F422259

General Info

Members Datasets Scaffolds Average Seq Length
361 213 722 271

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10039639|Ga0207428_100396393
Length 313
Sequence MADVRRRALLSNGLLGAAAVVTLAALGASCSPGPKEDAVKRQKYKYGDHPSQWGELFLPEPPPVSPSRSKHTVTRGVVVVIHGGYWRSQYGAELGEPIAKDLAAHGMAAWNLEYRRAGNGGGWPHTFEDVLAGIDKLRGIADEHGLDISRVVALGHSAGGHLAVWAAGRDRLAGLGTPDADRQVLRNLNGEAVHLTGVVSQSGLLNLAQADWLDLSNGAVSNLMGGSSGKYPKRHKYADPMSAVPLDVPIYAVHGLEDDTVPMSQSEAYVAAARAAGAPVQVVKVPGDHFALIDPKASSYRKCRELVQELLGL

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
90 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
91 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
92 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
100 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
101 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
102 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
187 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
188 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
189 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
190 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
191 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
192 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
193 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
194 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
195 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
196 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
197 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
198 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
199 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
200 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
201 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
202 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
203 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
204 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
205 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
206 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
207 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
208 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
209 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
210 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
211 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
212 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
213 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.69
Metatranscriptomes 0.55
Isolates 7.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 9.97
Nodule 0
Rhizoplane 8.03
Rhizosphere 75.9
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10039639 3300027907 Bacteria 3826
2 LJQas_1000458 3300000549 Bacteria 6771
3 LJQas_1002286 3300000549 Bacteria 2696
4 rootH2_10042505 3300003320 Bacteria 6336
5 rootL2_10254463 3300003322 Bacteria 2842
6 Ga0006562J51391_1017489 3300003578 Bacteria 1790
7 Ga0058860_10731936 3300004801 Bacteria 2112
8 Ga0065714_10014685 3300005288 Bacteria 2282
9 Ga0070676_10030615 3300005328 Bacteria 3070
10 Ga0070666_10037323 3300005335 Bacteria 3230
11 Ga0070668_100018181 3300005347 Bacteria 5274
12 Ga0070669_100104685 3300005353 Bacteria 2139
13 Ga0070671_100025409 3300005355 Bacteria 4859
14 Ga0070674_100067914 3300005356 Bacteria 2509
15 Ga0070674_100209162 3300005356 Bacteria 1511
16 Ga0070673_100386649 3300005364 Bacteria 1248
17 Ga0070667_100089098 3300005367 Bacteria 2650
18 Ga0070714_100086096 3300005435 Bacteria 2746
19 Ga0070713_100006115 3300005436 Bacteria 8305
20 Ga0070700_100130941 3300005441 Bacteria 1693
21 Ga0070665_100071239 3300005548 Bacteria 3482
22 Ga0068860_100003892 3300005843 Bacteria 15343
23 Ga0070717_10169333 3300006028 Bacteria 1899
24 Ga0075365_10011196 3300006038 Bacteria 5266
25 Ga0075365_10015356 3300006038 Bacteria 4632
26 Ga0075365_10022060 3300006038 Bacteria 3983
27 Ga0075365_10024139 3300006038 Bacteria 3831
28 Ga0075365_10184377 3300006038 Bacteria 1460
29 Ga0075368_10000543 3300006042 Bacteria 11314
30 Ga0075368_10005416 3300006042 Bacteria 4386
31 Ga0075363_100000422 3300006048 Bacteria 13172
32 Ga0075364_10001142 3300006051 Bacteria 14190
33 Ga0075364_10009495 3300006051 Bacteria 5840
34 Ga0075364_10017390 3300006051 Bacteria 4491
35 Ga0075364_10034961 3300006051 Bacteria 3246
36 Ga0075432_10004608 3300006058 Bacteria 4693
37 Ga0075362_10002282 3300006177 Bacteria 6395
38 Ga0075367_10021392 3300006178 Bacteria 3614
39 Ga0075370_10004354 3300006353 Bacteria 6863
40 Ga0075435_100307557 3300007076 Unclassified 1356
41 Ga0105251_10006497 3300009011 Bacteria 7433
42 Ga0105244_10032112 3300009036 Bacteria 2782
43 Ga0105244_10034876 3300009036 Bacteria 2646
44 Ga0105245_10210731 3300009098 Bacteria 1870
45 Ga0105245_10231736 3300009098 Bacteria 1786
46 Ga0105243_10107122 3300009148 Bacteria 2330
47 Ga0105243_10203283 3300009148 Bacteria 1739
48 Ga0105243_10315607 3300009148 Bacteria 1422
49 Ga0105242_10169492 3300009176 Bacteria 1917
50 Ga0105248_10028445 3300009177 Bacteria 6227
51 Ga0105238_10030798 3300009551 Bacteria 5461
52 Ga0105246_10002200 3300011119 Bacteria 11766
53 Ga0105246_10003204 3300011119 Bacteria 9938
54 Ga0105246_10012740 3300011119 Bacteria 5256
55 Ga0105246_10107666 3300011119 Bacteria 2042
56 Ga0105246_10228250 3300011119 Bacteria 1464
57 Ga0105246_10423492 3300011119 Bacteria 1112
58 Ga0157373_10034627 3300013100 Bacteria 3627
59 Ga0157369_10018881 3300013105 Bacteria 7726
60 Ga0157369_10093294 3300013105 Bacteria 3213
61 Ga0163162_10021734 3300013306 Bacteria 6319
62 Ga0157372_10374715 3300013307 Bacteria 1659
63 Ga0157375_10166668 3300013308 Bacteria 2348
64 Ga0207425_1008570 3300025245 Bacteria 2607
65 Ga0209759_1031673 3300025256 Bacteria 1027
66 Ga0209129_1000052 3300025258 Bacteria 265251
67 Ga0207673_1002907 3300025290 Bacteria 1981
68 Ga0209025_1000570 3300025294 Bacteria 67028
69 Ga0209051_1001747 3300025303 Bacteria 17311
70 Ga0207697_10002740 3300025315 Bacteria 8982
71 Ga0207697_10010888 3300025315 Bacteria 3867
72 Ga0207655_1005761 3300025728 Bacteria 8346
73 Ga0207655_1007824 3300025728 Bacteria 6880
74 Ga0207713_1037422 3300025735 Bacteria 2069
75 Ga0207682_10001160 3300025893 Bacteria 12230
76 Ga0207688_10050660 3300025901 Bacteria 2325
77 Ga0207645_10033261 3300025907 Bacteria 3314
78 Ga0207694_10076816 3300025924 Bacteria 2616
79 Ga0207659_10398106 3300025926 Bacteria 1151
80 Ga0207687_10060496 3300025927 Bacteria 2672
81 Ga0207700_10063377 3300025928 Bacteria 2811
82 Ga0207664_10029484 3300025929 Bacteria 4180
83 Ga0207644_10405109 3300025931 Bacteria 1115
84 Ga0207709_10011144 3300025935 Bacteria 4958
85 Ga0207709_10097802 3300025935 Bacteria 1934
86 Ga0207669_10154404 3300025937 Bacteria 1612
87 Ga0207691_10004831 3300025940 Bacteria 13037
88 Ga0207691_10614971 3300025940 Bacteria 919
89 Ga0207661_10105949 3300025944 Bacteria 2370
90 Ga0207708_10446891 3300026075 Bacteria 1076
91 Ga0207675_100087908 3300026118 Bacteria 2919
92 Ga0209813_10005592 3300027866 Bacteria 3061
93 Ga0209813_10010726 3300027866 Bacteria 2378
94 Ga0207428_10109028 3300027907 Bacteria 2132
95 Ga0268264_10000226 3300028381 Bacteria 109817
96 Ga0316181_1194174 3300030744 Bacteria 1526
97 Ga0307408_100002796 3300031548 Bacteria 12114
98 Ga0307408_100015576 3300031548 Bacteria 5063
99 Ga0307408_100094647 3300031548 Bacteria 2262
100 Ga0307408_100102145 3300031548 Bacteria 2186
101 Ga0307408_100130652 3300031548 Bacteria 1958
102 Ga0307408_100289347 3300031548 Bacteria 1367
103 Ga0307408_100296673 3300031548 Bacteria 1352
104 Ga0307405_10000458 3300031731 Bacteria 15367
105 Ga0307405_10002207 3300031731 Bacteria 8504
106 Ga0307405_10004728 3300031731 Bacteria 6482
107 Ga0307405_10061999 3300031731 Bacteria 2366
108 Ga0307405_10113959 3300031731 Bacteria 1836
109 Ga0307405_10244345 3300031731 Bacteria 1331
110 Ga0307413_10000873 3300031824 Bacteria 10661
111 Ga0307413_10013035 3300031824 Bacteria 4160
112 Ga0307413_10051380 3300031824 Bacteria 2483
113 Ga0307413_10059038 3300031824 Bacteria 2355
114 Ga0307413_10089175 3300031824 Bacteria 2003
115 Ga0307413_10108634 3300031824 Bacteria 1852
116 Ga0307413_10157967 3300031824 Bacteria 1589
117 Ga0307413_10372752 3300031824 Bacteria 1109
118 Ga0307413_10433489 3300031824 Bacteria 1038
119 Ga0307410_10000390 3300031852 Bacteria 17305
120 Ga0307410_10073428 3300031852 Bacteria 2379
121 Ga0307410_10088948 3300031852 Bacteria 2187
122 Ga0307410_10092245 3300031852 Bacteria 2152
123 Ga0307410_10290508 3300031852 Bacteria 1286
124 Ga0307410_10322768 3300031852 Bacteria 1226
125 Ga0307406_10009091 3300031901 Bacteria 5560
126 Ga0307406_10015278 3300031901 Bacteria 4439
127 Ga0307406_10064798 3300031901 Bacteria 2373
128 Ga0307406_10130819 3300031901 Bacteria 1761
129 Ga0307406_10237291 3300031901 Bacteria 1365
130 Ga0307407_10012651 3300031903 Bacteria 4064
131 Ga0307407_10023193 3300031903 Bacteria 3234
132 Ga0307407_10039657 3300031903 Bacteria 2620
133 Ga0307407_10072855 3300031903 Bacteria 2050
134 Ga0307407_10104535 3300031903 Bacteria 1765
135 Ga0307412_10003269 3300031911 Bacteria 8996
136 Ga0307412_10022563 3300031911 Bacteria 3860
137 Ga0307412_10054766 3300031911 Bacteria 2649
138 Ga0307412_10074309 3300031911 Bacteria 2328
139 Ga0307412_10106152 3300031911 Bacteria 1996
140 Ga0307412_10109019 3300031911 Bacteria 1973
141 Ga0307412_10121499 3300031911 Bacteria 1881
142 Ga0307412_10156995 3300031911 Bacteria 1685
143 Ga0307412_10295680 3300031911 Bacteria 1277
144 Ga0307412_10337179 3300031911 Bacteria 1205
145 Ga0307409_100000425 3300031995 Bacteria 17952
146 Ga0307409_100240573 3300031995 Bacteria 1647
147 Ga0307409_100260296 3300031995 Bacteria 1592
148 Ga0307416_100001032 3300032002 Bacteria 14789
149 Ga0307416_100002357 3300032002 Bacteria 10804
150 Ga0307416_100030038 3300032002 Bacteria 4072
151 Ga0307416_100086736 3300032002 Bacteria 2669
152 Ga0307416_100600191 3300032002 Bacteria 1180
153 Ga0307414_10092663 3300032004 Bacteria 2250
154 Ga0307414_10222942 3300032004 Bacteria 1549
155 Ga0307411_10009802 3300032005 Bacteria 5063
156 Ga0307411_10011132 3300032005 Bacteria 4836
157 Ga0307411_10359427 3300032005 Bacteria 1190
158 Ga0307415_100008819 3300032126 Bacteria 5613
159 Ga0307415_100029979 3300032126 Bacteria 3484
160 Ga0395899_0010447 3300037312 Bacteria 7111
161 Ga0395899_0116032 3300037312 Bacteria 1921
162 Ga0395900_0030356 3300037418 Bacteria 5550
163 Ga0395900_0294005 3300037418 Bacteria 1612
164 Ga0395898_0008123 3300037466 Bacteria 11109
165 Ga0395898_0358976 3300037466 Bacteria 1389
166 Ga0395898_0537239 3300037466 Bacteria 1111
167 Ga0395901_0101958 3300038443 Bacteria 3012
168 Ga0395901_0167649 3300038443 Bacteria 2305
169 Ga0436363_0675390 3300039450 Bacteria 11020
170 Ga0436362_1064434 3300039453 Unclassified 2582
171 Ga0439436_0001112 3300041404 Bacteria 7596
172 Ga0439436_0026587 3300041404 Bacteria 1696
173 Ga0439436_0028982 3300041404 Bacteria 1613
174 Ga0439438_003101 3300041405 Bacteria 6836
175 Ga0439439_0001623 3300041406 Bacteria 4540
176 Ga0439439_0004235 3300041406 Bacteria 3220
177 Ga0439466_0002998 3300041411 Bacteria 6586
178 Ga0439466_0018730 3300041411 Bacteria 2482
179 Ga0439466_0026119 3300041411 Bacteria 2034
180 Ga0439465_0014352 3300041413 Bacteria 2469
181 Ga0439433_0000125 3300041999 Bacteria 11194
182 Ga0439433_0000266 3300041999 Bacteria 8844
183 Ga0439433_0047448 3300041999 Bacteria 1008
184 Ga0439442_000296 3300042002 Bacteria 12039
185 Ga0439442_000321 3300042002 Bacteria 11484
186 Ga0439442_000493 3300042002 Bacteria 8907
187 Ga0439442_008828 3300042002 Bacteria 2036
188 Ga0439445_0057152 3300042004 Bacteria 1062
189 Ga0439432_001313 3300042006 Bacteria 9413
190 Ga0439449_0001186 3300042007 Bacteria 10223
191 Ga0439449_0002321 3300042007 Bacteria 7456
192 Ga0439449_0023980 3300042007 Bacteria 2281
193 Ga0439449_0042157 3300042007 Bacteria 1696
194 Ga0439449_0066636 3300042007 Bacteria 1328
195 Ga0439449_0072033 3300042007 Bacteria 1273
196 Ga0439452_002200 3300042010 Bacteria 7346
197 Ga0439452_031342 3300042010 Bacteria 1305
198 Ga0439457_001087 3300042014 Bacteria 8198
199 Ga0439457_001890 3300042014 Bacteria 6178
200 Ga0439457_007482 3300042014 Bacteria 2619
201 Ga0439457_009866 3300042014 Bacteria 2211
202 Ga0450919_001909 3300042121 Bacteria 2707
203 Ga0450920_004475 3300042122 Bacteria 2456
204 Ga0450920_005966 3300042122 Bacteria 2179
205 Ga0450907_000260 3300042146 Bacteria 17972
206 Ga0450907_003509 3300042146 Bacteria 2790
207 Ga0439446_0011806 3300042156 Bacteria 2377
208 Ga0439446_0044454 3300042156 Bacteria 1314
209 Ga0450908_001609 3300042184 Bacteria 4389
210 Ga0439434_0000203 3300042435 Bacteria 16458
211 Ga0439434_0005250 3300042435 Bacteria 3788
212 Ga0439434_0008227 3300042435 Bacteria 3058
213 Ga0450918_002430 3300042531 Bacteria 3522
214 Ga0450918_004688 3300042531 Bacteria 2479
215 Ga0466958_0140588 3300045836 Bacteria 1520
216 Ga0466967_0399540 3300045976 Bacteria 1337
217 Ga0495653_0063927 3300046463 Bacteria 2774
218 Ga0495580_0012981 3300046472 Bacteria 6378
219 Ga0495580_0078024 3300046472 Bacteria 2310
220 Ga0495582_0012248 3300046473 Bacteria 4725
221 Ga0495639_0001933 3300046475 Bacteria 9195
222 Ga0495662_0016395 3300046476 Bacteria 3589
223 Ga0495664_0001998 3300046477 Bacteria 10878
224 Ga0495610_0087366 3300046512 Bacteria 1419
225 Ga0495642_0013229 3300046528 Bacteria 3189
226 Ga0495654_0054469 3300046530 Bacteria 1940
227 Ga0495665_0005440 3300046531 Bacteria 6859
228 Ga0495665_0030475 3300046531 Bacteria 2887
229 Ga0495586_0004429 3300046535 Bacteria 7501
230 Ga0495587_0002009 3300046536 Bacteria 13568
231 Ga0495598_0070763 3300046537 Bacteria 1098
232 Ga0495645_0008568 3300046543 Bacteria 7141
233 Ga0495645_0037270 3300046543 Bacteria 3544
234 Ga0495667_0013472 3300046559 Bacteria 5535
235 Ga0495656_0008065 3300046615 Bacteria 3748
236 Ga0495656_0124990 3300046615 Bacteria 1218
237 Ga0495588_0012336 3300046674 Bacteria 4036
238 Ga0495588_0062920 3300046674 Bacteria 1923
239 Ga0495657_0081203 3300046675 Bacteria 2097
240 Ga0495623_0059389 3300046679 Bacteria 2402
241 Ga0495670_0053336 3300046691 Bacteria 2025
242 Ga0495600_0107602 3300046809 Bacteria 1816
243 Ga0495581_0003408 3300047315 Bacteria 9133
244 Ga0495581_0005494 3300047315 Bacteria 7336
245 Ga0495581_0007301 3300047315 Bacteria 6394
246 Ga0495604_0096745 3300047317 Bacteria 2178
247 Ga0495636_0061248 3300047318 Bacteria 1591
248 Ga0495680_0052139 3300047322 Bacteria 3191
249 Ga0495677_0041188 3300047445 Bacteria 1690
250 Ga0495681_0022684 3300047470 Bacteria 3353
251 Ga0495593_0051159 3300047673 Bacteria 2187
252 Ga0496100_0039295 3300048903 Bacteria 3004
253 Ga0496100_0330233 3300048903 Bacteria 1147
254 Ga0496101_0014803 3300048904 Bacteria 5247
255 Ga0496101_0056615 3300048904 Bacteria 2834
256 Ga0496102_0012387 3300048905 Bacteria 7379
257 Ga0496102_0085666 3300048905 Bacteria 2909
258 Ga0496102_0121339 3300048905 Bacteria 2441
259 Ga0496102_0176377 3300048905 Bacteria 2012
260 Ga0496103_0015719 3300048906 Bacteria 4511
261 Ga0496103_0015767 3300048906 Bacteria 4504
262 Ga0496103_0042803 3300048906 Bacteria 2787
263 Ga0496103_0072260 3300048906 Bacteria 2160
264 Ga0496105_0110081 3300048908 Bacteria 2273
265 Ga0496106_0006369 3300048909 Bacteria 8738
266 Ga0496106_0073622 3300048909 Bacteria 2613
267 Ga0496106_0443810 3300048909 Bacteria 1042
268 Ga0496107_0003759 3300048910 Bacteria 10193
269 Ga0496107_0042600 3300048910 Bacteria 3260
270 Ga0496108_0320467 3300048911 Bacteria 1351
271 Ga0496109_0009877 3300048912 Bacteria 8148
272 Ga0496110_0030531 3300048913 Bacteria 4646
273 Ga0496110_0036295 3300048913 Bacteria 4280
274 Ga0496110_0128254 3300048913 Bacteria 2289
275 Ga0496110_0160852 3300048913 Bacteria 2035
276 Ga0496111_0052145 3300048914 Bacteria 2953
277 Ga0496112_0117949 3300048915 Bacteria 2624
278 Ga0496112_0224251 3300048915 Bacteria 1835
279 Ga0496113_0157753 3300048916 Bacteria 1793
280 Ga0496114_0400379 3300048917 Bacteria 1215
281 Ga0496119_0227973 3300048922 Bacteria 950
282 Ga0496122_0091112 3300048925 Bacteria 2077
283 Ga0496123_0035918 3300048926 Bacteria 3524
284 Ga0496124_0033659 3300048927 Bacteria 4507
285 Ga0496125_0053212 3300048928 Bacteria 3321
286 Ga0496125_0218362 3300048928 Bacteria 1231
287 Ga0501032_0001042 3300049569 Bacteria 22242
288 Ga0501032_0023856 3300049569 Bacteria 4224
289 Ga0501032_0188467 3300049569 Bacteria 1349
290 Ga0501033_0101140 3300049570 Bacteria 2103
291 Ga0501034_0000279 3300049571 Bacteria 91909
292 Ga0501036_0100301 3300049572 Bacteria 2449
293 Ga0501037_0003159 3300049573 Bacteria 11964
294 Ga0501037_0016988 3300049573 Bacteria 5355
295 Ga0501038_0040386 3300049574 Bacteria 4075
296 Ga0501038_0046861 3300049574 Bacteria 3746
297 Ga0501038_0094270 3300049574 Bacteria 2502
298 Ga0501038_0175457 3300049574 Bacteria 1732
299 Ga0501039_0024324 3300049575 Bacteria 4651
300 Ga0501039_0078506 3300049575 Bacteria 2568
301 Ga0501039_0090575 3300049575 Bacteria 2383
302 Ga0501042_0005085 3300049578 Bacteria 8439
303 Ga0501043_0008612 3300049579 Bacteria 8039
304 Ga0501043_0081698 3300049579 Bacteria 2540
305 Ga0501048_0007952 3300049582 Bacteria 8032
306 Ga0501069_0599106 3300049585 Bacteria 661
307 Ga0501070_0226996 3300049586 Bacteria 1530
308 Ga0501072_0240958 3300049588 Bacteria 1440
309 Ga0501072_0356447 3300049588 Bacteria 1161
310 Ga0501073_0173060 3300049589 Bacteria 1495
311 Ga0501080_0021268 3300049742 Bacteria 6005
312 Ga0501081_0281765 3300049743 Bacteria 1217
313 Ga0501279_001564 3300049775 Bacteria 3015
314 Ga0501035_0050796 3300049822 Bacteria 3715
315 Ga0501044_0176082 3300049823 Bacteria 2108
316 nmdc:mga03n38_18261_c1 3300050490 Bacteria 2766
317 nmdc:mga00v17_1470_c1 3300050491 Bacteria 12338
318 nmdc:mga00v17_17369_c1 3300050491 Bacteria 3601
319 nmdc:mga00v17_27147_c1 3300050491 Bacteria 3340
320 nmdc:mga00v17_8007_c1 3300050491 Bacteria 5670
321 nmdc:mga0yw44_15256_c1 3300050492 Bacteria 4109
322 nmdc:mga0yw44_212996_c1 3300050492 Bacteria 1278
323 nmdc:mga0yw44_469021_c1 3300050492 Bacteria 853
324 nmdc:mga0yw44_7984_c1 3300050492 Bacteria 5247
325 nmdc:mga06z11_1740_c1 3300050494 Bacteria 8182
326 nmdc:mga04h51_10592_c1 3300050495 Bacteria 2537
327 nmdc:mga04h51_598_c1 3300050495 Bacteria 8611
328 nmdc:mga07m45_102289_c1 3300050496 Bacteria 1645
329 nmdc:mga07m45_11021_c1 3300050496 Bacteria 4739
330 nmdc:mga0rr50_386255_c1 3300050513 Unclassified 1181
331 Ga0500641_0011964 3300053096 Bacteria 3160
332 Ga0501084_0018132 3300054114 Bacteria 5863
333 Ga0530510_0445838 3300061734 Bacteria 978
334 2644455437 2643221681 Bacteria 3707866
335 2691512152 2690315906 Bacteria 4517044
336 2808893627 2808606370 Bacteria 4942454
337 2808898390 2808606371 Bacteria 4251511
338 2844850968 2844849076 Bacteria 4091819
339 2857744704 2857740372 Bacteria 4782044
340 2904498655 2904497146 Bacteria 4731781
341 2904779474 2904776348 Bacteria 4658726
342 2910814032 2910809715 Bacteria 4982797
343 2919037008 2919034639 Bacteria 4763403
344 2919062682 2919059106 Bacteria 4991624
345 2919394658 2919391150 Bacteria 4884741
346 2919541781 2919538618 Bacteria 4677069
347 2932429437 2932426870 Bacteria 4547726
348 2933420572 2933418574 Bacteria 4476724
349 2939601122 2939598168 Bacteria 4687164
350 2939649584 2939647034 Bacteria 4681660
351 2939678046 2939674588 Bacteria 4844420
352 2945916695 2945916053 Bacteria 4555517
353 2945923186 2945920336 Bacteria 4501603
354 2945945082 2945941187 Bacteria 4682474
355 2945956512 2945956166 Bacteria 5110334
356 2946041100 2946037020 Bacteria 4900426
357 2946060486 2946059875 Bacteria 4386623
358 2954002348 2953998280 Bacteria 4812144
359 2974304673 2974302888 Bacteria 4369871
360 2984592686 2984592036 Bacteria 3670284
361 8054110444 8054107350 Bacteria 5022511
362 Ga0207428_10039639
363 LJQas_1000458
364 LJQas_1002286
365 rootH2_10042505
366 rootL2_10254463
367 Ga0006562J51391_1017489
368 Ga0058860_10731936
369 Ga0065714_10014685
370 Ga0070676_10030615
371 Ga0070666_10037323
372 Ga0070668_100018181
373 Ga0070669_100104685
374 Ga0070671_100025409
375 Ga0070674_100067914
376 Ga0070674_100209162
377 Ga0070673_100386649
378 Ga0070667_100089098
379 Ga0070714_100086096
380 Ga0070713_100006115
381 Ga0070700_100130941
382 Ga0070665_100071239
383 Ga0068860_100003892
384 Ga0070717_10169333
385 Ga0075365_10011196
386 Ga0075365_10015356
387 Ga0075365_10022060
388 Ga0075365_10024139
389 Ga0075365_10184377
390 Ga0075368_10000543
391 Ga0075368_10005416
392 Ga0075363_100000422
393 Ga0075364_10001142
394 Ga0075364_10009495
395 Ga0075364_10017390
396 Ga0075364_10034961
397 Ga0075432_10004608
398 Ga0075362_10002282
399 Ga0075367_10021392
400 Ga0075370_10004354
401 Ga0075435_100307557
402 Ga0105251_10006497
403 Ga0105244_10032112
404 Ga0105244_10034876
405 Ga0105245_10210731
406 Ga0105245_10231736
407 Ga0105243_10107122
408 Ga0105243_10203283
409 Ga0105243_10315607
410 Ga0105242_10169492
411 Ga0105248_10028445
412 Ga0105238_10030798
413 Ga0105246_10002200
414 Ga0105246_10003204
415 Ga0105246_10012740
416 Ga0105246_10107666
417 Ga0105246_10228250
418 Ga0105246_10423492
419 Ga0157373_10034627
420 Ga0157369_10018881
421 Ga0157369_10093294
422 Ga0163162_10021734
423 Ga0157372_10374715
424 Ga0157375_10166668
425 Ga0207425_1008570
426 Ga0209759_1031673
427 Ga0209129_1000052
428 Ga0207673_1002907
429 Ga0209025_1000570
430 Ga0209051_1001747
431 Ga0207697_10002740
432 Ga0207697_10010888
433 Ga0207655_1005761
434 Ga0207655_1007824
435 Ga0207713_1037422
436 Ga0207682_10001160
437 Ga0207688_10050660
438 Ga0207645_10033261
439 Ga0207694_10076816
440 Ga0207659_10398106
441 Ga0207687_10060496
442 Ga0207700_10063377
443 Ga0207664_10029484
444 Ga0207644_10405109
445 Ga0207709_10011144
446 Ga0207709_10097802
447 Ga0207669_10154404
448 Ga0207691_10004831
449 Ga0207691_10614971
450 Ga0207661_10105949
451 Ga0207708_10446891
452 Ga0207675_100087908
453 Ga0209813_10005592
454 Ga0209813_10010726
455 Ga0207428_10109028
456 Ga0268264_10000226
457 Ga0316181_1194174
458 Ga0307408_100002796
459 Ga0307408_100015576
460 Ga0307408_100094647
461 Ga0307408_100102145
462 Ga0307408_100130652
463 Ga0307408_100289347
464 Ga0307408_100296673
465 Ga0307405_10000458
466 Ga0307405_10002207
467 Ga0307405_10004728
468 Ga0307405_10061999
469 Ga0307405_10113959
470 Ga0307405_10244345
471 Ga0307413_10000873
472 Ga0307413_10013035
473 Ga0307413_10051380
474 Ga0307413_10059038
475 Ga0307413_10089175
476 Ga0307413_10108634
477 Ga0307413_10157967
478 Ga0307413_10372752
479 Ga0307413_10433489
480 Ga0307410_10000390
481 Ga0307410_10073428
482 Ga0307410_10088948
483 Ga0307410_10092245
484 Ga0307410_10290508
485 Ga0307410_10322768
486 Ga0307406_10009091
487 Ga0307406_10015278
488 Ga0307406_10064798
489 Ga0307406_10130819
490 Ga0307406_10237291
491 Ga0307407_10012651
492 Ga0307407_10023193
493 Ga0307407_10039657
494 Ga0307407_10072855
495 Ga0307407_10104535
496 Ga0307412_10003269
497 Ga0307412_10022563
498 Ga0307412_10054766
499 Ga0307412_10074309
500 Ga0307412_10106152
501 Ga0307412_10109019
502 Ga0307412_10121499
503 Ga0307412_10156995
504 Ga0307412_10295680
505 Ga0307412_10337179
506 Ga0307409_100000425
507 Ga0307409_100240573
508 Ga0307409_100260296
509 Ga0307416_100001032
510 Ga0307416_100002357
511 Ga0307416_100030038
512 Ga0307416_100086736
513 Ga0307416_100600191
514 Ga0307414_10092663
515 Ga0307414_10222942
516 Ga0307411_10009802
517 Ga0307411_10011132
518 Ga0307411_10359427
519 Ga0307415_100008819
520 Ga0307415_100029979
521 Ga0395899_0010447
522 Ga0395899_0116032
523 Ga0395900_0030356
524 Ga0395900_0294005
525 Ga0395898_0008123
526 Ga0395898_0358976
527 Ga0395898_0537239
528 Ga0395901_0101958
529 Ga0395901_0167649
530 Ga0436363_0675390
531 Ga0436362_1064434
532 Ga0439436_0001112
533 Ga0439436_0026587
534 Ga0439436_0028982
535 Ga0439438_003101
536 Ga0439439_0001623
537 Ga0439439_0004235
538 Ga0439466_0002998
539 Ga0439466_0018730
540 Ga0439466_0026119
541 Ga0439465_0014352
542 Ga0439433_0000125
543 Ga0439433_0000266
544 Ga0439433_0047448
545 Ga0439442_000296
546 Ga0439442_000321
547 Ga0439442_000493
548 Ga0439442_008828
549 Ga0439445_0057152
550 Ga0439432_001313
551 Ga0439449_0001186
552 Ga0439449_0002321
553 Ga0439449_0023980
554 Ga0439449_0042157
555 Ga0439449_0066636
556 Ga0439449_0072033
557 Ga0439452_002200
558 Ga0439452_031342
559 Ga0439457_001087
560 Ga0439457_001890
561 Ga0439457_007482
562 Ga0439457_009866
563 Ga0450919_001909
564 Ga0450920_004475
565 Ga0450920_005966
566 Ga0450907_000260
567 Ga0450907_003509
568 Ga0439446_0011806
569 Ga0439446_0044454
570 Ga0450908_001609
571 Ga0439434_0000203
572 Ga0439434_0005250
573 Ga0439434_0008227
574 Ga0450918_002430
575 Ga0450918_004688
576 Ga0466958_0140588
577 Ga0466967_0399540
578 Ga0495653_0063927
579 Ga0495580_0012981
580 Ga0495580_0078024
581 Ga0495582_0012248
582 Ga0495639_0001933
583 Ga0495662_0016395
584 Ga0495664_0001998
585 Ga0495610_0087366
586 Ga0495642_0013229
587 Ga0495654_0054469
588 Ga0495665_0005440
589 Ga0495665_0030475
590 Ga0495586_0004429
591 Ga0495587_0002009
592 Ga0495598_0070763
593 Ga0495645_0008568
594 Ga0495645_0037270
595 Ga0495667_0013472
596 Ga0495656_0008065
597 Ga0495656_0124990
598 Ga0495588_0012336
599 Ga0495588_0062920
600 Ga0495657_0081203
601 Ga0495623_0059389
602 Ga0495670_0053336
603 Ga0495600_0107602
604 Ga0495581_0003408
605 Ga0495581_0005494
606 Ga0495581_0007301
607 Ga0495604_0096745
608 Ga0495636_0061248
609 Ga0495680_0052139
610 Ga0495677_0041188
611 Ga0495681_0022684
612 Ga0495593_0051159
613 Ga0496100_0039295
614 Ga0496100_0330233
615 Ga0496101_0014803
616 Ga0496101_0056615
617 Ga0496102_0012387
618 Ga0496102_0085666
619 Ga0496102_0121339
620 Ga0496102_0176377
621 Ga0496103_0015719
622 Ga0496103_0015767
623 Ga0496103_0042803
624 Ga0496103_0072260
625 Ga0496105_0110081
626 Ga0496106_0006369
627 Ga0496106_0073622
628 Ga0496106_0443810
629 Ga0496107_0003759
630 Ga0496107_0042600
631 Ga0496108_0320467
632 Ga0496109_0009877
633 Ga0496110_0030531
634 Ga0496110_0036295
635 Ga0496110_0128254
636 Ga0496110_0160852
637 Ga0496111_0052145
638 Ga0496112_0117949
639 Ga0496112_0224251
640 Ga0496113_0157753
641 Ga0496114_0400379
642 Ga0496119_0227973
643 Ga0496122_0091112
644 Ga0496123_0035918
645 Ga0496124_0033659
646 Ga0496125_0053212
647 Ga0496125_0218362
648 Ga0501032_0001042
649 Ga0501032_0023856
650 Ga0501032_0188467
651 Ga0501033_0101140
652 Ga0501034_0000279
653 Ga0501036_0100301
654 Ga0501037_0003159
655 Ga0501037_0016988
656 Ga0501038_0040386
657 Ga0501038_0046861
658 Ga0501038_0094270
659 Ga0501038_0175457
660 Ga0501039_0024324
661 Ga0501039_0078506
662 Ga0501039_0090575
663 Ga0501042_0005085
664 Ga0501043_0008612
665 Ga0501043_0081698
666 Ga0501048_0007952
667 Ga0501069_0599106
668 Ga0501070_0226996
669 Ga0501072_0240958
670 Ga0501072_0356447
671 Ga0501073_0173060
672 Ga0501080_0021268
673 Ga0501081_0281765
674 Ga0501279_001564
675 Ga0501035_0050796
676 Ga0501044_0176082
677 nmdc:mga03n38_18261_c1
678 nmdc:mga00v17_1470_c1
679 nmdc:mga00v17_17369_c1
680 nmdc:mga00v17_27147_c1
681 nmdc:mga00v17_8007_c1
682 nmdc:mga0yw44_15256_c1
683 nmdc:mga0yw44_212996_c1
684 nmdc:mga0yw44_469021_c1
685 nmdc:mga0yw44_7984_c1
686 nmdc:mga06z11_1740_c1
687 nmdc:mga04h51_10592_c1
688 nmdc:mga04h51_598_c1
689 nmdc:mga07m45_102289_c1
690 nmdc:mga07m45_11021_c1
691 nmdc:mga0rr50_386255_c1
692 Ga0500641_0011964
693 Ga0501084_0018132
694 Ga0530510_0445838
695 2644455437
696 2691512152
697 2808893627
698 2808898390
699 2844850968
700 2857744704
701 2904498655
702 2904779474
703 2910814032
704 2919037008
705 2919062682
706 2919394658
707 2919541781
708 2932429437
709 2933420572
710 2939601122
711 2939649584
712 2939678046
713 2945916695
714 2945923186
715 2945945082
716 2945956512
717 2946041100
718 2946060486
719 2954002348
720 2974304673
721 2984592686
722 8054110444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20434

BD-FAE

BD-FAE

65

272

0.87

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

78

293

0.83

PF00326

Peptidase_S9

Prolyl oligopeptidase family

195

308

0.68

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

78

298

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bfr-assembly1.cif.gz_A thermogutta terrifontis esterase 2 phosphorylated by paraoxon 0.8097 3 263
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.808 3 264
4po3-assembly1.cif.gz_X crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis 0.8044 3 263
6mly-assembly1.cif.gz_A bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8042 3 264
5zrs-assembly1.cif.gz_A crystal structure of pet-degrading cutinase cut190 s176a/s226p/r228s mutant in monoethyl adipate bound state 0.8024 1 263
ID Description Score Start End Superfamily
af_P96402_114_379_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8276 2 250 3.40.50.1820
af_I6Y9F7_131_400_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8081 6 263 3.40.50.1820
af_Q2G0E5_21_331_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8027 3 263 3.40.50.1820
4oukX00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8021 3 262 3.40.50.1820
af_I6Y2J4_205_430_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.802 2 258 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A329YRI6-F1-model_v4 deleted 0.994 1 264
AF-A0A329YRI6-F1-model_v4 deleted 0.9903 1 264
AF-A0A1S9M9X4-F1-model_v4 Alpha/beta hydrolase 0.9897 1 264 GO:0016787
AF-A0A1S9M9X4-F1-model_v4 Alpha/beta hydrolase 0.986 1 264 GO:0016787
AF-A0A353ZSV9-F1-model_v4 Alpha/beta hydrolase 0.9767 1 128 GO:0016787

Map