F422184

General Info

Members Datasets Scaffolds Average Seq Length
361 180 361 236

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001811|Ga0105240_100018114
Length 271
Sequence MDSEDSNQRPAASXXXSAQPDYHLLQEQLGYTFRDPGLLRLALTHPSVAHEQGLPVQTNQRLEFLGDAVLQLVLTRELYDKFPTFGEGPLTKARAKLVNRRSLAERARQLGLGNYLIVSRGEELSGGRERPSALADTFESLLGAIFLDGEFEAAGSFILREFHGAFGELSVIPILENPKGELQEFLQSFSSESPRYHVVSASGPDHDRVFECTVHHAGVELARGTGKSKKAAESEAALGALAKLRAQKRAAAEAVELPASVDASPKESAPE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
90 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.83
Rhizosphere 98.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10025558 3300005327 Bacteria 4734
2 Ga0070658_10051170 3300005327 Unclassified 3348
3 Ga0070676_10089989 3300005328 Unclassified 1878
4 Ga0070690_100025479 3300005330 Bacteria 3644
5 Ga0070670_100088215 3300005331 Bacteria 2666
6 Ga0070666_10017249 3300005335 Bacteria 4627
7 Ga0070660_100091807 3300005339 Unclassified 2396
8 Ga0070689_100046888 3300005340 Bacteria 3331
9 Ga0070689_100379861 3300005340 Bacteria 1190
10 Ga0070689_100409889 3300005340 Unclassified 1147
11 Ga0070691_10148021 3300005341 Bacteria 1202
12 Ga0070668_100063101 3300005347 Viruses 2871
13 Ga0070675_100087575 3300005354 Bacteria 2604
14 Ga0070675_100545163 3300005354 Unclassified 1048
15 Ga0070671_100088624 3300005355 Bacteria 2590
16 Ga0070673_100591374 3300005364 Unclassified 1011
17 Ga0070667_100003114 3300005367 Bacteria 14255
18 Ga0070714_100464121 3300005435 Bacteria 1204
19 Ga0070714_100975529 3300005435 Unclassified 824
20 Ga0070711_100315249 3300005439 Bacteria 1248
21 Ga0070705_100375905 3300005440 Bacteria 1044
22 Ga0070700_100260155 3300005441 Bacteria 1249
23 Ga0070681_10109811 3300005458 Unclassified 2698
24 Ga0070681_10179832 3300005458 Bacteria 2037
25 Ga0070699_100159524 3300005518 Bacteria 1996
26 Ga0070679_100005461 3300005530 Bacteria 11784
27 Ga0070679_100082061 3300005530 Bacteria 3214
28 Ga0070665_100014164 3300005548 Bacteria 8013
29 Ga0068855_100018096 3300005563 Bacteria 8468
30 Ga0068855_100068248 3300005563 Bacteria 4140
31 Ga0068855_100156388 3300005563 Unclassified 2590
32 Ga0068855_100508821 3300005563 Unclassified 1308
33 Ga0068857_100077985 3300005577 Bacteria 2957
34 Ga0068856_100099130 3300005614 Bacteria 2904
35 Ga0068856_100173071 3300005614 Bacteria 2171
36 Ga0068856_100331062 3300005614 Unclassified 1540
37 Ga0070702_100085810 3300005615 Unclassified 1897
38 Ga0070702_100615340 3300005615 Bacteria 816
39 Ga0068859_100810861 3300005617 Unclassified 1023
40 Ga0068863_100091508 3300005841 Unclassified 2885
41 Ga0068863_100138684 3300005841 Bacteria 2324
42 Ga0068863_100349274 3300005841 Bacteria 1440
43 Ga0068863_100397730 3300005841 Bacteria 1347
44 Ga0068863_100580677 3300005841 Bacteria 1108
45 Ga0068863_100891700 3300005841 Bacteria 889
46 Ga0068860_100208833 3300005843 Bacteria 1894
47 Ga0081455_10068698 3300005937 Bacteria 2948
48 Ga0081455_10096756 3300005937 Bacteria 2380
49 Ga0081455_10161364 3300005937 Bacteria 1717
50 Ga0070717_10238953 3300006028 Bacteria 1601
51 Ga0097621_100866992 3300006237 Unclassified 839
52 Ga0068871_100029330 3300006358 Bacteria 4320
53 Ga0068871_100597928 3300006358 Unclassified 1003
54 Ga0075434_100189436 3300006871 Unclassified 2077
55 Ga0068865_100359581 3300006881 Unclassified 1182
56 Ga0097620_100810818 3300006931 Unclassified 1023
57 Ga0099795_10117955 3300007788 Unclassified 1058
58 Ga0105240_10001811 3300009093 Bacteria 35983
59 Ga0105240_10008536 3300009093 Bacteria 14639
60 Ga0111539_10059518 3300009094 Bacteria 4529
61 Ga0111539_10166143 3300009094 Bacteria 2580
62 Ga0111539_10211690 3300009094 Bacteria 2258
63 Ga0111539_10280010 3300009094 Unclassified 1941
64 Ga0111539_10329426 3300009094 Unclassified 1777
65 Ga0114129_10211069 3300009147 Bacteria 2624
66 Ga0114129_10272629 3300009147 Bacteria 2263
67 Ga0105248_10558045 3300009177 Bacteria 1292
68 Ga0105238_10006065 3300009551 Bacteria 11992
69 Ga0105238_10029893 3300009551 Bacteria 5547
70 Ga0105238_10165847 3300009551 Unclassified 2184
71 Ga0105238_10259502 3300009551 Bacteria 1717
72 Ga0157370_10128657 3300013104 Bacteria 2363
73 Ga0157374_10021765 3300013296 Bacteria 5711
74 Ga0157374_10425857 3300013296 Bacteria 1326
75 Ga0157378_10190863 3300013297 Bacteria 1932
76 Ga0157378_10192344 3300013297 Bacteria 1925
77 Ga0163162_10087378 3300013306 Bacteria 3196
78 Ga0157372_10220632 3300013307 Unclassified 2198
79 Ga0157375_10002976 3300013308 Bacteria 14720
80 Ga0157375_10043049 3300013308 Archaea 4375
81 Ga0157375_10842231 3300013308 Unclassified 1064
82 Ga0163163_10000336 3300014325 Bacteria 45265
83 Ga0163163_10137114 3300014325 Bacteria 2488
84 Ga0157380_10530018 3300014326 Unclassified 1151
85 Ga0157376_10031153 3300014969 Bacteria 4267
86 Ga0157376_10224608 3300014969 Unclassified 1741
87 Ga0207697_10010777 3300025315 Bacteria 3893
88 Ga0207688_10031020 3300025901 Unclassified 2949
89 Ga0207680_10021201 3300025903 Bacteria 3513
90 Ga0207645_10011655 3300025907 Bacteria 5995
91 Ga0207705_10107029 3300025909 Unclassified 2062
92 Ga0207705_10239918 3300025909 Bacteria 1381
93 Ga0207707_10171619 3300025912 Unclassified 1895
94 Ga0207695_10091621 3300025913 Bacteria 3053
95 Ga0207663_10140376 3300025916 Bacteria 1682
96 Ga0207663_10317057 3300025916 Unclassified 1170
97 Ga0207652_10017595 3300025921 Bacteria 5851
98 Ga0207694_10004134 3300025924 Bacteria 11402
99 Ga0207694_10105949 3300025924 Unclassified 2233
100 Ga0207694_10188645 3300025924 Bacteria 1674
101 Ga0207694_10245389 3300025924 Bacteria 1464
102 Ga0207650_10334753 3300025925 Unclassified 1242
103 Ga0207659_10001807 3300025926 Bacteria 12653
104 Ga0207664_10005474 3300025929 Bacteria 8685
105 Ga0207706_10358439 3300025933 Bacteria 1267
106 Ga0207670_10019504 3300025936 Bacteria 4143
107 Ga0207670_10319421 3300025936 Unclassified 1221
108 Ga0207670_10412944 3300025936 Bacteria 1081
109 Ga0207670_10441140 3300025936 Unclassified 1048
110 Ga0207670_10490703 3300025936 Unclassified 996
111 Ga0207669_10039253 3300025937 Bacteria 2734
112 Ga0207704_10282902 3300025938 Bacteria 1262
113 Ga0207691_10049664 3300025940 Bacteria 3844
114 Ga0207711_10877547 3300025941 Bacteria 834
115 Ga0207679_10749313 3300025945 Bacteria 888
116 Ga0207667_10039886 3300025949 Bacteria 5001
117 Ga0207667_10073423 3300025949 Bacteria 3554
118 Ga0207667_10438192 3300025949 Unclassified 1329
119 Ga0207651_10168764 3300025960 Bacteria 1723
120 Ga0207668_10213300 3300025972 Unclassified 1545
121 Ga0207658_10271989 3300025986 Unclassified 1448
122 Ga0207708_10164502 3300026075 Bacteria 1753
123 Ga0207702_10033598 3300026078 Bacteria 4285
124 Ga0207702_10100638 3300026078 Bacteria 2550
125 Ga0207702_10650173 3300026078 Bacteria 1037
126 Ga0207641_10114512 3300026088 Bacteria 2396
127 Ga0207641_10122280 3300026088 Bacteria 2325
128 Ga0207641_10281973 3300026088 Unclassified 1563
129 Ga0207641_10539911 3300026088 Bacteria 1136
130 Ga0207674_10095160 3300026116 Bacteria 2965
131 Ga0207683_10020632 3300026121 Bacteria 5639
132 Ga0209968_1000416 3300027526 Bacteria 6945
133 Ga0209966_1000009 3300027695 Bacteria 86456
134 Ga0268266_10069091 3300028379 Bacteria 3060
135 Ga0268264_10278105 3300028381 Bacteria 1567
136 Ga0265337_1000018 3300028556 Bacteria 76481
137 Ga0265337_1002694 3300028556 Bacteria 7979
138 Ga0265337_1004581 3300028556 Bacteria 5699
139 Ga0265337_1006679 3300028556 Bacteria 4406
140 Ga0265337_1007394 3300028556 Bacteria 4113
141 Ga0265337_1044761 3300028556 Bacteria 1262
142 Ga0265326_10049820 3300028558 Bacteria 1187
143 Ga0265326_10056476 3300028558 Unclassified 1111
144 Ga0265319_1000003 3300028563 Bacteria 340561
145 Ga0265319_1027619 3300028563 Bacteria 2010
146 Ga0265319_1028736 3300028563 Bacteria 1958
147 Ga0265319_1050594 3300028563 Bacteria 1372
148 Ga0265319_1051538 3300028563 Bacteria 1357
149 Ga0265319_1075652 3300028563 Bacteria 1074
150 Ga0265319_1078740 3300028563 Unclassified 1048
151 Ga0265334_10005160 3300028573 Bacteria 5724
152 Ga0265334_10012780 3300028573 Unclassified 3523
153 Ga0265334_10026218 3300028573 Bacteria 2354
154 Ga0265334_10026337 3300028573 Bacteria 2347
155 Ga0265334_10136537 3300028573 Bacteria 870
156 Ga0265318_10058856 3300028577 Bacteria 1433
157 Ga0265323_10000301 3300028653 Bacteria 28570
158 Ga0265323_10008121 3300028653 Bacteria 4340
159 Ga0265323_10027208 3300028653 Bacteria 2149
160 Ga0265323_10040519 3300028653 Bacteria 1694
161 Ga0265323_10063938 3300028653 Unclassified 1273
162 Ga0265323_10080269 3300028653 Unclassified 1102
163 Ga0265323_10099085 3300028653 Bacteria 966
164 Ga0265322_10002003 3300028654 Bacteria 6420
165 Ga0265336_10000653 3300028666 Bacteria 18863
166 Ga0265336_10005548 3300028666 Bacteria 4645
167 Ga0265338_10000084 3300028800 Bacteria 175415
168 Ga0265338_10001253 3300028800 Bacteria 41843
169 Ga0265338_10001736 3300028800 Bacteria 34461
170 Ga0265338_10003009 3300028800 Bacteria 24342
171 Ga0265338_10003617 3300028800 Bacteria 21551
172 Ga0265338_10009171 3300028800 Bacteria 11867
173 Ga0265338_10014918 3300028800 Bacteria 8592
174 Ga0265338_10020270 3300028800 Bacteria 7005
175 Ga0265338_10021501 3300028800 Bacteria 6724
176 Ga0265338_10024610 3300028800 Bacteria 6144
177 Ga0265338_10026576 3300028800 Bacteria 5832
178 Ga0265338_10029776 3300028800 Bacteria 5402
179 Ga0265338_10044677 3300028800 Bacteria 4085
180 Ga0265338_10046291 3300028800 Unclassified 3988
181 Ga0265338_10053132 3300028800 Bacteria 3628
182 Ga0265338_10065040 3300028800 Bacteria 3167
183 Ga0265338_10066600 3300028800 Bacteria 3116
184 Ga0265338_10091438 3300028800 Bacteria 2514
185 Ga0265338_10109196 3300028800 Bacteria 2232
186 Ga0265338_10131188 3300028800 Unclassified 1978
187 Ga0265338_10137161 3300028800 Bacteria 1921
188 Ga0265338_10338319 3300028800 Bacteria 1085
189 Ga0265338_10420825 3300028800 Bacteria 949
190 Ga0265324_10000322 3300029957 Bacteria 35202
191 Ga0265324_10002794 3300029957 Bacteria 8618
192 Ga0265324_10021935 3300029957 Unclassified 2288
193 Ga0265324_10026889 3300029957 Unclassified 2035
194 Ga0265324_10033333 3300029957 Bacteria 1797
195 Ga0265324_10050236 3300029957 Bacteria 1433
196 Ga0265324_10079733 3300029957 Bacteria 1114
197 Ga0265330_10131218 3300031235 Bacteria 1066
198 Ga0265332_10011030 3300031238 Bacteria 4015
199 Ga0265328_10021414 3300031239 Bacteria 2467
200 Ga0265320_10000082 3300031240 Bacteria 81536
201 Ga0265320_10018300 3300031240 Bacteria 3862
202 Ga0265320_10022445 3300031240 Bacteria 3375
203 Ga0265320_10095038 3300031240 Bacteria 1378
204 Ga0265325_10004640 3300031241 Bacteria 8624
205 Ga0265325_10052516 3300031241 Bacteria 2092
206 Ga0265325_10164317 3300031241 Bacteria 1042
207 Ga0265329_10002083 3300031242 Bacteria 9308
208 Ga0265329_10022472 3300031242 Bacteria 2110
209 Ga0265329_10060156 3300031242 Unclassified 1203
210 Ga0265340_10001884 3300031247 Bacteria 11946
211 Ga0265340_10015248 3300031247 Bacteria 3998
212 Ga0265340_10028648 3300031247 Bacteria 2800
213 Ga0265339_10038091 3300031249 Bacteria 2684
214 Ga0265339_10041937 3300031249 Bacteria 2536
215 Ga0265316_10001012 3300031344 Bacteria 30488
216 Ga0265316_10005026 3300031344 Bacteria 12975
217 Ga0265316_10023822 3300031344 Bacteria 5141
218 Ga0265316_10031652 3300031344 Bacteria 4323
219 Ga0265316_10122175 3300031344 Unclassified 1966
220 Ga0265316_10186037 3300031344 Bacteria 1545
221 Ga0265316_10288229 3300031344 Unclassified 1198
222 Ga0265316_10336862 3300031344 Bacteria 1094
223 Ga0307408_100169582 3300031548 Bacteria 1742
224 Ga0265313_10004036 3300031595 Bacteria 11448
225 Ga0265313_10019001 3300031595 Bacteria 3840
226 Ga0265314_10001286 3300031711 Bacteria 28495
227 Ga0265314_10027147 3300031711 Unclassified 4290
228 Ga0265314_10052806 3300031711 Bacteria 2823
229 Ga0265314_10077408 3300031711 Bacteria 2206
230 Ga0265314_10214317 3300031711 Bacteria 1129
231 Ga0265342_10146860 3300031712 Unclassified 1312
232 Ga0307406_10325186 3300031901 Bacteria 1191
233 Ga0307412_10509969 3300031911 Unclassified 1003
234 Ga0316593_10043406 3300032168 Bacteria 1502
235 Ga0373930_0001080 3300034816 Bacteria 3941
236 Ga0373950_0003909 3300034818 Bacteria 2162
237 Ga0373926_0028355 3300035083 Unclassified 1965
238 Ga0373926_0034640 3300035083 Bacteria 1788
239 Ga0373928_0000295 3300035084 Bacteria 9889
240 Ga0373929_0000463 3300035085 Bacteria 7749
241 Ga0373940_0012712 3300035088 Unclassified 2021
242 Ga0373944_0000259 3300035089 Bacteria 11666
243 Ga0373949_0004322 3300035090 Bacteria 3264
244 Ga0373923_0049809 3300035111 Bacteria 1753
245 Ga0373923_0083692 3300035111 Bacteria 1387
246 Ga0373932_0000004 3300035112 Bacteria 412176
247 Ga0373945_0016617 3300035116 Bacteria 2484
248 Ga0373945_0039893 3300035116 Bacteria 1694
249 Ga0373954_0009767 3300035118 Bacteria 4224
250 Ga0373956_0006696 3300035119 Bacteria 4623
251 Ga0373956_0010677 3300035119 Bacteria 3771
252 Ga0373943_0156090 3300035170 Bacteria 1239
253 Ga0373955_0101288 3300035172 Unclassified 1654
254 Ga0373962_0000213 3300035242 Bacteria 12222
255 Ga0373924_0144238 3300035410 Unclassified 1040
256 Ga0373924_0163421 3300035410 Bacteria 977
257 Ga0373931_0000009 3300035691 Bacteria 349854
258 Ga0373931_0115048 3300035691 Bacteria 1531
259 Ga0373935_0000667 3300035692 Bacteria 18098
260 Ga0373927_0005952 3300035695 Bacteria 8352
261 Ga0373927_0119164 3300035695 Bacteria 1722
262 Ga0373933_0011400 3300035724 Bacteria 4898
263 Ga0373947_0072309 3300035725 Bacteria 2117
264 Ga0373937_0000664 3300036401 Bacteria 30157
265 Ga0373937_0050932 3300036401 Unclassified 3795
266 Ga0373937_0105740 3300036401 Bacteria 2616
267 Ga0373937_0917135 3300036401 Bacteria 825
268 Ga0373925_0000930 3300037068 Bacteria 26664
269 Ga0373925_0001123 3300037068 Bacteria 23752
270 Ga0373925_0224349 3300037068 Bacteria 1501
271 Ga0451577_0007538 3300042876 Bacteria 10685
272 Ga0451577_0049467 3300042876 Bacteria 3754
273 Ga0451577_0155033 3300042876 Unclassified 2061
274 Ga0451577_0155138 3300042876 Bacteria 2060
275 Ga0453684_0002419 3300044712 Bacteria 45391
276 Ga0453684_0003390 3300044712 Bacteria 36045
277 Ga0453684_0006095 3300044712 Bacteria 23250
278 Ga0453684_0298977 3300044712 Unclassified 1830
279 Ga0451576_0022957 3300045051 Bacteria 6761
280 Ga0451576_0029461 3300045051 Bacteria 5873
281 Ga0451576_0047704 3300045051 Bacteria 4502
282 Ga0451576_0054190 3300045051 Unclassified 4200
283 Ga0451576_0082489 3300045051 Bacteria 3344
284 Ga0451576_0165639 3300045051 Bacteria 2307
285 Ga0451576_0213626 3300045051 Bacteria 2015
286 Ga0451576_0471676 3300045051 Unclassified 1318
287 Ga0495592_0000615 3300046454 Bacteria 25232
288 Ga0495629_0035312 3300046459 Bacteria 3533
289 Ga0495629_0316074 3300046459 Bacteria 1068
290 Ga0495629_0414287 3300046459 Bacteria 915
291 Ga0495641_0007533 3300046461 Bacteria 6780
292 Ga0495653_0324023 3300046463 Bacteria 998
293 Ga0495582_0065601 3300046473 Bacteria 2006
294 Ga0495639_0078758 3300046475 Unclassified 1532
295 Ga0495664_0238351 3300046477 Bacteria 1100
296 Ga0495618_0005007 3300046514 Bacteria 8095
297 Ga0495618_0020472 3300046514 Bacteria 4071
298 Ga0495628_0001080 3300046516 Bacteria 24911
299 Ga0495630_0000220 3300046517 Bacteria 45190
300 Ga0495630_0005206 3300046517 Bacteria 9164
301 Ga0495630_0009713 3300046517 Bacteria 6921
302 Ga0495630_0248681 3300046517 Bacteria 1358
303 Ga0495630_0335480 3300046517 Unclassified 1156
304 Ga0495666_0001943 3300046526 Bacteria 10191
305 Ga0495666_0024599 3300046526 Bacteria 2975
306 Ga0495652_0413594 3300046529 Bacteria 952
307 Ga0495640_0046962 3300046533 Unclassified 2989
308 Ga0495640_0200143 3300046533 Bacteria 1266
309 Ga0495586_0000017 3300046535 Bacteria 116426
310 Ga0495586_0001266 3300046535 Bacteria 14162
311 Ga0495586_0017749 3300046535 Bacteria 3786
312 Ga0495586_0052536 3300046535 Bacteria 2206
313 Ga0495587_0229883 3300046536 Unclassified 1045
314 Ga0495645_0093849 3300046543 Bacteria 2141
315 Ga0495645_0162142 3300046543 Bacteria 1545
316 Ga0495645_0236407 3300046543 Bacteria 1221
317 Ga0495622_0034974 3300046557 Unclassified 2343
318 Ga0495667_0022499 3300046559 Bacteria 4246
319 Ga0495667_0324218 3300046559 Unclassified 974
320 Ga0495634_0005260 3300046642 Bacteria 9996
321 Ga0495634_0076859 3300046642 Bacteria 2191
322 Ga0495634_0159369 3300046642 Unclassified 1423
323 Ga0495634_0241058 3300046642 Bacteria 1109
324 Ga0495599_0024910 3300046678 Bacteria 3742
325 Ga0495599_0268481 3300046678 Bacteria 1035
326 Ga0495647_0003546 3300046681 Bacteria 5000
327 Ga0495647_0006443 3300046681 Unclassified 3886
328 Ga0495658_0002669 3300046683 Bacteria 8974
329 Ga0495658_0040204 3300046683 Bacteria 2599
330 Ga0495658_0213493 3300046683 Unclassified 1206
331 Ga0495669_0041877 3300046684 Bacteria 2035
332 Ga0495613_0000536 3300046689 Bacteria 31578
333 Ga0495613_0003861 3300046689 Bacteria 11209
334 Ga0495613_0086776 3300046689 Unclassified 2269
335 Ga0495613_0131314 3300046689 Bacteria 1793
336 Ga0495624_0076475 3300046690 Bacteria 2077
337 Ga0495624_0393463 3300046690 Unclassified 832
338 Ga0495581_0167425 3300047315 Unclassified 1285
339 Ga0495674_0000243 3300047319 Bacteria 45976
340 Ga0495674_0057180 3300047319 Bacteria 3414
341 Ga0495674_0404273 3300047319 Unclassified 1102
342 Ga0495676_0029139 3300047321 Bacteria 4703
343 Ga0495676_0121161 3300047321 Unclassified 1902
344 Ga0495680_0016532 3300047322 Bacteria 6334
345 Ga0495684_0142259 3300047471 Bacteria 1798
346 Ga0495614_0071161 3300048089 Unclassified 1499
347 Ga0496104_0536472 3300048907 Bacteria 1081
348 Ga0496114_0137807 3300048917 Bacteria 2111
349 Ga0496115_0002981 3300048918 Bacteria 12160
350 Ga0501040_0280950 3300049576 Bacteria 1189
351 Ga0501071_0248724 3300049587 Bacteria 1342
352 Ga0501076_0426820 3300049592 Bacteria 1091
353 Ga0501242_010244 3300049674 Unclassified 1118
354 Ga0501081_0174858 3300049743 Bacteria 1551
355 nmdc:mga05p37_343290_c2 3300050507 Bacteria 992
356 nmdc:mga0qj67_28159_c1 3300050509 Unclassified 4359
357 nmdc:mga08y16_131202_c1 3300050511 Bacteria 2605
358 nmdc:mga08y16_259369_c1 3300050511 Bacteria 1795
359 nmdc:mga0n895_285006_c1 3300050512 Bacteria 1675
360 nmdc:mga0n895_385720_c1 3300050512 Bacteria 1417
361 Ga0500650_0196825 3300053098 Bacteria 919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100866992 Ga0097621_1008669921 210
2 3300025916 Ga0207663_10317057 Ga0207663_103170572 211
3 3300005937 Ga0081455_10161364 Ga0081455_101613643 212
4 3300042876 Ga0451577_0049467 Ga0451577_0049467_2175_2888 212
5 3300005518 Ga0070699_100159524 Ga0070699_1001595243 213
6 3300005841 Ga0068863_100349274 Ga0068863_1003492741 213
7 3300028800 Ga0265338_10001736 Ga0265338_1000173611 213
8 3300031249 Ga0265339_10041937 Ga0265339_100419373 213
9 3300042876 Ga0451577_0007538 Ga0451577_0007538_9569_10303 213
10 3300044712 Ga0453684_0003390 Ga0453684_0003390_31659_32393 213
11 3300009094 Ga0111539_10166143 Ga0111539_101661432 214
12 3300025936 Ga0207670_10019504 Ga0207670_100195043 214
13 3300031712 Ga0265342_10146860 Ga0265342_101468601 214
14 3300050509 nmdc:mga0qj67_28159_c1 nmdc:mga0qj67_28159_c1_120_830 214
15 3300050511 nmdc:mga08y16_259369_c1 nmdc:mga08y16_259369_c1_941_1645 214
16 3300005340 Ga0070689_100409889 Ga0070689_1004098892 215
17 3300025936 Ga0207670_10412944 Ga0207670_104129442 215
18 3300014969 Ga0157376_10224608 Ga0157376_102246082 216
19 3300035083 Ga0373926_0034640 Ga0373926_0034640_145_900 216
20 3300035111 Ga0373923_0083692 Ga0373923_0083692_561_1316 216
21 3300035116 Ga0373945_0039893 Ga0373945_0039893_212_967 216
22 3300035170 Ga0373943_0156090 Ga0373943_0156090_149_904 216
23 3300035410 Ga0373924_0163421 Ga0373924_0163421_110_865 216
24 3300035692 Ga0373935_0000667 Ga0373935_0000667_1976_2731 216
25 3300035695 Ga0373927_0005952 Ga0373927_0005952_674_1429 216
26 3300035725 Ga0373947_0072309 Ga0373947_0072309_1067_1822 216
27 3300037068 Ga0373925_0000930 Ga0373925_0000930_9458_10213 216
28 3300046517 Ga0495630_0009713 Ga0495630_0009713_4178_4933 216
29 3300005435 Ga0070714_100975529 Ga0070714_1009755291 217
30 3300005843 Ga0068860_100208833 Ga0068860_1002088332 217
31 3300005937 Ga0081455_10096756 Ga0081455_100967561 217
32 3300028381 Ga0268264_10278105 Ga0268264_102781052 217
33 3300028800 Ga0265338_10109196 Ga0265338_101091963 217
34 3300036401 Ga0373937_0917135 Ga0373937_0917135_23_709 217
35 3300028563 Ga0265319_1027619 Ga0265319_10276191 218
36 3300028573 Ga0265334_10136537 Ga0265334_101365371 218
37 3300028800 Ga0265338_10066600 Ga0265338_100666002 218
38 3300031595 Ga0265313_10019001 Ga0265313_100190012 218
39 3300037068 Ga0373925_0224349 Ga0373925_0224349_505_1173 218
40 3300042876 Ga0451577_0155033 Ga0451577_0155033_951_1688 218
41 3300009094 Ga0111539_10059518 Ga0111539_100595182 219
42 3300028563 Ga0265319_1028736 Ga0265319_10287362 219
43 3300028800 Ga0265338_10026576 Ga0265338_100265764 219
44 3300031240 Ga0265320_10022445 Ga0265320_100224452 219
45 3300031241 Ga0265325_10052516 Ga0265325_100525161 219
46 3300035083 Ga0373926_0028355 Ga0373926_0028355_667_1431 219
47 3300046459 Ga0495629_0035312 Ga0495629_0035312_127_891 219
48 3300046517 Ga0495630_0000220 Ga0495630_0000220_28346_29110 219
49 3300046526 Ga0495666_0001943 Ga0495666_0001943_9026_9790 219
50 3300046535 Ga0495586_0000017 Ga0495586_0000017_51519_52283 219
51 3300046642 Ga0495634_0159369 Ga0495634_0159369_407_1171 219
52 3300046681 Ga0495647_0003546 Ga0495647_0003546_398_1162 219
53 3300046683 Ga0495658_0040204 Ga0495658_0040204_266_1030 219
54 3300046689 Ga0495613_0131314 Ga0495613_0131314_476_1240 219
55 3300046690 Ga0495624_0076475 Ga0495624_0076475_537_1259 219
56 3300047315 Ga0495581_0167425 Ga0495581_0167425_20_784 219
57 3300047319 Ga0495674_0000243 Ga0495674_0000243_2461_3225 219
58 3300047321 Ga0495676_0121161 Ga0495676_0121161_605_1369 219
59 3300050511 nmdc:mga08y16_131202_c1 nmdc:mga08y16_131202_c1_1703_2428 219
60 3300029957 Ga0265324_10033333 Ga0265324_100333333 220
61 3300032168 Ga0316593_10043406 Ga0316593_100434062 220
62 3300005435 Ga0070714_100464121 Ga0070714_1004641211 221
63 3300005439 Ga0070711_100315249 Ga0070711_1003152491 221
64 3300025916 Ga0207663_10140376 Ga0207663_101403762 221
65 3300031711 Ga0265314_10052806 Ga0265314_100528064 221
66 3300044712 Ga0453684_0298977 Ga0453684_0298977_318_1058 221
67 3300013104 Ga0157370_10128657 Ga0157370_101286574 222
68 3300028573 Ga0265334_10026337 Ga0265334_100263372 222
69 3300031247 Ga0265340_10015248 Ga0265340_100152483 222
70 3300042876 Ga0451577_0155138 Ga0451577_0155138_1007_1768 222
71 3300044712 Ga0453684_0002419 Ga0453684_0002419_33470_34231 222
72 3300048907 Ga0496104_0536472 Ga0496104_0536472_85_837 222
73 3300029957 Ga0265324_10002794 Ga0265324_100027942 223
74 3300005330 Ga0070690_100025479 Ga0070690_1000254793 224
75 3300005340 Ga0070689_100379861 Ga0070689_1003798612 224
76 3300005440 Ga0070705_100375905 Ga0070705_1003759052 224
77 3300005530 Ga0070679_100005461 Ga0070679_1000054612 224
78 3300005563 Ga0068855_100068248 Ga0068855_1000682483 224
79 3300005614 Ga0068856_100173071 Ga0068856_1001730712 224
80 3300009093 Ga0105240_10008536 Ga0105240_100085367 224
81 3300009551 Ga0105238_10259502 Ga0105238_102595022 224
82 3300025921 Ga0207652_10017595 Ga0207652_100175953 224
83 3300025924 Ga0207694_10188645 Ga0207694_101886452 224
84 3300025949 Ga0207667_10073423 Ga0207667_100734233 224
85 3300026078 Ga0207702_10033598 Ga0207702_100335984 224
86 3300026078 Ga0207702_10650173 Ga0207702_106501732 224
87 3300027526 Ga0209968_1000416 Ga0209968_10004165 224
88 3300027695 Ga0209966_1000009 Ga0209966_100000971 224
89 3300028556 Ga0265337_1000018 Ga0265337_100001858 224
90 3300028556 Ga0265337_1007394 Ga0265337_10073942 224
91 3300028653 Ga0265323_10063938 Ga0265323_100639381 224
92 3300028800 Ga0265338_10000084 Ga0265338_1000008488 224
93 3300028800 Ga0265338_10131188 Ga0265338_101311884 224
94 3300031235 Ga0265330_10131218 Ga0265330_101312182 224
95 3300031247 Ga0265340_10028648 Ga0265340_100286482 224
96 3300031344 Ga0265316_10186037 Ga0265316_101860372 224
97 3300034816 Ga0373930_0001080 Ga0373930_0001080_1181_1870 224
98 3300034818 Ga0373950_0003909 Ga0373950_0003909_232_921 224
99 3300035084 Ga0373928_0000295 Ga0373928_0000295_4615_5304 224
100 3300035085 Ga0373929_0000463 Ga0373929_0000463_592_1281 224
101 3300035088 Ga0373940_0012712 Ga0373940_0012712_932_1621 224
102 3300035089 Ga0373944_0000259 Ga0373944_0000259_8997_9686 224
103 3300035090 Ga0373949_0004322 Ga0373949_0004322_966_1655 224
104 3300035112 Ga0373932_0000004 Ga0373932_0000004_394510_395199 224
105 3300035116 Ga0373945_0016617 Ga0373945_0016617_1334_2023 224
106 3300035242 Ga0373962_0000213 Ga0373962_0000213_9049_9738 224
107 3300035691 Ga0373931_0000009 Ga0373931_0000009_223973_224662 224
108 3300035695 Ga0373927_0119164 Ga0373927_0119164_645_1334 224
109 3300037068 Ga0373925_0001123 Ga0373925_0001123_11776_12465 224
110 3300045051 Ga0451576_0022957 Ga0451576_0022957_5467_6156 224
111 3300005841 Ga0068863_100138684 Ga0068863_1001386843 225
112 3300026088 Ga0207641_10114512 Ga0207641_101145123 225
113 3300046557 Ga0495622_0034974 Ga0495622_0034974_617_1309 225
114 3300005563 Ga0068855_100156388 Ga0068855_1001563882 226
115 3300007788 Ga0099795_10117955 Ga0099795_101179552 226
116 3300009551 Ga0105238_10006065 Ga0105238_100060657 226
117 3300025924 Ga0207694_10004134 Ga0207694_100041346 226
118 3300028556 Ga0265337_1044761 Ga0265337_10447612 226
119 3300028563 Ga0265319_1000003 Ga0265319_1000003162 226
120 3300028563 Ga0265319_1051538 Ga0265319_10515382 226
121 3300028653 Ga0265323_10099085 Ga0265323_100990851 226
122 3300028800 Ga0265338_10020270 Ga0265338_100202704 226
123 3300028800 Ga0265338_10065040 Ga0265338_100650402 226
124 3300028800 Ga0265338_10420825 Ga0265338_104208252 226
125 3300029957 Ga0265324_10021935 Ga0265324_100219352 226
126 3300029957 Ga0265324_10050236 Ga0265324_100502362 226
127 3300029957 Ga0265324_10079733 Ga0265324_100797332 226
128 3300031240 Ga0265320_10018300 Ga0265320_100183003 226
129 3300031241 Ga0265325_10004640 Ga0265325_100046404 226
130 3300031241 Ga0265325_10164317 Ga0265325_101643171 226
131 3300031344 Ga0265316_10122175 Ga0265316_101221753 226
132 3300031595 Ga0265313_10004036 Ga0265313_100040367 226
133 3300031711 Ga0265314_10027147 Ga0265314_100271473 226
134 3300035118 Ga0373954_0009767 Ga0373954_0009767_150_842 226
135 3300035119 Ga0373956_0006696 Ga0373956_0006696_3880_4572 226
136 3300035172 Ga0373955_0101288 Ga0373955_0101288_702_1394 226
137 3300035724 Ga0373933_0011400 Ga0373933_0011400_3519_4211 226
138 3300036401 Ga0373937_0000664 Ga0373937_0000664_2626_3318 226
139 3300046514 Ga0495618_0005007 Ga0495618_0005007_6396_7088 226
140 3300046535 Ga0495586_0001266 Ga0495586_0001266_6867_7559 226
141 3300046536 Ga0495587_0229883 Ga0495587_0229883_40_732 226
142 3300046559 Ga0495667_0324218 Ga0495667_0324218_109_801 226
143 3300046642 Ga0495634_0005260 Ga0495634_0005260_8888_9580 226
144 3300046681 Ga0495647_0006443 Ga0495647_0006443_1985_2677 226
145 3300046689 Ga0495613_0000536 Ga0495613_0000536_30699_31391 226
146 3300047322 Ga0495680_0016532 Ga0495680_0016532_268_960 226
147 3300005458 Ga0070681_10109811 Ga0070681_101098113 227
148 3300005458 Ga0070681_10179832 Ga0070681_101798322 227
149 3300005530 Ga0070679_100082061 Ga0070679_1000820613 227
150 3300005563 Ga0068855_100018096 Ga0068855_1000180965 227
151 3300005563 Ga0068855_100508821 Ga0068855_1005088211 227
152 3300005614 Ga0068856_100331062 Ga0068856_1003310622 227
153 3300009551 Ga0105238_10029893 Ga0105238_100298932 227
154 3300013307 Ga0157372_10220632 Ga0157372_102206322 227
155 3300025912 Ga0207707_10171619 Ga0207707_101716192 227
156 3300025924 Ga0207694_10245389 Ga0207694_102453891 227
157 3300025929 Ga0207664_10005474 Ga0207664_100054748 227
158 3300025949 Ga0207667_10039886 Ga0207667_100398861 227
159 3300025949 Ga0207667_10438192 Ga0207667_104381921 227
160 3300028556 Ga0265337_1006679 Ga0265337_10066794 227
161 3300028563 Ga0265319_1075652 Ga0265319_10756522 227
162 3300028573 Ga0265334_10005160 Ga0265334_100051607 227
163 3300028573 Ga0265334_10012780 Ga0265334_100127804 227
164 3300028666 Ga0265336_10000653 Ga0265336_1000065324 227
165 3300028666 Ga0265336_10005548 Ga0265336_100055484 227
166 3300028800 Ga0265338_10009171 Ga0265338_1000917115 227
167 3300028800 Ga0265338_10053132 Ga0265338_100531323 227
168 3300031247 Ga0265340_10001884 Ga0265340_100018847 227
169 3300045051 Ga0451576_0471676 Ga0451576_0471676_195_977 227
170 3300005441 Ga0070700_100260155 Ga0070700_1002601552 228
171 3300005614 Ga0068856_100099130 Ga0068856_1000991304 228
172 3300005937 Ga0081455_10068698 Ga0081455_100686984 228
173 3300009094 Ga0111539_10211690 Ga0111539_102116902 228
174 3300026075 Ga0207708_10164502 Ga0207708_101645022 228
175 3300026078 Ga0207702_10100638 Ga0207702_101006382 228
176 3300028800 Ga0265338_10044677 Ga0265338_100446773 228
177 3300029957 Ga0265324_10026889 Ga0265324_100268892 228
178 3300031238 Ga0265332_10011030 Ga0265332_100110302 228
179 3300031239 Ga0265328_10021414 Ga0265328_100214143 228
180 3300031242 Ga0265329_10002083 Ga0265329_100020839 228
181 3300031711 Ga0265314_10001286 Ga0265314_100012869 228
182 3300005341 Ga0070691_10148021 Ga0070691_101480212 229
183 3300005841 Ga0068863_100397730 Ga0068863_1003977301 229
184 3300009094 Ga0111539_10329426 Ga0111539_103294262 229
185 3300013308 Ga0157375_10842231 Ga0157375_108422312 229
186 3300014325 Ga0163163_10000336 Ga0163163_1000033625 229
187 3300025936 Ga0207670_10490703 Ga0207670_104907032 229
188 3300028558 Ga0265326_10056476 Ga0265326_100564762 229
189 3300028800 Ga0265338_10091438 Ga0265338_100914382 229
190 3300029957 Ga0265324_10000322 Ga0265324_1000032213 229
191 3300031344 Ga0265316_10288229 Ga0265316_102882292 229
192 3300031344 Ga0265316_10336862 Ga0265316_103368622 229
193 3300031548 Ga0307408_100169582 Ga0307408_1001695822 229
194 3300031901 Ga0307406_10325186 Ga0307406_103251862 229
195 3300031911 Ga0307412_10509969 Ga0307412_105099692 229
196 3300036401 Ga0373937_0050932 Ga0373937_0050932_1947_2651 229
197 3300045051 Ga0451576_0047704 Ga0451576_0047704_3704_4423 229
198 3300046454 Ga0495592_0000615 Ga0495592_0000615_24360_25064 229
199 3300046459 Ga0495629_0316074 Ga0495629_0316074_293_997 229
200 3300046461 Ga0495641_0007533 Ga0495641_0007533_4601_5362 229
201 3300046473 Ga0495582_0065601 Ga0495582_0065601_1162_1923 229
202 3300046475 Ga0495639_0078758 Ga0495639_0078758_611_1372 229
203 3300046477 Ga0495664_0238351 Ga0495664_0238351_157_861 229
204 3300046514 Ga0495618_0020472 Ga0495618_0020472_204_908 229
205 3300046516 Ga0495628_0001080 Ga0495628_0001080_13367_14071 229
206 3300046517 Ga0495630_0005206 Ga0495630_0005206_7280_7984 229
207 3300046517 Ga0495630_0248681 Ga0495630_0248681_603_1307 229
208 3300046517 Ga0495630_0335480 Ga0495630_0335480_310_1014 229
209 3300046526 Ga0495666_0024599 Ga0495666_0024599_1467_2171 229
210 3300046533 Ga0495640_0046962 Ga0495640_0046962_595_1299 229
211 3300046533 Ga0495640_0200143 Ga0495640_0200143_120_824 229
212 3300046535 Ga0495586_0017749 Ga0495586_0017749_1880_2641 229
213 3300046535 Ga0495586_0052536 Ga0495586_0052536_94_798 229
214 3300046543 Ga0495645_0236407 Ga0495645_0236407_335_1039 229
215 3300046559 Ga0495667_0022499 Ga0495667_0022499_2161_2865 229
216 3300046642 Ga0495634_0076859 Ga0495634_0076859_261_1022 229
217 3300046642 Ga0495634_0241058 Ga0495634_0241058_87_791 229
218 3300046678 Ga0495599_0024910 Ga0495599_0024910_2587_3291 229
219 3300046683 Ga0495658_0002669 Ga0495658_0002669_3118_3879 229
220 3300046689 Ga0495613_0003861 Ga0495613_0003861_8675_9436 229
221 3300046689 Ga0495613_0086776 Ga0495613_0086776_472_1176 229
222 3300046690 Ga0495624_0393463 Ga0495624_0393463_48_809 229
223 3300047319 Ga0495674_0057180 Ga0495674_0057180_2578_3282 229
224 3300047319 Ga0495674_0404273 Ga0495674_0404273_192_896 229
225 3300047321 Ga0495676_0029139 Ga0495676_0029139_3279_4040 229
226 3300048089 Ga0495614_0071161 Ga0495614_0071161_180_941 229
227 3300049674 Ga0501242_010244 Ga0501242_010244_372_1082 229
228 3300005841 Ga0068863_100091508 Ga0068863_1000915083 230
229 3300014325 Ga0163163_10137114 Ga0163163_101371143 230
230 3300026088 Ga0207641_10122280 Ga0207641_101222802 230
231 3300028800 Ga0265338_10137161 Ga0265338_101371613 230
232 3300028800 Ga0265338_10338319 Ga0265338_103383191 230
233 3300035691 Ga0373931_0115048 Ga0373931_0115048_314_1021 230
234 3300045051 Ga0451576_0054190 Ga0451576_0054190_1051_1758 230
235 3300045051 Ga0451576_0165639 Ga0451576_0165639_1426_2133 230
236 3300048918 Ga0496115_0002981 Ga0496115_0002981_7492_8223 230
237 3300005617 Ga0068859_100810861 Ga0068859_1008108611 231
238 3300005841 Ga0068863_100891700 Ga0068863_1008917001 231
239 3300006871 Ga0075434_100189436 Ga0075434_1001894363 231
240 3300006931 Ga0097620_100810818 Ga0097620_1008108182 231
241 3300009147 Ga0114129_10272629 Ga0114129_102726293 231
242 3300014326 Ga0157380_10530018 Ga0157380_105300181 231
243 3300025941 Ga0207711_10877547 Ga0207711_108775471 231
244 3300026088 Ga0207641_10281973 Ga0207641_102819731 231
245 3300028556 Ga0265337_1002694 Ga0265337_10026942 231
246 3300028556 Ga0265337_1004581 Ga0265337_10045817 231
247 3300028558 Ga0265326_10049820 Ga0265326_100498202 231
248 3300028563 Ga0265319_1050594 Ga0265319_10505941 231
249 3300028573 Ga0265334_10026218 Ga0265334_100262182 231
250 3300028577 Ga0265318_10058856 Ga0265318_100588562 231
251 3300028653 Ga0265323_10027208 Ga0265323_100272082 231
252 3300028800 Ga0265338_10001253 Ga0265338_1000125336 231
253 3300028800 Ga0265338_10003617 Ga0265338_1000361721 231
254 3300028800 Ga0265338_10021501 Ga0265338_100215014 231
255 3300028800 Ga0265338_10024610 Ga0265338_100246106 231
256 3300028800 Ga0265338_10046291 Ga0265338_100462913 231
257 3300031240 Ga0265320_10000082 Ga0265320_1000008229 231
258 3300031240 Ga0265320_10095038 Ga0265320_100950381 231
259 3300031242 Ga0265329_10022472 Ga0265329_100224722 231
260 3300031249 Ga0265339_10038091 Ga0265339_100380912 231
261 3300031344 Ga0265316_10005026 Ga0265316_100050269 231
262 3300031344 Ga0265316_10031652 Ga0265316_100316524 231
263 3300031711 Ga0265314_10077408 Ga0265314_100774082 231
264 3300031711 Ga0265314_10214317 Ga0265314_102143172 231
265 3300050507 nmdc:mga05p37_343290_c2 nmdc:mga05p37_343290_c2_58_774 231
266 3300050512 nmdc:mga0n895_385720_c1 nmdc:mga0n895_385720_c1_21_749 231
267 3300053098 Ga0500650_0196825 Ga0500650_0196825_171_881 231
268 3300005577 Ga0068857_100077985 Ga0068857_1000779853 232
269 3300005615 Ga0070702_100085810 Ga0070702_1000858101 232
270 3300005615 Ga0070702_100615340 Ga0070702_1006153401 232
271 3300005841 Ga0068863_100580677 Ga0068863_1005806772 232
272 3300006028 Ga0070717_10238953 Ga0070717_102389532 232
273 3300006358 Ga0068871_100029330 Ga0068871_1000293303 232
274 3300009093 Ga0105240_10001811 Ga0105240_100018114 232
275 3300009177 Ga0105248_10558045 Ga0105248_105580451 232
276 3300009551 Ga0105238_10165847 Ga0105238_101658473 232
277 3300013296 Ga0157374_10425857 Ga0157374_104258572 232
278 3300013297 Ga0157378_10192344 Ga0157378_101923442 232
279 3300013308 Ga0157375_10002976 Ga0157375_100029764 232
280 3300025913 Ga0207695_10091621 Ga0207695_100916211 232
281 3300025924 Ga0207694_10105949 Ga0207694_101059491 232
282 3300025936 Ga0207670_10441140 Ga0207670_104411402 232
283 3300026088 Ga0207641_10539911 Ga0207641_105399111 232
284 3300026116 Ga0207674_10095160 Ga0207674_100951603 232
285 3300028563 Ga0265319_1078740 Ga0265319_10787402 232
286 3300028800 Ga0265338_10003009 Ga0265338_1000300920 232
287 3300035111 Ga0373923_0049809 Ga0373923_0049809_320_1075 232
288 3300035119 Ga0373956_0010677 Ga0373956_0010677_2089_2844 232
289 3300035410 Ga0373924_0144238 Ga0373924_0144238_188_931 232
290 3300036401 Ga0373937_0105740 Ga0373937_0105740_324_1079 232
291 3300044712 Ga0453684_0006095 Ga0453684_0006095_13535_14347 232
292 3300045051 Ga0451576_0082489 Ga0451576_0082489_803_1525 232
293 3300045051 Ga0451576_0213626 Ga0451576_0213626_806_1525 232
294 3300046459 Ga0495629_0414287 Ga0495629_0414287_80_835 232
295 3300046463 Ga0495653_0324023 Ga0495653_0324023_220_960 232
296 3300046529 Ga0495652_0413594 Ga0495652_0413594_91_831 232
297 3300046543 Ga0495645_0093849 Ga0495645_0093849_1001_1738 232
298 3300046543 Ga0495645_0162142 Ga0495645_0162142_120_860 232
299 3300046678 Ga0495599_0268481 Ga0495599_0268481_103_843 232
300 3300047471 Ga0495684_0142259 Ga0495684_0142259_1001_1741 232
301 3300050512 nmdc:mga0n895_285006_c1 nmdc:mga0n895_285006_c1_512_1234 232
302 3300028653 Ga0265323_10000301 Ga0265323_100003017 233
303 3300028653 Ga0265323_10008121 Ga0265323_100081214 233
304 3300028653 Ga0265323_10040519 Ga0265323_100405192 233
305 3300028653 Ga0265323_10080269 Ga0265323_100802692 233
306 3300028654 Ga0265322_10002003 Ga0265322_100020035 233
307 3300028800 Ga0265338_10014918 Ga0265338_100149185 233
308 3300028800 Ga0265338_10029776 Ga0265338_100297765 233
309 3300031242 Ga0265329_10060156 Ga0265329_100601562 233
310 3300031344 Ga0265316_10001012 Ga0265316_1000101230 233
311 3300031344 Ga0265316_10023822 Ga0265316_100238225 233
312 3300005328 Ga0070676_10089989 Ga0070676_100899892 234
313 3300005331 Ga0070670_100088215 Ga0070670_1000882152 234
314 3300005335 Ga0070666_10017249 Ga0070666_100172496 234
315 3300005340 Ga0070689_100046888 Ga0070689_1000468882 234
316 3300005347 Ga0070668_100063101 Ga0070668_1000631012 234
317 3300005354 Ga0070675_100087575 Ga0070675_1000875752 234
318 3300005354 Ga0070675_100545163 Ga0070675_1005451631 234
319 3300005355 Ga0070671_100088624 Ga0070671_1000886242 234
320 3300005364 Ga0070673_100591374 Ga0070673_1005913742 234
321 3300005367 Ga0070667_100003114 Ga0070667_10000311412 234
322 3300005548 Ga0070665_100014164 Ga0070665_1000141643 234
323 3300006358 Ga0068871_100597928 Ga0068871_1005979282 234
324 3300006881 Ga0068865_100359581 Ga0068865_1003595812 234
325 3300009094 Ga0111539_10280010 Ga0111539_102800102 234
326 3300009147 Ga0114129_10211069 Ga0114129_102110693 234
327 3300013296 Ga0157374_10021765 Ga0157374_100217655 234
328 3300013297 Ga0157378_10190863 Ga0157378_101908632 234
329 3300013306 Ga0163162_10087378 Ga0163162_100873783 234
330 3300013308 Ga0157375_10043049 Ga0157375_100430497 234
331 3300014969 Ga0157376_10031153 Ga0157376_100311533 234
332 3300025315 Ga0207697_10010777 Ga0207697_100107772 234
333 3300025901 Ga0207688_10031020 Ga0207688_100310203 234
334 3300025903 Ga0207680_10021201 Ga0207680_100212012 234
335 3300025907 Ga0207645_10011655 Ga0207645_100116553 234
336 3300025925 Ga0207650_10334753 Ga0207650_103347531 234
337 3300025926 Ga0207659_10001807 Ga0207659_1000180710 234
338 3300025933 Ga0207706_10358439 Ga0207706_103584392 234
339 3300025936 Ga0207670_10319421 Ga0207670_103194212 234
340 3300025937 Ga0207669_10039253 Ga0207669_100392532 234
341 3300025938 Ga0207704_10282902 Ga0207704_102829022 234
342 3300025940 Ga0207691_10049664 Ga0207691_100496642 234
343 3300025945 Ga0207679_10749313 Ga0207679_107493132 234
344 3300025960 Ga0207651_10168764 Ga0207651_101687641 234
345 3300025972 Ga0207668_10213300 Ga0207668_102133002 234
346 3300025986 Ga0207658_10271989 Ga0207658_102719892 234
347 3300026121 Ga0207683_10020632 Ga0207683_100206323 234
348 3300028379 Ga0268266_10069091 Ga0268266_100690914 234
349 3300046683 Ga0495658_0213493 Ga0495658_0213493_110_814 234
350 3300046684 Ga0495669_0041877 Ga0495669_0041877_84_788 234
351 3300048917 Ga0496114_0137807 Ga0496114_0137807_315_1019 234
352 3300049576 Ga0501040_0280950 Ga0501040_0280950_108_896 237
353 3300049587 Ga0501071_0248724 Ga0501071_0248724_485_1276 237
354 3300049592 Ga0501076_0426820 Ga0501076_0426820_242_1030 237
355 3300049743 Ga0501081_0174858 Ga0501081_0174858_210_998 237
356 3300005327 Ga0070658_10051170 Ga0070658_100511703 240
357 3300025909 Ga0207705_10107029 Ga0207705_101070291 240
358 3300005339 Ga0070660_100091807 Ga0070660_1000918073 243
359 3300025909 Ga0207705_10239918 Ga0207705_102399182 243
360 3300045051 Ga0451576_0029461 Ga0451576_0029461_4284_5021 243
361 3300005327 Ga0070658_10025558 Ga0070658_100255584 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00035

dsrm

Double-stranded RNA binding motif

178

244

0.98

PF00636

Ribonuclease_3

Ribonuclease III domain

60

150

0.96

PF14622

Ribonucleas_3_3

Ribonuclease-III-like

35

165

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9801 4 140
2a11-assembly1.cif.gz_A-2 crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis 0.9498 5 143
3n3w-assembly1.cif.gz_B 2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9176 1 153
1rc5-assembly2.cif.gz_C crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution 0.9123 2 151
1i4s-assembly1.cif.gz_A crystal structure of rnase iii endonuclease domain from aquifex aeolicus at 2.15 angstrom resolution 0.9102 1 148
ID Description Score Start End Superfamily
af_P0A7Y0_4_147_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9843 4 147 1.10.1520.10
af_Q2FZ50_16_166_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9597 2 147 1.10.1520.10
af_P22192_129_284_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9553 11 147 1.10.1520.10
2a11A00 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9498 5 143 1.10.1520.10
af_Q2FZ50_172_239_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9414 157 222 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A356E6B3-F1-model_v4 Ribonuclease III 0.9883 2 124 GO:0004525
GO:0006396
AF-A0A6L6EC33-F1-model_v4 deleted 0.9841 18 135
AF-W7WWP8-F1-model_v4 deleted 0.9758 4 142
AF-A0A3D2DL54-F1-model_v4 Ribonuclease III (EC 3.1.26.3) 0.9758 2 133 GO:0003725
GO:0004525
GO:0006364
GO:0006397
GO:0010468
AF-A0A832AU94-F1-model_v4 DRBM domain-containing protein 0.972 156 221 GO:0003725
GO:0005737
GO:0016442
GO:0030422
GO:0035197
GO:0070578
GO:0070920

Feature Viewer

pLDDT pTM Quality
87.5 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map