F422200

General Info

Members Datasets Scaffolds Average Seq Length
361 232 722 64

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_11849368|Ga0105241_118493682
Length 76
Sequence MECVYLLVEVHIMRTNIVIDDKLMRDTLRATGLKTKREAVEEGLRSLLRLKRQAEIRKLRGRLKWQGDLDAMRRDS

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
124 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
140 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
145 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
149 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
194 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
195 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
199 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
220 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
221 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
222 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.03
Nodule 0
Rhizoplane 4.16
Rhizosphere 81.72
Stem 0
Stem Tuber 0
Unclassified 27.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_11849368 3300009174 Unclassified 590
2 Ga0070658_10848856 3300005327 Unclassified 794
3 Ga0070658_10887558 3300005327 Unclassified 775
4 Ga0070683_100000012 3300005329 Bacteria 274646
5 Ga0070683_100239182 3300005329 Bacteria 1727
6 Ga0070670_100227069 3300005331 Bacteria 1625
7 Ga0070670_100301755 3300005331 Bacteria 1401
8 Ga0070670_100846910 3300005331 Unclassified 827
9 Ga0068869_100349938 3300005334 Bacteria 1204
10 Ga0070680_100871598 3300005336 Unclassified 776
11 Ga0070682_100474728 3300005337 Bacteria 963
12 Ga0070660_101354777 3300005339 Bacteria 604
13 Ga0070689_101423755 3300005340 Bacteria 626
14 Ga0070668_100431249 3300005347 Bacteria 1130
15 Ga0070668_101185134 3300005347 Bacteria 692
16 Ga0070669_101029929 3300005353 Bacteria 707
17 Ga0070675_100650686 3300005354 Unclassified 958
18 Ga0070675_100877481 3300005354 Bacteria 822
19 Ga0070671_100726330 3300005355 Bacteria 862
20 Ga0070671_101696421 3300005355 Bacteria 561
21 Ga0070714_100610186 3300005435 Bacteria 1048
22 Ga0070705_100184476 3300005440 Unclassified 1416
23 Ga0070681_10820441 3300005458 Bacteria 847
24 Ga0070681_11715296 3300005458 Unclassified 554
25 Ga0068867_100297505 3300005459 Bacteria 1329
26 Ga0068867_101559448 3300005459 Unclassified 616
27 Ga0068867_101669159 3300005459 Bacteria 597
28 Ga0070685_10411170 3300005466 Bacteria 939
29 Ga0070699_101665324 3300005518 Bacteria 584
30 Ga0070679_100419295 3300005530 Bacteria 1284
31 Ga0070679_100448634 3300005530 Bacteria 1235
32 Ga0070679_101477333 3300005530 Bacteria 626
33 Ga0070684_100000013 3300005535 Bacteria 167281
34 Ga0070684_100178124 3300005535 Bacteria 1932
35 Ga0070684_100228897 3300005535 Bacteria 1697
36 Ga0070684_100321635 3300005535 Bacteria 1421
37 Ga0070684_101727135 3300005535 Bacteria 590
38 Ga0068853_100504268 3300005539 Unclassified 1143
39 Ga0070672_100189910 3300005543 Bacteria 1715
40 Ga0070672_100317564 3300005543 Bacteria 1324
41 Ga0070693_101148144 3300005547 Unclassified 594
42 Ga0070665_100142933 3300005548 Bacteria 2396
43 Ga0070665_100278993 3300005548 Bacteria 1673
44 Ga0070665_100919011 3300005548 Bacteria 888
45 Ga0070665_102572666 3300005548 Bacteria 510
46 Ga0068855_100102741 3300005563 Bacteria 3289
47 Ga0068855_101034907 3300005563 Bacteria 861
48 Ga0070664_100566243 3300005564 Bacteria 1052
49 Ga0070664_101482396 3300005564 Unclassified 642
50 Ga0068852_100440223 3300005616 Bacteria 1289
51 Ga0068859_101367320 3300005617 Bacteria 781
52 Ga0068859_102853311 3300005617 Unclassified 530
53 Ga0068864_100809613 3300005618 Bacteria 921
54 Ga0068864_101177160 3300005618 Unclassified 765
55 Ga0068866_10033105 3300005718 Unclassified 2504
56 Ga0068861_100163785 3300005719 Bacteria 1837
57 Ga0068861_101015468 3300005719 Bacteria 792
58 Ga0068861_101872944 3300005719 Unclassified 596
59 Ga0068863_101550419 3300005841 Bacteria 671
60 Ga0068860_100775278 3300005843 Bacteria 971
61 Ga0070717_11425315 3300006028 Bacteria 629
62 Ga0070715_10985524 3300006163 Unclassified 524
63 Ga0070716_101337979 3300006173 Bacteria 580
64 Ga0075366_10086879 3300006195 Bacteria 1871
65 Ga0097621_101243563 3300006237 Unclassified 702
66 Ga0097621_101855032 3300006237 Unclassified 575
67 Ga0075430_100046750 3300006846 Bacteria 3655
68 Ga0075430_100443170 3300006846 Bacteria 1072
69 Ga0075430_100963750 3300006846 Unclassified 703
70 Ga0075431_100770910 3300006847 Unclassified 936
71 Ga0075433_11921214 3300006852 Unclassified 508
72 Ga0075434_100272430 3300006871 Bacteria 1712
73 Ga0075429_100351752 3300006880 Bacteria 1290
74 Ga0097620_100091190 3300006931 Bacteria 3098
75 Ga0097620_101367268 3300006931 Bacteria 781
76 Ga0097620_102852460 3300006931 Unclassified 530
77 Ga0105240_10034165 3300009093 Bacteria 6562
78 Ga0105240_10083402 3300009093 Bacteria 3922
79 Ga0105240_10228374 3300009093 Bacteria 2164
80 Ga0105240_10268107 3300009093 Bacteria 1967
81 Ga0105245_10093222 3300009098 Bacteria 2775
82 Ga0105245_11496112 3300009098 Bacteria 726
83 Ga0105247_11611547 3300009101 Bacteria 533
84 Ga0114129_10039169 3300009147 Bacteria 6683
85 Ga0105241_11922864 3300009174 Unclassified 580
86 Ga0105241_12511805 3300009174 Unclassified 516
87 Ga0105248_10348848 3300009177 Bacteria 1666
88 Ga0105248_11058029 3300009177 Bacteria 917
89 Ga0105248_12906088 3300009177 Unclassified 546
90 Ga0105237_10008074 3300009545 Bacteria 11443
91 Ga0105237_10035432 3300009545 Bacteria 5050
92 Ga0105237_10636245 3300009545 Unclassified 1074
93 Ga0105237_10962031 3300009545 Bacteria 861
94 Ga0105237_11636119 3300009545 Bacteria 651
95 Ga0105238_10627891 3300009551 Unclassified 1083
96 Ga0105238_10636537 3300009551 Bacteria 1076
97 Ga0105238_10810490 3300009551 Bacteria 952
98 Ga0105239_10508188 3300010375 Bacteria 1370
99 Ga0105239_10632324 3300010375 Unclassified 1222
100 Ga0105239_10889096 3300010375 Unclassified 1022
101 Ga0157373_10651927 3300013100 Bacteria 769
102 Ga0157371_11198087 3300013102 Unclassified 585
103 Ga0157370_10163558 3300013104 Bacteria 2070
104 Ga0157370_10738560 3300013104 Unclassified 897
105 Ga0157370_11003656 3300013104 Bacteria 755
106 Ga0157369_10107338 3300013105 Bacteria 2970
107 Ga0157374_10099358 3300013296 Bacteria 2788
108 Ga0157374_10860116 3300013296 Bacteria 924
109 Ga0157374_11316971 3300013296 Unclassified 744
110 Ga0157374_12981085 3300013296 Unclassified 500
111 Ga0157378_11901816 3300013297 Bacteria 644
112 Ga0163162_10182182 3300013306 Bacteria 2227
113 Ga0157372_10053503 3300013307 Bacteria 4500
114 Ga0157372_11946681 3300013307 Unclassified 676
115 Ga0157372_12908474 3300013307 Bacteria 548
116 Ga0157375_10470011 3300013308 Bacteria 1423
117 Ga0157375_11681711 3300013308 Unclassified 751
118 Ga0163163_10042533 3300014325 Bacteria 4450
119 Ga0163163_10321445 3300014325 Bacteria 1601
120 Ga0163163_12421118 3300014325 Bacteria 583
121 Ga0157380_10137613 3300014326 Bacteria 2093
122 Ga0157380_11717399 3300014326 Bacteria 685
123 Ga0157377_11622244 3300014745 Unclassified 519
124 Ga0157376_10100241 3300014969 Unclassified 2529
125 Ga0157376_10256887 3300014969 Bacteria 1635
126 Ga0157376_11137765 3300014969 Bacteria 807
127 Ga0213876_10348150 3300021384 Bacteria 788
128 Ga0213875_10000006 3300021388 Bacteria 579005
129 Ga0213875_10046271 3300021388 Bacteria 2042
130 Ga0213875_10128293 3300021388 Bacteria 1185
131 Ga0213875_10435067 3300021388 Unclassified 627
132 Ga0207656_10353841 3300025321 Unclassified 733
133 Ga0207642_10022144 3300025899 Unclassified 2515
134 Ga0207645_10077255 3300025907 Bacteria 2133
135 Ga0207705_10442941 3300025909 Bacteria 1007
136 Ga0207707_10841195 3300025912 Unclassified 762
137 Ga0207707_11425367 3300025912 Unclassified 552
138 Ga0207695_10063830 3300025913 Unclassified 3794
139 Ga0207695_10215164 3300025913 Bacteria 1831
140 Ga0207695_10465250 3300025913 Bacteria 1147
141 Ga0207671_10039458 3300025914 Bacteria 3496
142 Ga0207671_10095097 3300025914 Unclassified 2249
143 Ga0207663_11077578 3300025916 Unclassified 646
144 Ga0207660_11493739 3300025917 Unclassified 546
145 Ga0207649_10265823 3300025920 Bacteria 1241
146 Ga0207652_10617026 3300025921 Bacteria 972
147 Ga0207694_10476352 3300025924 Unclassified 1044
148 Ga0207650_10516091 3300025925 Bacteria 1000
149 Ga0207659_11308766 3300025926 Bacteria 622
150 Ga0207659_11896661 3300025926 Bacteria 505
151 Ga0207700_10407382 3300025928 Bacteria 1192
152 Ga0207664_10799544 3300025929 Bacteria 848
153 Ga0207644_10164713 3300025931 Bacteria 1726
154 Ga0207706_11696871 3300025933 Bacteria 509
155 Ga0207669_11966190 3300025937 Bacteria 500
156 Ga0207665_10368380 3300025939 Bacteria 1088
157 Ga0207691_10015616 3300025940 Bacteria 7218
158 Ga0207691_10085097 3300025940 Bacteria 2838
159 Ga0207661_10000034 3300025944 Bacteria 154138
160 Ga0207661_11130220 3300025944 Bacteria 721
161 Ga0207679_10147460 3300025945 Bacteria 1910
162 Ga0207679_10853636 3300025945 Bacteria 832
163 Ga0207667_10752683 3300025949 Bacteria 973
164 Ga0207667_11769184 3300025949 Unclassified 583
165 Ga0207651_10516361 3300025960 Bacteria 1035
166 Ga0207668_10231277 3300025972 Bacteria 1491
167 Ga0207658_10673216 3300025986 Bacteria 934
168 Ga0207677_11368519 3300026023 Unclassified 651
169 Ga0207639_10860795 3300026041 Bacteria 846
170 Ga0207639_11298415 3300026041 Unclassified 683
171 Ga0207702_12036038 3300026078 Unclassified 564
172 Ga0207641_11054097 3300026088 Bacteria 811
173 Ga0207641_11650884 3300026088 Bacteria 643
174 Ga0207641_12380755 3300026088 Bacteria 529
175 Ga0207648_10048328 3300026089 Bacteria 3725
176 Ga0207648_11406021 3300026089 Bacteria 656
177 Ga0207676_10220182 3300026095 Bacteria 1690
178 Ga0207675_100369731 3300026118 Bacteria 1408
179 Ga0207675_100392999 3300026118 Bacteria 1365
180 Ga0207675_100751495 3300026118 Unclassified 986
181 Ga0207698_10082143 3300026142 Bacteria 2604
182 Ga0268266_11795813 3300028379 Unclassified 588
183 Ga0268266_12118195 3300028379 Bacteria 535
184 Ga0268266_12250744 3300028379 Bacteria 517
185 Ga0268265_10428454 3300028380 Unclassified 1230
186 Ga0268264_10223986 3300028381 Unclassified 1733
187 Ga0268264_10539090 3300028381 Bacteria 1143
188 Ga0265338_10430897 3300028800 Bacteria 936
189 Ga0265324_10177508 3300029957 Bacteria 723
190 Ga0265325_10009803 3300031241 Bacteria 5576
191 Ga0265329_10113739 3300031242 Bacteria 866
192 Ga0265329_10176028 3300031242 Bacteria 699
193 Ga0265331_10058749 3300031250 Bacteria 1820
194 Ga0265327_10511206 3300031251 Bacteria 517
195 Ga0265316_10002556 3300031344 Bacteria 18804
196 Ga0265316_10015888 3300031344 Bacteria 6553
197 Ga0265316_10155684 3300031344 Bacteria 1710
198 Ga0265316_10434786 3300031344 Bacteria 942
199 Ga0265316_10591319 3300031344 Unclassified 787
200 Ga0265313_10038433 3300031595 Bacteria 2383
201 Ga0265313_10169500 3300031595 Bacteria 923
202 Ga0265342_10231633 3300031712 Bacteria 992
203 Ga0265342_10264200 3300031712 Bacteria 915
204 Ga0307516_10103513 3300031730 Bacteria 2660
205 Ga0307516_10821627 3300031730 Unclassified 592
206 Ga0307413_10624159 3300031824 Bacteria 885
207 Ga0307410_11389127 3300031852 Unclassified 616
208 Ga0307407_10211472 3300031903 Bacteria 1306
209 Ga0307407_10686768 3300031903 Bacteria 770
210 Ga0307412_11544557 3300031911 Unclassified 605
211 Ga0307411_10082742 3300032005 Bacteria 2215
212 Ga0307415_100838634 3300032126 Unclassified 842
213 Ga0316585_10186351 3300032137 Bacteria 686
214 Ga0316593_10049163 3300032168 Bacteria 1421
215 Ga0373923_0691139 3300035111 Unclassified 506
216 Ga0373936_0385965 3300035113 Bacteria 641
217 Ga0373945_0113013 3300035116 Bacteria 1073
218 Ga0373956_0344337 3300035119 Unclassified 710
219 Ga0373943_0183132 3300035170 Bacteria 1152
220 Ga0373961_0005544 3300035241 Bacteria 3032
221 Ga0316574_0259981 3300035398 Unclassified 1108
222 Ga0316574_0384688 3300035398 Bacteria 885
223 Ga0373935_0039365 3300035692 Bacteria 2965
224 Ga0373935_1122965 3300035692 Unclassified 585
225 Ga0373927_0000529 3300035695 Bacteria 29006
226 Ga0373927_0420724 3300035695 Unclassified 882
227 Ga0373927_0496160 3300035695 Bacteria 807
228 Ga0373927_1048613 3300035695 Bacteria 538
229 Ga0373947_0000748 3300035725 Bacteria 19497
230 Ga0373937_0875646 3300036401 Unclassified 847
231 Ga0373937_1972180 3300036401 Unclassified 530
232 Ga0316584_0032595 3300036712 Bacteria 3857
233 Ga0316584_0700943 3300036712 Bacteria 694
234 Ga0373925_0000345 3300037068 Bacteria 48292
235 Ga0373925_1479531 3300037068 Bacteria 556
236 Ga0436364_0140004 3300037853 Bacteria 1260
237 Ga0436364_0376590 3300037853 Bacteria 7364
238 Ga0436364_0508034 3300037853 Bacteria 1247
239 Ga0436364_1071877 3300037853 Bacteria 2131
240 Ga0436364_1181643 3300037853 Bacteria 1779
241 Ga0436364_1313581 3300037853 Bacteria 3103
242 Ga0436364_1511998 3300037853 Bacteria 1018
243 Ga0400490_19336 3300038726 Bacteria 3359
244 Ga0400483_209594 3300039062 Unclassified 1156
245 Ga0436365_1118904 3300039437 Unclassified 1535
246 Ga0436365_1123248 3300039437 Unclassified 506
247 Ga0436365_1159700 3300039437 Bacteria 2506
248 Ga0436361_0350597 3300039447 Bacteria 1838
249 Ga0436361_0737457 3300039447 Bacteria 668
250 Ga0436362_0823128 3300039453 Bacteria 2643
251 Ga0451787_689923 3300041441 Bacteria 574
252 Ga0451789_1328410 3300041443 Bacteria 1344
253 Ga0451791_0196384 3300041451 Bacteria 1110
254 Ga0451797_0375220 3300041453 Bacteria 599
255 Ga0451797_0721831 3300041453 Bacteria 1181
256 Ga0451798_0775601 3300041458 Bacteria 1447
257 Ga0451800_0132677 3300041459 Bacteria 1552
258 Ga0451802_0641437 3300041460 Unclassified 934
259 Ga0451802_0696225 3300041460 Bacteria 786
260 Ga0451804_0539831 3300041463 Bacteria 1509
261 Ga0451807_0204840 3300041486 Bacteria 950
262 Ga0451807_0828693 3300041486 Bacteria 1066
263 Ga0451807_1705413 3300041486 Bacteria 1089
264 Ga0451845_0207548 3300041501 Bacteria 719
265 Ga0451853_2280130 3300041512 Bacteria 855
266 Ga0439448_0242441 3300042005 Unclassified 635
267 Ga0439432_029030 3300042006 Bacteria 1800
268 Ga0453683_0605848 3300044673 Unclassified 714
269 Ga0453683_1111615 3300044673 Unclassified 527
270 Ga0466966_0942201 3300044684 Unclassified 521
271 Ga0453684_0001574 3300044712 Bacteria 63302
272 Ga0453684_1740921 3300044712 Bacteria 635
273 Ga0451576_0082722 3300045051 Bacteria 3339
274 Ga0466967_0575538 3300045976 Bacteria 1110
275 Ga0495638_0065324 3300046460 Bacteria 2240
276 Ga0495651_0610265 3300046462 Bacteria 687
277 Ga0495580_0379622 3300046472 Bacteria 955
278 Ga0495580_0711067 3300046472 Unclassified 657
279 Ga0495582_0297888 3300046473 Unclassified 927
280 Ga0495662_0098553 3300046476 Bacteria 1429
281 Ga0495664_0447063 3300046477 Unclassified 774
282 Ga0495585_0066794 3300046492 Bacteria 1968
283 Ga0495628_0298935 3300046516 Bacteria 1192
284 Ga0495628_0511311 3300046516 Unclassified 866
285 Ga0495630_0357096 3300046517 Bacteria 1118
286 Ga0495632_0003746 3300046519 Bacteria 10644
287 Ga0495652_1153522 3300046529 Unclassified 501
288 Ga0495665_0103348 3300046531 Bacteria 1495
289 Ga0495665_0119322 3300046531 Unclassified 1382
290 Ga0495640_0676500 3300046533 Unclassified 620
291 Ga0495645_0616167 3300046543 Unclassified 666
292 Ga0495634_0343418 3300046642 Bacteria 895
293 Ga0495611_0406598 3300046648 Unclassified 622
294 Ga0495635_0026373 3300046663 Bacteria 4044
295 Ga0495599_0203112 3300046678 Unclassified 1217
296 Ga0495623_0129566 3300046679 Bacteria 1512
297 Ga0495613_0436629 3300046689 Bacteria 889
298 Ga0495624_0150536 3300046690 Bacteria 1423
299 Ga0495604_0997569 3300047317 Unclassified 518
300 Ga0495674_0045548 3300047319 Bacteria 3895
301 Ga0495674_0108925 3300047319 Unclassified 2350
302 Ga0495674_0296118 3300047319 Unclassified 1322
303 Ga0495674_0553737 3300047319 Unclassified 915
304 Ga0495674_0696303 3300047319 Bacteria 798
305 Ga0495675_0206048 3300047444 Bacteria 1195
306 Ga0495684_0218999 3300047471 Bacteria 1396
307 Ga0495684_0596000 3300047471 Bacteria 746
308 Ga0495684_1091821 3300047471 Unclassified 501
309 Ga0496102_1925667 3300048905 Unclassified 508
310 Ga0496106_0096214 3300048909 Bacteria 2291
311 Ga0496121_0364666 3300048924 Bacteria 958
312 Ga0501033_0133653 3300049570 Bacteria 1796
313 Ga0501047_0190404 3300049581 Bacteria 1915
314 Ga0501074_1155024 3300049590 Bacteria 543
315 Ga0501239_081664 3300049672 Unclassified 519
316 Ga0501253_087062 3300049683 Bacteria 713
317 Ga0501258_048748 3300049687 Unclassified 586
318 Ga0501080_0101238 3300049742 Unclassified 2673
319 Ga0501083_0516949 3300049744 Bacteria 777
320 Ga0501232_058903 3300049757 Bacteria 610
321 Ga0501266_077031 3300049763 Unclassified 559
322 Ga0501035_0005262 3300049822 Bacteria 12246
323 Ga0501044_0000033 3300049823 Bacteria 167177
324 Ga0501044_0523808 3300049823 Bacteria 1085
325 nmdc:mga0k408_81016_c1 3300050493 Bacteria 1900
326 nmdc:mga05p37_353973_c1 3300050507 Bacteria 1728
327 nmdc:mga09592_342669_c1 3300050508 Bacteria 1294
328 nmdc:mga0qj67_317252_c1 3300050509 Bacteria 1262
329 nmdc:mga0qj67_511071_c1 3300050509 Bacteria 965
330 nmdc:mga0n895_276096_c1 3300050512 Bacteria 1704
331 nmdc:mga08x19_1270270_c1 3300050514 Bacteria 522
332 Ga0495601_0787420 3300053077 Bacteria 604
333 Ga0495612_0612094 3300053078 Unclassified 504
334 Ga0500578_0000192 3300053086 Bacteria 73995
335 Ga0500578_0783557 3300053086 Bacteria 505
336 Ga0500643_178451 3300053087 Bacteria 570
337 Ga0500644_0126253 3300053088 Bacteria 1002
338 Ga0500581_343803 3300053089 Bacteria 569
339 Ga0500646_0258670 3300053090 Bacteria 614
340 Ga0500583_0133092 3300053092 Bacteria 1234
341 Ga0500651_0079083 3300053093 Bacteria 2038
342 Ga0500555_187035 3300053103 Bacteria 500
343 Ga0500562_045074 3300053108 Bacteria 1175
344 Ga0500569_036342 3300053109 Bacteria 1418
345 Ga0500594_0138680 3300053118 Bacteria 775
346 Ga0500623_200432 3300053127 Bacteria 738
347 Ga0500628_000917 3300053129 Bacteria 5195
348 Ga0500628_045549 3300053129 Bacteria 1020
349 Ga0500642_0003199 3300053130 Bacteria 4915
350 Ga0500652_000204 3300053131 Bacteria 22796
351 Ga0500655_009759 3300053133 Bacteria 1732
352 Ga0500568_0005836 3300053139 Bacteria 6275
353 Ga0500577_0070937 3300053142 Bacteria 1366
354 Ga0500577_0099308 3300053142 Bacteria 1188
355 Ga0500588_0103091 3300053146 Bacteria 986
356 Ga0500588_0266891 3300053146 Bacteria 645
357 Ga0500604_0011150 3300053151 Bacteria 2410
358 Ga0500622_0009538 3300053156 Bacteria 5367
359 Ga0500622_0044491 3300053156 Bacteria 2301
360 Ga0500570_185999 3300053724 Bacteria 660
361 Ga0590075_176071 3300059424 Unclassified 565
362 Ga0105241_11849368
363 Ga0070658_10848856
364 Ga0070658_10887558
365 Ga0070683_100000012
366 Ga0070683_100239182
367 Ga0070670_100227069
368 Ga0070670_100301755
369 Ga0070670_100846910
370 Ga0068869_100349938
371 Ga0070680_100871598
372 Ga0070682_100474728
373 Ga0070660_101354777
374 Ga0070689_101423755
375 Ga0070668_100431249
376 Ga0070668_101185134
377 Ga0070669_101029929
378 Ga0070675_100650686
379 Ga0070675_100877481
380 Ga0070671_100726330
381 Ga0070671_101696421
382 Ga0070714_100610186
383 Ga0070705_100184476
384 Ga0070681_10820441
385 Ga0070681_11715296
386 Ga0068867_100297505
387 Ga0068867_101559448
388 Ga0068867_101669159
389 Ga0070685_10411170
390 Ga0070699_101665324
391 Ga0070679_100419295
392 Ga0070679_100448634
393 Ga0070679_101477333
394 Ga0070684_100000013
395 Ga0070684_100178124
396 Ga0070684_100228897
397 Ga0070684_100321635
398 Ga0070684_101727135
399 Ga0068853_100504268
400 Ga0070672_100189910
401 Ga0070672_100317564
402 Ga0070693_101148144
403 Ga0070665_100142933
404 Ga0070665_100278993
405 Ga0070665_100919011
406 Ga0070665_102572666
407 Ga0068855_100102741
408 Ga0068855_101034907
409 Ga0070664_100566243
410 Ga0070664_101482396
411 Ga0068852_100440223
412 Ga0068859_101367320
413 Ga0068859_102853311
414 Ga0068864_100809613
415 Ga0068864_101177160
416 Ga0068866_10033105
417 Ga0068861_100163785
418 Ga0068861_101015468
419 Ga0068861_101872944
420 Ga0068863_101550419
421 Ga0068860_100775278
422 Ga0070717_11425315
423 Ga0070715_10985524
424 Ga0070716_101337979
425 Ga0075366_10086879
426 Ga0097621_101243563
427 Ga0097621_101855032
428 Ga0075430_100046750
429 Ga0075430_100443170
430 Ga0075430_100963750
431 Ga0075431_100770910
432 Ga0075433_11921214
433 Ga0075434_100272430
434 Ga0075429_100351752
435 Ga0097620_100091190
436 Ga0097620_101367268
437 Ga0097620_102852460
438 Ga0105240_10034165
439 Ga0105240_10083402
440 Ga0105240_10228374
441 Ga0105240_10268107
442 Ga0105245_10093222
443 Ga0105245_11496112
444 Ga0105247_11611547
445 Ga0114129_10039169
446 Ga0105241_11922864
447 Ga0105241_12511805
448 Ga0105248_10348848
449 Ga0105248_11058029
450 Ga0105248_12906088
451 Ga0105237_10008074
452 Ga0105237_10035432
453 Ga0105237_10636245
454 Ga0105237_10962031
455 Ga0105237_11636119
456 Ga0105238_10627891
457 Ga0105238_10636537
458 Ga0105238_10810490
459 Ga0105239_10508188
460 Ga0105239_10632324
461 Ga0105239_10889096
462 Ga0157373_10651927
463 Ga0157371_11198087
464 Ga0157370_10163558
465 Ga0157370_10738560
466 Ga0157370_11003656
467 Ga0157369_10107338
468 Ga0157374_10099358
469 Ga0157374_10860116
470 Ga0157374_11316971
471 Ga0157374_12981085
472 Ga0157378_11901816
473 Ga0163162_10182182
474 Ga0157372_10053503
475 Ga0157372_11946681
476 Ga0157372_12908474
477 Ga0157375_10470011
478 Ga0157375_11681711
479 Ga0163163_10042533
480 Ga0163163_10321445
481 Ga0163163_12421118
482 Ga0157380_10137613
483 Ga0157380_11717399
484 Ga0157377_11622244
485 Ga0157376_10100241
486 Ga0157376_10256887
487 Ga0157376_11137765
488 Ga0213876_10348150
489 Ga0213875_10000006
490 Ga0213875_10046271
491 Ga0213875_10128293
492 Ga0213875_10435067
493 Ga0207656_10353841
494 Ga0207642_10022144
495 Ga0207645_10077255
496 Ga0207705_10442941
497 Ga0207707_10841195
498 Ga0207707_11425367
499 Ga0207695_10063830
500 Ga0207695_10215164
501 Ga0207695_10465250
502 Ga0207671_10039458
503 Ga0207671_10095097
504 Ga0207663_11077578
505 Ga0207660_11493739
506 Ga0207649_10265823
507 Ga0207652_10617026
508 Ga0207694_10476352
509 Ga0207650_10516091
510 Ga0207659_11308766
511 Ga0207659_11896661
512 Ga0207700_10407382
513 Ga0207664_10799544
514 Ga0207644_10164713
515 Ga0207706_11696871
516 Ga0207669_11966190
517 Ga0207665_10368380
518 Ga0207691_10015616
519 Ga0207691_10085097
520 Ga0207661_10000034
521 Ga0207661_11130220
522 Ga0207679_10147460
523 Ga0207679_10853636
524 Ga0207667_10752683
525 Ga0207667_11769184
526 Ga0207651_10516361
527 Ga0207668_10231277
528 Ga0207658_10673216
529 Ga0207677_11368519
530 Ga0207639_10860795
531 Ga0207639_11298415
532 Ga0207702_12036038
533 Ga0207641_11054097
534 Ga0207641_11650884
535 Ga0207641_12380755
536 Ga0207648_10048328
537 Ga0207648_11406021
538 Ga0207676_10220182
539 Ga0207675_100369731
540 Ga0207675_100392999
541 Ga0207675_100751495
542 Ga0207698_10082143
543 Ga0268266_11795813
544 Ga0268266_12118195
545 Ga0268266_12250744
546 Ga0268265_10428454
547 Ga0268264_10223986
548 Ga0268264_10539090
549 Ga0265338_10430897
550 Ga0265324_10177508
551 Ga0265325_10009803
552 Ga0265329_10113739
553 Ga0265329_10176028
554 Ga0265331_10058749
555 Ga0265327_10511206
556 Ga0265316_10002556
557 Ga0265316_10015888
558 Ga0265316_10155684
559 Ga0265316_10434786
560 Ga0265316_10591319
561 Ga0265313_10038433
562 Ga0265313_10169500
563 Ga0265342_10231633
564 Ga0265342_10264200
565 Ga0307516_10103513
566 Ga0307516_10821627
567 Ga0307413_10624159
568 Ga0307410_11389127
569 Ga0307407_10211472
570 Ga0307407_10686768
571 Ga0307412_11544557
572 Ga0307411_10082742
573 Ga0307415_100838634
574 Ga0316585_10186351
575 Ga0316593_10049163
576 Ga0373923_0691139
577 Ga0373936_0385965
578 Ga0373945_0113013
579 Ga0373956_0344337
580 Ga0373943_0183132
581 Ga0373961_0005544
582 Ga0316574_0259981
583 Ga0316574_0384688
584 Ga0373935_0039365
585 Ga0373935_1122965
586 Ga0373927_0000529
587 Ga0373927_0420724
588 Ga0373927_0496160
589 Ga0373927_1048613
590 Ga0373947_0000748
591 Ga0373937_0875646
592 Ga0373937_1972180
593 Ga0316584_0032595
594 Ga0316584_0700943
595 Ga0373925_0000345
596 Ga0373925_1479531
597 Ga0436364_0140004
598 Ga0436364_0376590
599 Ga0436364_0508034
600 Ga0436364_1071877
601 Ga0436364_1181643
602 Ga0436364_1313581
603 Ga0436364_1511998
604 Ga0400490_19336
605 Ga0400483_209594
606 Ga0436365_1118904
607 Ga0436365_1123248
608 Ga0436365_1159700
609 Ga0436361_0350597
610 Ga0436361_0737457
611 Ga0436362_0823128
612 Ga0451787_689923
613 Ga0451789_1328410
614 Ga0451791_0196384
615 Ga0451797_0375220
616 Ga0451797_0721831
617 Ga0451798_0775601
618 Ga0451800_0132677
619 Ga0451802_0641437
620 Ga0451802_0696225
621 Ga0451804_0539831
622 Ga0451807_0204840
623 Ga0451807_0828693
624 Ga0451807_1705413
625 Ga0451845_0207548
626 Ga0451853_2280130
627 Ga0439448_0242441
628 Ga0439432_029030
629 Ga0453683_0605848
630 Ga0453683_1111615
631 Ga0466966_0942201
632 Ga0453684_0001574
633 Ga0453684_1740921
634 Ga0451576_0082722
635 Ga0466967_0575538
636 Ga0495638_0065324
637 Ga0495651_0610265
638 Ga0495580_0379622
639 Ga0495580_0711067
640 Ga0495582_0297888
641 Ga0495662_0098553
642 Ga0495664_0447063
643 Ga0495585_0066794
644 Ga0495628_0298935
645 Ga0495628_0511311
646 Ga0495630_0357096
647 Ga0495632_0003746
648 Ga0495652_1153522
649 Ga0495665_0103348
650 Ga0495665_0119322
651 Ga0495640_0676500
652 Ga0495645_0616167
653 Ga0495634_0343418
654 Ga0495611_0406598
655 Ga0495635_0026373
656 Ga0495599_0203112
657 Ga0495623_0129566
658 Ga0495613_0436629
659 Ga0495624_0150536
660 Ga0495604_0997569
661 Ga0495674_0045548
662 Ga0495674_0108925
663 Ga0495674_0296118
664 Ga0495674_0553737
665 Ga0495674_0696303
666 Ga0495675_0206048
667 Ga0495684_0218999
668 Ga0495684_0596000
669 Ga0495684_1091821
670 Ga0496102_1925667
671 Ga0496106_0096214
672 Ga0496121_0364666
673 Ga0501033_0133653
674 Ga0501047_0190404
675 Ga0501074_1155024
676 Ga0501239_081664
677 Ga0501253_087062
678 Ga0501258_048748
679 Ga0501080_0101238
680 Ga0501083_0516949
681 Ga0501232_058903
682 Ga0501266_077031
683 Ga0501035_0005262
684 Ga0501044_0000033
685 Ga0501044_0523808
686 nmdc:mga0k408_81016_c1
687 nmdc:mga05p37_353973_c1
688 nmdc:mga09592_342669_c1
689 nmdc:mga0qj67_317252_c1
690 nmdc:mga0qj67_511071_c1
691 nmdc:mga0n895_276096_c1
692 nmdc:mga08x19_1270270_c1
693 Ga0495601_0787420
694 Ga0495612_0612094
695 Ga0500578_0000192
696 Ga0500578_0783557
697 Ga0500643_178451
698 Ga0500644_0126253
699 Ga0500581_343803
700 Ga0500646_0258670
701 Ga0500583_0133092
702 Ga0500651_0079083
703 Ga0500555_187035
704 Ga0500562_045074
705 Ga0500569_036342
706 Ga0500594_0138680
707 Ga0500623_200432
708 Ga0500628_000917
709 Ga0500628_045549
710 Ga0500642_0003199
711 Ga0500652_000204
712 Ga0500655_009759
713 Ga0500568_0005836
714 Ga0500577_0070937
715 Ga0500577_0099308
716 Ga0500588_0103091
717 Ga0500588_0266891
718 Ga0500604_0011150
719 Ga0500622_0009538
720 Ga0500622_0044491
721 Ga0500570_185999
722 Ga0590075_176071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09957

VapB_antitoxin

Bacterial antitoxin of type II TA system, VapB

13

59

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h0m-assembly1.cif.gz_A three-dimensional structure of the quorum sensing protein trar bound to its autoinducer and to its target dna 0.8507 12 36
1l3l-assembly2.cif.gz_C crystal structure of a bacterial quorum-sensing transcription factor complexed with pheromone and dna 0.8366 12 36
1fse-assembly2.cif.gz_F crystal structure of the bacillus subtilis regulatory protein gere 0.7963 9 34
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.7953 12 34
2wvd-assembly2.cif.gz_B structural and mechanistic insights into helicobacter pylori nikr function 0.7272 1 43
ID Description Score Start End Superfamily
1fseF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7963 9 34 1.10.10.10
1fseC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7953 12 34 1.10.10.10
1q5vC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7349 1 38 1.10.1220.10
1q5vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7308 1 41 1.10.1220.10
2hzaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.7215 1 42 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A6I3KX77-F1-model_v4 Type II toxin-antitoxin system VapB family antitoxin 0.9441 2 33
AF-A0A450S5N3-F1-model_v4 Antitoxin of type II TA system, VapB 0.9396 1 42
AF-A0A177QGM3-F1-model_v4 deleted 0.9346 1 37
AF-A0A7X7DQK2-F1-model_v4 Type II toxin-antitoxin system VapB family antitoxin 0.9342 1 35
AF-A0A139SSZ6-F1-model_v4 CopG family transcriptional regulator 0.9337 1 34

Map