F422203

General Info

Members Datasets Scaffolds Average Seq Length
361 237 716 219

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10000039|Ga0105248_10000039152
Length 242
Sequence MPKVPRRPLRSTYIDHDGLPRIVFGVDKITVFILDDHEIVRDGLRRTLERQDDIEVVGEAGLAAEALRRIPALMPTVAILDGRLPDGSGIDVCREIRAEYPGIACLILTSYDDDEALFSAIMAGAAGYVLKEIRGTDLVGAIRTVAAGQSLLSPSVTQRVLARLREGPKEDPVLAELSPREREILALVAEGLTNRQIGTRIHLSEKTVKNYVSSILDKLGLTSRTQAAVLAFKHLGQDSSVS

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
125 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2508501039 Frankia saprophytica CN3 Isolate Nodule
216 2527291627 Frankia casuarinae Thr Isolate Nodule
217 2527291629 Frankia sp. BMG5.23 Isolate Nodule
218 2576861822 Frankia sp. CeD Isolate Nodule
219 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
220 2619618881 Frankia sp. ACN1ag Isolate Unclassified
221 2619619003 Frankia sp. CpI1-P Isolate Nodule
222 2643221613 Oerskovia sp. Root22 Isolate Unclassified
223 2643221641 Nocardioides sp. Root122 Isolate Unclassified
224 2643221721 Oerskovia sp. Root918 Isolate Unclassified
225 2671180195 Frankia sp. CcI49 Isolate Nodule
226 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
227 2684623036 Frankia sp. CgIM4 Isolate Nodule
228 2687453737 Frankia sp. BMG5.36 Isolate Nodule
229 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
230 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
231 2773857922 Frankia sp. CcI49 Isolate Nodule
232 2773857924 Frankia sp. CgIS1 Isolate Nodule
233 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
234 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
235 637000116 Frankia casuarinae CcI3 Isolate Nodule
236 8002775197 Frankia nepalensis CN7 Isolate Nodule
237 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.3
Metatranscriptomes 2.22
Isolates 7.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 4.99
Nodule 5.54
Rhizoplane 6.37
Rhizosphere 75.9
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10000039 3300009177 Bacteria 179700
2 JGI24743J22301_10008772 3300001991 Bacteria 1780
3 JGI24735J21928_10014332 3300002067 Bacteria 2484
4 JGI24738J21930_10003428 3300002075 Bacteria 4001
5 JGI24744J21845_10003026 3300002077 Bacteria 3446
6 JGI24742J22300_10010813 3300002244 Bacteria 1512
7 Ga0070658_10121139 3300005327 Bacteria 2174
8 Ga0070658_10777202 3300005327 Bacteria 832
9 Ga0070683_100038592 3300005329 Bacteria 4379
10 Ga0070683_100170969 3300005329 Bacteria 2063
11 Ga0070683_100203806 3300005329 Bacteria 1879
12 Ga0070670_100210959 3300005331 Bacteria 1689
13 Ga0070680_100242575 3300005336 Bacteria 1523
14 Ga0070682_100011104 3300005337 Bacteria 5138
15 Ga0070682_100264808 3300005337 Bacteria 1246
16 Ga0068868_100135582 3300005338 Bacteria 2017
17 Ga0070660_100039305 3300005339 Bacteria 3596
18 Ga0070692_10002197 3300005345 Bacteria 7469
19 Ga0070675_100046765 3300005354 Bacteria 3545
20 Ga0070674_100020889 3300005356 Bacteria 4193
21 Ga0070673_100209456 3300005364 Bacteria 1683
22 Ga0070659_100004944 3300005366 Bacteria 9534
23 Ga0070659_100014320 3300005366 Bacteria 5925
24 Ga0070659_100031646 3300005366 Bacteria 4099
25 Ga0070659_100171390 3300005366 Bacteria 1778
26 Ga0070701_10002230 3300005438 Bacteria 7409
27 Ga0070700_100003366 3300005441 Bacteria 8244
28 Ga0070678_100815405 3300005456 Bacteria 848
29 Ga0070662_100065116 3300005457 Bacteria 2671
30 Ga0070681_10204363 3300005458 Bacteria 1893
31 Ga0068867_100011159 3300005459 Bacteria 6338
32 Ga0070685_10082068 3300005466 Bacteria 1934
33 Ga0070679_100001798 3300005530 Bacteria 19340
34 Ga0070684_100005296 3300005535 Bacteria 9874
35 Ga0070684_100421039 3300005535 Bacteria 1233
36 Ga0070684_100528382 3300005535 Bacteria 1094
37 Ga0068853_100058516 3300005539 Bacteria 3327
38 Ga0068853_100324346 3300005539 Bacteria 1428
39 Ga0070672_100006745 3300005543 Bacteria 7743
40 Ga0070672_100789726 3300005543 Bacteria 835
41 Ga0070686_100010520 3300005544 Bacteria 5220
42 Ga0070686_100107084 3300005544 Bacteria 1898
43 Ga0070664_100542230 3300005564 Bacteria 1075
44 Ga0068857_100601154 3300005577 Bacteria 1040
45 Ga0068854_100135872 3300005578 Bacteria 1882
46 Ga0068854_100427979 3300005578 Bacteria 1101
47 Ga0070702_100015622 3300005615 Bacteria 3880
48 Ga0068852_100026501 3300005616 Bacteria 4713
49 Ga0068859_100000724 3300005617 Bacteria 33153
50 Ga0068859_100004512 3300005617 Bacteria 14205
51 Ga0068859_100005003 3300005617 Bacteria 13459
52 Ga0068859_100815466 3300005617 Bacteria 1020
53 Ga0068861_100043450 3300005719 Bacteria 3374
54 Ga0068861_100049119 3300005719 Bacteria 3193
55 Ga0068870_10001067 3300005840 Bacteria 10886
56 Ga0068858_100013429 3300005842 Bacteria 7729
57 Ga0068858_100200654 3300005842 Bacteria 1886
58 Ga0075365_10059376 3300006038 Bacteria 2549
59 Ga0075365_10142471 3300006038 Bacteria 1664
60 Ga0075365_10167556 3300006038 Bacteria 1533
61 Ga0075365_10264591 3300006038 Bacteria 1209
62 Ga0075365_10584619 3300006038 Bacteria 790
63 Ga0075432_10001351 3300006058 Bacteria 7959
64 Ga0075367_10189066 3300006178 Bacteria 1285
65 Ga0075367_10319233 3300006178 Bacteria 979
66 Ga0075428_100004412 3300006844 Bacteria 15537
67 Ga0075428_100109119 3300006844 Bacteria 3016
68 Ga0075428_100423286 3300006844 Bacteria 1427
69 Ga0075433_10000549 3300006852 Bacteria 24735
70 Ga0075434_100005456 3300006871 Bacteria 11588
71 Ga0068865_100015731 3300006881 Bacteria 4827
72 Ga0068865_100039490 3300006881 Bacteria 3201
73 Ga0075436_100044252 3300006914 Bacteria 3069
74 Ga0097620_100000724 3300006931 Bacteria 33153
75 Ga0097620_100004512 3300006931 Bacteria 14205
76 Ga0097620_100005003 3300006931 Bacteria 13459
77 Ga0097620_100815605 3300006931 Bacteria 1020
78 Ga0075435_100019785 3300007076 Bacteria 5149
79 Ga0111539_10013864 3300009094 Bacteria 10078
80 Ga0111539_10030501 3300009094 Bacteria 6553
81 Ga0111539_11059544 3300009094 Bacteria 942
82 Ga0105245_10030008 3300009098 Bacteria 4807
83 Ga0105245_10082270 3300009098 Bacteria 2945
84 Ga0105247_10000335 3300009101 Bacteria 41099
85 Ga0105247_10039200 3300009101 Bacteria 2894
86 Ga0114129_10063408 3300009147 Bacteria 5160
87 Ga0105243_10001281 3300009148 Bacteria 22570
88 Ga0105243_10095644 3300009148 Bacteria 2455
89 Ga0105242_10260008 3300009176 Bacteria 1568
90 Ga0105248_10000055 3300009177 Bacteria 141968
91 Ga0105248_10002739 3300009177 Bacteria 19567
92 Ga0105237_10965318 3300009545 Bacteria 859
93 Ga0105238_10342946 3300009551 Bacteria 1482
94 Ga0105249_10000893 3300009553 Bacteria 26438
95 Ga0105249_10007165 3300009553 Bacteria 9738
96 Ga0105249_10035808 3300009553 Bacteria 4501
97 Ga0105239_10027046 3300010375 Bacteria 6315
98 Ga0105239_10099153 3300010375 Bacteria 3220
99 Ga0105239_10371356 3300010375 Bacteria 1616
100 Ga0105246_10089688 3300011119 Bacteria 2212
101 Ga0157335_1006800 3300012492 Bacteria 839
102 Ga0163162_10014368 3300013306 Bacteria 7739
103 Ga0163162_10919716 3300013306 Bacteria 987
104 Ga0157372_10031361 3300013307 Bacteria 5821
105 Ga0157372_10234126 3300013307 Bacteria 2130
106 Ga0163163_10016309 3300014325 Bacteria 6896
107 Ga0163163_10032554 3300014325 Bacteria 5036
108 Ga0163163_10702568 3300014325 Bacteria 1075
109 Ga0163163_10722417 3300014325 Bacteria 1060
110 Ga0163163_11289023 3300014325 Bacteria 793
111 Ga0157380_10010495 3300014326 Bacteria 6664
112 Ga0157380_10380512 3300014326 Bacteria 1332
113 Ga0157377_10002813 3300014745 Bacteria 7759
114 Ga0157379_10015875 3300014968 Bacteria 6619
115 Ga0163161_10077872 3300017792 Bacteria 2436
116 Ga0163161_10537659 3300017792 Bacteria 956
117 Ga0197907_10772837 3300020069 Bacteria 1263
118 Ga0206351_10099254 3300020077 Bacteria 1174
119 Ga0206350_10018556 3300020080 Bacteria 935
120 Ga0206354_10401401 3300020081 Bacteria 1949
121 Ga0206353_10965931 3300020082 Bacteria 2004
122 Ga0206353_11251687 3300020082 Bacteria 4978
123 Ga0154015_1174579 3300020610 Bacteria 1111
124 Ga0207710_10000169 3300025900 Bacteria 67027
125 Ga0207710_10000440 3300025900 Bacteria 27128
126 Ga0207710_10008893 3300025900 Bacteria 4226
127 Ga0207688_10012615 3300025901 Bacteria 4599
128 Ga0207647_10038451 3300025904 Bacteria 3025
129 Ga0207643_10001879 3300025908 Bacteria 11602
130 Ga0207705_10646233 3300025909 Bacteria 823
131 Ga0207707_10049047 3300025912 Bacteria 3679
132 Ga0207660_10282490 3300025917 Bacteria 1318
133 Ga0207662_10201808 3300025918 Bacteria 1287
134 Ga0207657_10023244 3300025919 Bacteria 5776
135 Ga0207652_10028599 3300025921 Bacteria 4653
136 Ga0207681_10581523 3300025923 Bacteria 924
137 Ga0207650_10113721 3300025925 Bacteria 2099
138 Ga0207659_10167380 3300025926 Bacteria 1731
139 Ga0207687_10028813 3300025927 Bacteria 3732
140 Ga0207687_10399408 3300025927 Bacteria 1130
141 Ga0207690_10052611 3300025932 Bacteria 2728
142 Ga0207690_10064304 3300025932 Bacteria 2505
143 Ga0207706_10102127 3300025933 Bacteria 2523
144 Ga0207706_10104730 3300025933 Unclassified 2489
145 Ga0207709_10013179 3300025935 Bacteria 4561
146 Ga0207709_10029449 3300025935 Bacteria 3185
147 Ga0207669_10197673 3300025937 Bacteria 1457
148 Ga0207704_10427784 3300025938 Bacteria 1051
149 Ga0207691_10008253 3300025940 Bacteria 9998
150 Ga0207711_10000030 3300025941 Bacteria 206250
151 Ga0207711_10000288 3300025941 Bacteria 53814
152 Ga0207711_10008223 3300025941 Bacteria 8734
153 Ga0207711_10176083 3300025941 Bacteria 1943
154 Ga0207711_10263740 3300025941 Bacteria 1584
155 Ga0207661_10026457 3300025944 Bacteria 4421
156 Ga0207661_10274540 3300025944 Bacteria 1505
157 Ga0207679_10465838 3300025945 Bacteria 1123
158 Ga0207651_10111033 3300025960 Bacteria 2058
159 Ga0207712_10002784 3300025961 Bacteria 11187
160 Ga0207712_10030990 3300025961 Bacteria 3599
161 Ga0207712_10051121 3300025961 Bacteria 2889
162 Ga0207668_10052229 3300025972 Bacteria 2827
163 Ga0207640_10088732 3300025981 Bacteria 2135
164 Ga0207640_10665602 3300025981 Bacteria 889
165 Ga0207677_10667197 3300026023 Bacteria 919
166 Ga0207703_10008485 3300026035 Bacteria 8118
167 Ga0207703_10720053 3300026035 Bacteria 950
168 Ga0207708_10000445 3300026075 Bacteria 32158
169 Ga0207648_10009429 3300026089 Bacteria 9353
170 Ga0207648_10511194 3300026089 Bacteria 1100
171 Ga0207674_10568418 3300026116 Bacteria 1095
172 Ga0207675_100012218 3300026118 Bacteria 8020
173 Ga0207675_100069104 3300026118 Bacteria 3301
174 Ga0207683_10093865 3300026121 Bacteria 2674
175 Ga0207698_10021479 3300026142 Bacteria 4465
176 Ga0207428_10000402 3300027907 Bacteria 53693
177 Ga0207428_10509137 3300027907 Bacteria 874
178 Ga0268265_10171669 3300028380 Bacteria 1854
179 Ga0307512_10011660 3300030522 Bacteria 8316
180 Ga0316181_1120764 3300030744 Bacteria 1534
181 Ga0316575_10012861 3300031665 Bacteria 3120
182 Ga0316579_10035651 3300031691 Bacteria 2293
183 Ga0316576_10013023 3300031727 Bacteria 5511
184 Ga0316578_10046154 3300031728 Bacteria 2538
185 Ga0307516_10053245 3300031730 Bacteria 3958
186 Ga0316577_10095553 3300031733 Bacteria 1664
187 Ga0307410_10038737 3300031852 Bacteria 3125
188 Ga0307409_100248231 3300031995 Bacteria 1625
189 Ga0307414_10146959 3300032004 Bacteria 1854
190 Ga0307411_10484852 3300032005 Bacteria 1042
191 Ga0307411_10619438 3300032005 Bacteria 933
192 Ga0316583_10005464 3300032133 Bacteria 4558
193 Ga0316583_10062081 3300032133 Bacteria 1309
194 Ga0316580_10027353 3300032139 Bacteria 1763
195 Ga0373942_0002580 3300035207 Bacteria 4370
196 Ga0316574_0045710 3300035398 Bacteria 2712
197 Ga0316582_0048091 3300036647 Bacteria 2695
198 Ga0316584_0100092 3300036712 Bacteria 2170
199 Ga0395900_0778359 3300037418 Bacteria 886
200 Ga0395898_0002239 3300037466 Bacteria 23529
201 Ga0316581_0004762 3300037588 Bacteria 3490
202 Ga0395901_0006919 3300038443 Bacteria 11461
203 Ga0451791_1063075 3300041451 Bacteria 1750
204 Ga0451795_1313993 3300041456 Bacteria 980
205 Ga0451800_0635074 3300041459 Bacteria 1618
206 Ga0451837_0205975 3300041494 Bacteria 2148
207 Ga0439443_022170 3300042003 Bacteria 1007
208 Ga0439448_0009828 3300042005 Bacteria 2826
209 Ga0439450_022498 3300042008 Bacteria 1362
210 Ga0450888_014763 3300042126 Bacteria 948
211 Ga0439464_0123438 3300042439 Bacteria 799
212 Ga0466965_0060148 3300044683 Bacteria 1897
213 Ga0466963_0557145 3300044694 Bacteria 809
214 Ga0466957_0250278 3300044842 Bacteria 1178
215 Ga0466959_0073156 3300045049 Bacteria 2480
216 Ga0466967_0017493 3300045976 Bacteria 5695
217 Ga0466967_0067532 3300045976 Bacteria 3189
218 Ga0466967_0145222 3300045976 Bacteria 2213
219 Ga0495603_0070978 3300046455 Bacteria 2047
220 Ga0495641_0088576 3300046461 Bacteria 1384
221 Ga0495651_0211809 3300046462 Bacteria 1348
222 Ga0495582_0240201 3300046473 Bacteria 1038
223 Ga0495662_0274691 3300046476 Bacteria 830
224 Ga0495594_0373384 3300046499 Bacteria 812
225 Ga0495586_0160536 3300046535 Bacteria 1268
226 Ga0495635_0551994 3300046663 Bacteria 755
227 Ga0495581_0144237 3300047315 Bacteria 1389
228 Ga0495674_0532370 3300047319 Bacteria 937
229 Ga0496102_0000079 3300048905 Bacteria 140942
230 Ga0496103_0000034 3300048906 Bacteria 189284
231 Ga0496104_0072924 3300048907 Bacteria 3266
232 Ga0496104_1080558 3300048907 Bacteria 706
233 Ga0496105_0066457 3300048908 Bacteria 2977
234 Ga0496106_0165408 3300048909 Bacteria 1751
235 Ga0496106_0166250 3300048909 Bacteria 1746
236 Ga0496107_0111693 3300048910 Bacteria 2009
237 Ga0496107_0628709 3300048910 Bacteria 792
238 Ga0496108_0032259 3300048911 Bacteria 4350
239 Ga0496109_0199477 3300048912 Bacteria 1881
240 Ga0496109_0482920 3300048912 Bacteria 1170
241 Ga0496110_0118714 3300048913 Bacteria 2382
242 Ga0496110_0291605 3300048913 Bacteria 1486
243 Ga0496110_0798779 3300048913 Bacteria 848
244 Ga0496114_0047994 3300048917 Bacteria 3551
245 Ga0496114_0052239 3300048917 Bacteria 3405
246 Ga0496114_0073798 3300048917 Bacteria 2872
247 Ga0496114_0080082 3300048917 Bacteria 2758
248 Ga0496114_0136179 3300048917 Bacteria 2124
249 Ga0496117_0006372 3300048920 Bacteria 11989
250 Ga0496117_0018950 3300048920 Bacteria 5674
251 Ga0496117_0120576 3300048920 Bacteria 1612
252 Ga0496117_0150857 3300048920 Bacteria 1376
253 Ga0496118_0004376 3300048921 Bacteria 16797
254 Ga0496118_0006215 3300048921 Bacteria 13216
255 Ga0496118_0023994 3300048921 Bacteria 5278
256 Ga0496119_0000337 3300048922 Bacteria 65601
257 Ga0496119_0000745 3300048922 Bacteria 43756
258 Ga0496120_0000250 3300048923 Bacteria 90632
259 Ga0496120_0000833 3300048923 Bacteria 43993
260 Ga0496120_0122880 3300048923 Bacteria 1340
261 Ga0496121_0150331 3300048924 Bacteria 1714
262 Ga0496126_0000039 3300048929 Bacteria 347353
263 Ga0496126_0000055 3300048929 Bacteria 297958
264 Ga0501031_0014348 3300049568 Bacteria 5151
265 Ga0501031_0044880 3300049568 Bacteria 2884
266 Ga0501031_0722537 3300049568 Bacteria 639
267 Ga0501034_0187253 3300049571 Bacteria 2033
268 Ga0501036_0027478 3300049572 Bacteria 4807
269 Ga0501036_0045165 3300049572 Bacteria 3733
270 Ga0501037_0087406 3300049573 Bacteria 2256
271 Ga0501037_0260347 3300049573 Bacteria 1212
272 Ga0501039_0068527 3300049575 Bacteria 2754
273 Ga0501039_0772449 3300049575 Bacteria 750
274 Ga0501040_0012913 3300049576 Bacteria 5487
275 Ga0501040_0082819 3300049576 Bacteria 2225
276 Ga0501040_0314777 3300049576 Bacteria 1119
277 Ga0501041_0067595 3300049577 Bacteria 2190
278 Ga0501042_0019547 3300049578 Bacteria 4705
279 Ga0501042_0149306 3300049578 Bacteria 1685
280 Ga0501042_0283050 3300049578 Bacteria 1198
281 Ga0501042_0304376 3300049578 Bacteria 1152
282 Ga0501042_0560685 3300049578 Bacteria 830
283 Ga0501043_0134992 3300049579 Bacteria 1933
284 Ga0501043_0294875 3300049579 Bacteria 1241
285 Ga0501046_0082060 3300049580 Bacteria 2490
286 Ga0501048_0017355 3300049582 Bacteria 5304
287 Ga0501068_0104383 3300049584 Bacteria 1758
288 Ga0501070_0019390 3300049586 Bacteria 5702
289 Ga0501070_0047154 3300049586 Bacteria 3582
290 Ga0501070_0136932 3300049586 Bacteria 2022
291 Ga0501071_0036814 3300049587 Bacteria 3490
292 Ga0501071_0278886 3300049587 Bacteria 1265
293 Ga0501072_0014341 3300049588 Bacteria 6075
294 Ga0501072_0607222 3300049588 Bacteria 862
295 Ga0501074_0016922 3300049590 Bacteria 5290
296 Ga0501074_0105062 3300049590 Bacteria 2022
297 Ga0501075_0002599 3300049591 Bacteria 12060
298 Ga0501076_0018654 3300049592 Bacteria 5294
299 Ga0501077_0098211 3300049593 Bacteria 1856
300 Ga0501079_0014879 3300049741 Bacteria 5930
301 Ga0501079_0514521 3300049741 Bacteria 941
302 Ga0501080_0021921 3300049742 Bacteria 5917
303 Ga0501080_0063938 3300049742 Bacteria 3424
304 Ga0501081_0003831 3300049743 Bacteria 9637
305 Ga0501035_0363101 3300049822 Bacteria 1210
306 Ga0501045_0039980 3300049824 Bacteria 3412
307 Ga0501045_0076650 3300049824 Bacteria 2464
308 Ga0501045_0121923 3300049824 Bacteria 1936
309 nmdc:mga00v17_489048_c1 3300050491 Bacteria 798
310 nmdc:mga0yw44_137423_c1 3300050492 Bacteria 1586
311 nmdc:mga0yw44_33227_c1 3300050492 Bacteria 3012
312 nmdc:mga0yw44_47738_c1 3300050492 Bacteria 2579
313 nmdc:mga0yw44_95980_c1 3300050492 Bacteria 1881
314 nmdc:mga06z11_183717_c1 3300050494 Bacteria 1207
315 nmdc:mga05p37_3338_c1 3300050507 Bacteria 18708
316 nmdc:mga08y16_345891_c1 3300050511 Bacteria 1528
317 nmdc:mga08y16_69200_c1 3300050511 Bacteria 3680
318 nmdc:mga0n895_30596_c1 3300050512 Bacteria 5147
319 nmdc:mga0rr50_58611_c1 3300050513 Bacteria 2887
320 nmdc:mga0a205_41105_c1 3300050515 Bacteria 4453
321 Ga0495595_0144178 3300053084 Bacteria 1170
322 Ga0500583_0052647 3300053092 Bacteria 1895
323 Ga0500556_0002958 3300053104 Bacteria 5133
324 Ga0500593_000071 3300053117 Bacteria 38009
325 Ga0500593_000132 3300053117 Bacteria 29758
326 Ga0500568_0015580 3300053139 Bacteria 3401
327 Ga0501084_0199186 3300054114 Bacteria 1689
328 Ga0587094_043146 3300059513 Bacteria 741
329 Ga0501082_0149777 3300060353 Bacteria 2026
330 Ga0501082_0235666 3300060353 Bacteria 1593
331 Ga0530510_0042270 3300061734 Bacteria 3292
332 2508673296 2508501039 Bacteria 9978592
333 2528205627 2527291627 Bacteria 5309833
334 2528215287 2527291629 Bacteria 5267418
335 2579750372 2576861822 Bacteria 5004595
336 2579855276 2579778521 Bacteria 7624758
337 2619855211 2619618881 Bacteria 7521104
338 2620351447 2619619003 Bacteria 7619552
339 2644083463 2643221613 Bacteria 4622396
340 2644230957 2643221641 Bacteria 4490190
341 2644666252 2643221721 Bacteria 4486924
342 2671840352 2671180195 Bacteria 9757215
343 2676201942 2675902999 Bacteria 9438463
344 2686544102 2684623036 Bacteria 5199090
345 2689956494 2687453737 Bacteria 11203906
346 2689990460 2687453743 Bacteria 8361025
347 2689990532 2687453743 Bacteria 8361025
348 2689991517 2687453743 Bacteria 8361025
349 2774846518 2773857921 Bacteria 9435764
350 2774858508 2773857922 Bacteria 9757215
351 2774866237 2773857924 Bacteria 5256821
352 2891972581 2891968417 Bacteria 5821697
353 2984593145 2984592036 Bacteria 3670284
354 637880578 637000116 Bacteria 5433628
355 8002776831 8002775197 Bacteria 10728764
356 8054610157 8054609563 Bacteria 5170090
357 8054610799 8054609563 Bacteria 5170090
358 8054610836 8054609563 Bacteria 5170090
359 Ga0105248_10000039
360 JGI24743J22301_10008772
361 JGI24735J21928_10014332
362 JGI24738J21930_10003428
363 JGI24744J21845_10003026
364 JGI24742J22300_10010813
365 Ga0070658_10121139
366 Ga0070658_10777202
367 Ga0070683_100038592
368 Ga0070683_100170969
369 Ga0070683_100203806
370 Ga0070670_100210959
371 Ga0070680_100242575
372 Ga0070682_100011104
373 Ga0070682_100264808
374 Ga0068868_100135582
375 Ga0070660_100039305
376 Ga0070692_10002197
377 Ga0070675_100046765
378 Ga0070674_100020889
379 Ga0070673_100209456
380 Ga0070659_100004944
381 Ga0070659_100014320
382 Ga0070659_100031646
383 Ga0070659_100171390
384 Ga0070701_10002230
385 Ga0070700_100003366
386 Ga0070678_100815405
387 Ga0070662_100065116
388 Ga0070681_10204363
389 Ga0068867_100011159
390 Ga0070685_10082068
391 Ga0070679_100001798
392 Ga0070684_100005296
393 Ga0070684_100421039
394 Ga0070684_100528382
395 Ga0068853_100058516
396 Ga0068853_100324346
397 Ga0070672_100006745
398 Ga0070672_100789726
399 Ga0070686_100010520
400 Ga0070686_100107084
401 Ga0070664_100542230
402 Ga0068857_100601154
403 Ga0068854_100135872
404 Ga0068854_100427979
405 Ga0070702_100015622
406 Ga0068852_100026501
407 Ga0068859_100000724
408 Ga0068859_100004512
409 Ga0068859_100005003
410 Ga0068859_100815466
411 Ga0068861_100043450
412 Ga0068861_100049119
413 Ga0068870_10001067
414 Ga0068858_100013429
415 Ga0068858_100200654
416 Ga0075365_10059376
417 Ga0075365_10142471
418 Ga0075365_10167556
419 Ga0075365_10264591
420 Ga0075365_10584619
421 Ga0075432_10001351
422 Ga0075367_10189066
423 Ga0075367_10319233
424 Ga0075428_100004412
425 Ga0075428_100109119
426 Ga0075428_100423286
427 Ga0075433_10000549
428 Ga0075434_100005456
429 Ga0068865_100015731
430 Ga0068865_100039490
431 Ga0075436_100044252
432 Ga0097620_100000724
433 Ga0097620_100004512
434 Ga0097620_100005003
435 Ga0097620_100815605
436 Ga0075435_100019785
437 Ga0111539_10013864
438 Ga0111539_10030501
439 Ga0111539_11059544
440 Ga0105245_10030008
441 Ga0105245_10082270
442 Ga0105247_10000335
443 Ga0105247_10039200
444 Ga0114129_10063408
445 Ga0105243_10001281
446 Ga0105243_10095644
447 Ga0105242_10260008
448 Ga0105248_10000055
449 Ga0105248_10002739
450 Ga0105237_10965318
451 Ga0105238_10342946
452 Ga0105249_10000893
453 Ga0105249_10007165
454 Ga0105249_10035808
455 Ga0105239_10027046
456 Ga0105239_10099153
457 Ga0105239_10371356
458 Ga0105246_10089688
459 Ga0157335_1006800
460 Ga0163162_10014368
461 Ga0163162_10919716
462 Ga0157372_10031361
463 Ga0157372_10234126
464 Ga0163163_10016309
465 Ga0163163_10032554
466 Ga0163163_10702568
467 Ga0163163_10722417
468 Ga0163163_11289023
469 Ga0157380_10010495
470 Ga0157380_10380512
471 Ga0157377_10002813
472 Ga0157379_10015875
473 Ga0163161_10077872
474 Ga0163161_10537659
475 Ga0197907_10772837
476 Ga0206351_10099254
477 Ga0206350_10018556
478 Ga0206354_10401401
479 Ga0206353_10965931
480 Ga0206353_11251687
481 Ga0154015_1174579
482 Ga0207710_10000169
483 Ga0207710_10000440
484 Ga0207710_10008893
485 Ga0207688_10012615
486 Ga0207647_10038451
487 Ga0207643_10001879
488 Ga0207705_10646233
489 Ga0207707_10049047
490 Ga0207660_10282490
491 Ga0207662_10201808
492 Ga0207657_10023244
493 Ga0207652_10028599
494 Ga0207681_10581523
495 Ga0207650_10113721
496 Ga0207659_10167380
497 Ga0207687_10028813
498 Ga0207687_10399408
499 Ga0207690_10052611
500 Ga0207690_10064304
501 Ga0207706_10102127
502 Ga0207706_10104730
503 Ga0207709_10013179
504 Ga0207709_10029449
505 Ga0207669_10197673
506 Ga0207704_10427784
507 Ga0207691_10008253
508 Ga0207711_10000030
509 Ga0207711_10000288
510 Ga0207711_10008223
511 Ga0207711_10176083
512 Ga0207711_10263740
513 Ga0207661_10026457
514 Ga0207661_10274540
515 Ga0207679_10465838
516 Ga0207651_10111033
517 Ga0207712_10002784
518 Ga0207712_10030990
519 Ga0207712_10051121
520 Ga0207668_10052229
521 Ga0207640_10088732
522 Ga0207640_10665602
523 Ga0207677_10667197
524 Ga0207703_10008485
525 Ga0207703_10720053
526 Ga0207708_10000445
527 Ga0207648_10009429
528 Ga0207648_10511194
529 Ga0207674_10568418
530 Ga0207675_100012218
531 Ga0207675_100069104
532 Ga0207683_10093865
533 Ga0207698_10021479
534 Ga0207428_10000402
535 Ga0207428_10509137
536 Ga0268265_10171669
537 Ga0307512_10011660
538 Ga0316181_1120764
539 Ga0316575_10012861
540 Ga0316579_10035651
541 Ga0316576_10013023
542 Ga0316578_10046154
543 Ga0307516_10053245
544 Ga0316577_10095553
545 Ga0307410_10038737
546 Ga0307409_100248231
547 Ga0307414_10146959
548 Ga0307411_10484852
549 Ga0307411_10619438
550 Ga0316583_10005464
551 Ga0316583_10062081
552 Ga0316580_10027353
553 Ga0373942_0002580
554 Ga0316574_0045710
555 Ga0316582_0048091
556 Ga0316584_0100092
557 Ga0395900_0778359
558 Ga0395898_0002239
559 Ga0316581_0004762
560 Ga0395901_0006919
561 Ga0451791_1063075
562 Ga0451795_1313993
563 Ga0451800_0635074
564 Ga0451837_0205975
565 Ga0439443_022170
566 Ga0439448_0009828
567 Ga0439450_022498
568 Ga0450888_014763
569 Ga0439464_0123438
570 Ga0466965_0060148
571 Ga0466963_0557145
572 Ga0466957_0250278
573 Ga0466959_0073156
574 Ga0466967_0017493
575 Ga0466967_0067532
576 Ga0466967_0145222
577 Ga0495603_0070978
578 Ga0495641_0088576
579 Ga0495651_0211809
580 Ga0495582_0240201
581 Ga0495662_0274691
582 Ga0495594_0373384
583 Ga0495586_0160536
584 Ga0495635_0551994
585 Ga0495581_0144237
586 Ga0495674_0532370
587 Ga0496102_0000079
588 Ga0496103_0000034
589 Ga0496104_0072924
590 Ga0496104_1080558
591 Ga0496105_0066457
592 Ga0496106_0165408
593 Ga0496106_0166250
594 Ga0496107_0111693
595 Ga0496107_0628709
596 Ga0496108_0032259
597 Ga0496109_0199477
598 Ga0496109_0482920
599 Ga0496110_0118714
600 Ga0496110_0291605
601 Ga0496110_0798779
602 Ga0496114_0047994
603 Ga0496114_0052239
604 Ga0496114_0073798
605 Ga0496114_0080082
606 Ga0496114_0136179
607 Ga0496117_0006372
608 Ga0496117_0018950
609 Ga0496117_0120576
610 Ga0496117_0150857
611 Ga0496118_0004376
612 Ga0496118_0006215
613 Ga0496118_0023994
614 Ga0496119_0000337
615 Ga0496119_0000745
616 Ga0496120_0000250
617 Ga0496120_0000833
618 Ga0496120_0122880
619 Ga0496121_0150331
620 Ga0496126_0000039
621 Ga0496126_0000055
622 Ga0501031_0014348
623 Ga0501031_0044880
624 Ga0501031_0722537
625 Ga0501034_0187253
626 Ga0501036_0027478
627 Ga0501036_0045165
628 Ga0501037_0087406
629 Ga0501037_0260347
630 Ga0501039_0068527
631 Ga0501039_0772449
632 Ga0501040_0012913
633 Ga0501040_0082819
634 Ga0501040_0314777
635 Ga0501041_0067595
636 Ga0501042_0019547
637 Ga0501042_0149306
638 Ga0501042_0283050
639 Ga0501042_0304376
640 Ga0501042_0560685
641 Ga0501043_0134992
642 Ga0501043_0294875
643 Ga0501046_0082060
644 Ga0501048_0017355
645 Ga0501068_0104383
646 Ga0501070_0019390
647 Ga0501070_0047154
648 Ga0501070_0136932
649 Ga0501071_0036814
650 Ga0501071_0278886
651 Ga0501072_0014341
652 Ga0501072_0607222
653 Ga0501074_0016922
654 Ga0501074_0105062
655 Ga0501075_0002599
656 Ga0501076_0018654
657 Ga0501077_0098211
658 Ga0501079_0014879
659 Ga0501079_0514521
660 Ga0501080_0021921
661 Ga0501080_0063938
662 Ga0501081_0003831
663 Ga0501035_0363101
664 Ga0501045_0039980
665 Ga0501045_0076650
666 Ga0501045_0121923
667 nmdc:mga00v17_489048_c1
668 nmdc:mga0yw44_137423_c1
669 nmdc:mga0yw44_33227_c1
670 nmdc:mga0yw44_47738_c1
671 nmdc:mga0yw44_95980_c1
672 nmdc:mga06z11_183717_c1
673 nmdc:mga05p37_3338_c1
674 nmdc:mga08y16_345891_c1
675 nmdc:mga08y16_69200_c1
676 nmdc:mga0n895_30596_c1
677 nmdc:mga0rr50_58611_c1
678 nmdc:mga0a205_41105_c1
679 Ga0495595_0144178
680 Ga0500583_0052647
681 Ga0500556_0002958
682 Ga0500593_000071
683 Ga0500593_000132
684 Ga0500568_0015580
685 Ga0501084_0199186
686 Ga0587094_043146
687 Ga0501082_0149777
688 Ga0501082_0235666
689 Ga0530510_0042270
690 2508673296
691 2528205627
692 2528215287
693 2579750372
694 2579855276
695 2619855211
696 2620351447
697 2644083463
698 2644230957
699 2644666252
700 2671840352
701 2676201942
702 2686544102
703 2689956494
704 2689990460
705 2689990532
706 2689991517
707 2774846518
708 2774858508
709 2774866237
710 2891972581
711 2984593145
712 637880578
713 8002776831
714 8054610157
715 8054610799
716 8054610836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

31

143

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

175

231

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

173

219

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

173

219

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9846 153 211
1zlk-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain-dna complex 0.9829 149 211
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9819 154 211
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9808 151 211
1zlj-assembly4.cif.gz_H crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.9749 149 211
ID Description Score Start End Superfamily
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9934 153 211 1.10.10.10
1zlkB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9829 149 211 1.10.10.10
3p7nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9644 151 209 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 155 210 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9565 154 211 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A428X1Y9-F1-model_v4 DNA-binding response regulator 0.9761 6 143 GO:0000160
GO:0003677
AF-A0A428X1Y9-F1-model_v4 DNA-binding response regulator 0.9624 6 143 GO:0000160
GO:0003677
AF-A0A535L8F0-F1-model_v4 Response regulator transcription factor 0.9576 2 144 GO:0000160
GO:0003677
AF-Q98JH5-F1-model_v4 DNA-binding response regulator 0.9531 6 140 GO:0000160
GO:0003677
AF-A0A397RJT3-F1-model_v4 deleted 0.9203 1 156

Map