_0486751_258_716 151
334 3300046460 Ga0495638_0074690 Ga0495638_0074690_798_1259 151
335 3300046522 Ga0495643_0012885 Ga0495643_0012885_2728_3189 151
336 3300046528 Ga0495642_0195383 Ga0495642_0195383_308_769 151
337 3300046660 Ga0495625_0068282 Ga0495625_0068282_1090_1551 151
338 3300046660 Ga0495625_0664999 Ga0495625_0664999_109_594 151
339 3300046684 Ga0495669_0000425 Ga0495669_0000425_9603_10067 151
340 3300046684 Ga0495669_0666846 Ga0495669_0666846_11_475 151
341 3300049704 Ga0501221_132729 Ga0501221_132729_51_512 151
342 3300050489 nmdc:mga03683_23520_c1 nmdc:mga03683_23520_c1_372_833 151
343 3300050490 nmdc:mga03n38_592768_c1 nmdc:mga03n38_592768_c1_98_559 151
344 3300050491 nmdc:mga00v17_53171_c1 nmdc:mga00v17_53171_c1_678_1139 151
345 3300050492 nmdc:mga0yw44_12750_c1 nmdc:mga0yw44_12750_c1_3381_3842 151
346 3300050493 nmdc:mga0k408_69547_c1 nmdc:mga0k408_69547_c1_1187_1648 151
347 3300050494 nmdc:mga06z11_1164_c1 nmdc:mga06z11_1164_c1_7675_8136 151
348 3300050495 nmdc:mga04h51_216_c1 nmdc:mga04h51_216_c1_1443_1904 151
349 3300050496 nmdc:mga07m45_23_c1 nmdc:mga07m45_23_c1_16786_17247 151
350 3300050496 nmdc:mga07m45_537358_c1 nmdc:mga07m45_537358_c1_18_479 151
351 3300050516 nmdc:mga0sz30_722_c1 nmdc:mga0sz30_722_c1_10488_10949 151
352 3300053087 Ga0500643_000001 Ga0500643_000001_284039_284500 151
353 3300053087 Ga0500643_025805 Ga0500643_025805_162_623 151
354 3300053104 Ga0500556_0288268 Ga0500556_0288268_125_586 151
355 3300053118 Ga0500594_0217146 Ga0500594_0217146_96_560 151
356 3300053121 Ga0500607_046778 Ga0500607_046778_703_1164 151
357 3300053136 Ga0500559_0002061 Ga0500559_0002061_1727_2188 151
358 3300053156 Ga0500622_0009697 Ga0500622_0009697_3192_3653 151
359 3300053730 Ga0500645_005354 Ga0500645_005354_1427_1891 151
360 3300053730 Ga0500645_030214 Ga0500645_030214_947_1408 151
361 3300061719 Ga0466962_0005218 Ga0466962_0005218_5239_5697 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04657

DMT_YdcZ

Putative inner membrane exporter, YdcZ

18

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f36-assembly1.cif.gz_M polytomella fo model 0.3635 29 148
6f36-assembly1.cif.gz_M polytomella fo model 0.2917 29 148
3ux4-assembly1.cif.gz_A crystal structure of the urea channel from the human gastric pathogen helicobacter pylori 0.2904 22 148
3ux4-assembly1.cif.gz_A crystal structure of the urea channel from the human gastric pathogen helicobacter pylori 0.2588 22 148
6uez-assembly2.cif.gz_B human sterol 14a-demethylase (cyp51) in complex with the substrate lanosterol 0.253 82 144
ID Description Score Start End Superfamily
af_P76111_5_143_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7737 11 145 1.20.1250.20
af_P76111_5_143_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7483 11 145 1.20.1250.20
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7058 13 146 1.25.10.10
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6721 13 146 1.25.10.10
af_Q2FUS1_154_287_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6667 13 146 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A2A4V5N5-F1-model_v4 DMT family transporter 0.9676 16 151 GO:0005886
AF-A0A222X6G8-F1-model_v4 deleted 0.9642 16 151
AF-A0A2D5YLC1-F1-model_v4 EamA-like transporter family protein 0.9635 7 146 GO:0005886
AF-A0A0N1BGD9-F1-model_v4 Amidophosphoribosyltransferase 0.961 3 151 GO:0005886
AF-A0A7W2GQ05-F1-model_v4 DMT family transporter 0.9582 6 149 GO:0005886

Feature Viewer

pLDDT pTM Quality
86.52 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map