F422165

General Info

Members Datasets Scaffolds Average Seq Length
361 218 361 239

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10080324|Ga0075365_100803242
Length 249
Sequence MADRAELRLLTLYPEQMNIYADRGNVLFLQRRCEWRGLGFRAASAGMGEAFDPGDHDLIYIGGGQDRDQLMVAGDMVATKRDAIAAAVDDGAAVLAVCGGYQLLGSSYQLGDERIQGLGLADLETIREEGERLIGNVSIEVDLGAGPRVLAGFENHGGRTTLGPAATPLGRVLHGHGNNGRDGLEGVTRDNLIGTYLHGPLLPKNAWLADELIARAIERRTGARPELAPLADELEERAHADALRAAERG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 15.24
Rhizosphere 76.18
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003010 3300005329 Bacteria 13531
2 Ga0070683_100022449 3300005329 Bacteria 5641
3 Ga0070683_100081805 3300005329 Bacteria 3024
4 Ga0070683_100143832 3300005329 Bacteria 2259
5 Ga0070683_100150355 3300005329 Bacteria 2207
6 Ga0070677_10000008 3300005333 Bacteria 74027
7 Ga0070682_100000090 3300005337 Bacteria 82642
8 Ga0070682_100017907 3300005337 Bacteria 4133
9 Ga0068868_100059799 3300005338 Bacteria 3015
10 Ga0068868_100094724 3300005338 Bacteria 2409
11 Ga0068868_100106486 3300005338 Bacteria 2274
12 Ga0070660_100003444 3300005339 Bacteria 10888
13 Ga0070689_100125596 3300005340 Bacteria 2053
14 Ga0070687_100381162 3300005343 Bacteria 919
15 Ga0070661_100000099 3300005344 Bacteria 71115
16 Ga0070692_10006910 3300005345 Bacteria 4962
17 Ga0070668_100008836 3300005347 Bacteria 7482
18 Ga0070668_100407563 3300005347 Bacteria 1162
19 Ga0070674_100000005 3300005356 Bacteria 168443
20 Ga0070673_100017914 3300005364 Bacteria 5048
21 Ga0070688_100000137 3300005365 Bacteria 39585
22 Ga0070688_100060397 3300005365 Bacteria 2394
23 Ga0070688_100236728 3300005365 Bacteria 1294
24 Ga0070659_100000300 3300005366 Bacteria 38760
25 Ga0070659_100286309 3300005366 Bacteria 1371
26 Ga0070667_100026459 3300005367 Bacteria 4826
27 Ga0070711_100025241 3300005439 Bacteria 3886
28 Ga0070700_100051340 3300005441 Bacteria 2567
29 Ga0070663_100002435 3300005455 Bacteria 10475
30 Ga0070663_100082852 3300005455 Bacteria 2361
31 Ga0070678_100038011 3300005456 Bacteria 3385
32 Ga0070678_100247414 3300005456 Bacteria 1494
33 Ga0068867_100032704 3300005459 Bacteria 3763
34 Ga0068867_100208317 3300005459 Bacteria 1569
35 Ga0070685_10000118 3300005466 Bacteria 50597
36 Ga0070685_10000314 3300005466 Bacteria 30259
37 Ga0070685_10162130 3300005466 Bacteria 1426
38 Ga0070685_10182224 3300005466 Bacteria 1353
39 Ga0070679_100000818 3300005530 Bacteria 26995
40 Ga0070684_100017832 3300005535 Bacteria 5835
41 Ga0070684_100060109 3300005535 Bacteria 3323
42 Ga0070684_100198288 3300005535 Bacteria 1828
43 Ga0068853_100036258 3300005539 Bacteria 4192
44 Ga0068853_100078845 3300005539 Bacteria 2879
45 Ga0070686_100002755 3300005544 Bacteria 9675
46 Ga0070686_100034338 3300005544 Bacteria 3125
47 Ga0070695_100220176 3300005545 Bacteria 1367
48 Ga0070665_100023501 3300005548 Bacteria 6206
49 Ga0070704_100417944 3300005549 Bacteria 1148
50 Ga0070664_100025036 3300005564 Bacteria 4945
51 Ga0068857_100060025 3300005577 Bacteria 3379
52 Ga0068857_100302777 3300005577 Bacteria 1474
53 Ga0068854_100035830 3300005578 Bacteria 3475
54 Ga0068856_100582059 3300005614 Bacteria 1141
55 Ga0070702_100038047 3300005615 Bacteria 2676
56 Ga0068852_100010822 3300005616 Bacteria 6834
57 Ga0068859_100113893 3300005617 Bacteria 2768
58 Ga0068864_100825872 3300005618 Bacteria 912
59 Ga0068863_100000022 3300005841 Bacteria 188278
60 Ga0068863_100674768 3300005841 Bacteria 1026
61 Ga0068858_100000097 3300005842 Bacteria 91503
62 Ga0068860_100010110 3300005843 Bacteria 9348
63 Ga0068860_100164835 3300005843 Bacteria 2139
64 Ga0068860_100217641 3300005843 Bacteria 1854
65 Ga0068860_100469354 3300005843 Bacteria 1253
66 Ga0068862_100004419 3300005844 Bacteria 11866
67 Ga0068862_100023558 3300005844 Bacteria 5159
68 Ga0081455_10008594 3300005937 Bacteria 10596
69 Ga0081455_10031732 3300005937 Bacteria 4773
70 Ga0081455_10037338 3300005937 Bacteria 4316
71 Ga0081455_10460147 3300005937 Bacteria 866
72 Ga0081538_10000141 3300005981 Bacteria 74085
73 Ga0075365_10046560 3300006038 Bacteria 2849
74 Ga0075365_10080324 3300006038 Bacteria 2208
75 Ga0075363_100010930 3300006048 Bacteria 4331
76 Ga0075364_10026917 3300006051 Bacteria 3671
77 Ga0075364_10247717 3300006051 Bacteria 1211
78 Ga0070715_10000021 3300006163 Bacteria 119283
79 Ga0070712_100025296 3300006175 Bacteria 3945
80 Ga0075430_100002638 3300006846 Bacteria 14972
81 Ga0075433_10001579 3300006852 Bacteria 16871
82 Ga0075433_10359063 3300006852 Bacteria 1287
83 Ga0068865_100043371 3300006881 Bacteria 3073
84 Ga0097620_100113886 3300006931 Bacteria 2768
85 Ga0075435_100196549 3300007076 Bacteria 1708
86 Ga0105245_10000130 3300009098 Bacteria 72166
87 Ga0105245_10024267 3300009098 Bacteria 5325
88 Ga0105245_10094172 3300009098 Bacteria 2761
89 Ga0105247_10000305 3300009101 Bacteria 44071
90 Ga0105247_10100792 3300009101 Bacteria 1846
91 Ga0105243_10006671 3300009148 Bacteria 8911
92 Ga0105243_10028632 3300009148 Bacteria 4278
93 Ga0105243_10947895 3300009148 Bacteria 859
94 Ga0105242_10000810 3300009176 Bacteria 24262
95 Ga0105242_10058928 3300009176 Bacteria 3150
96 Ga0105242_10134120 3300009176 Bacteria 2141
97 Ga0105248_10561961 3300009177 Bacteria 1287
98 Ga0105248_10580401 3300009177 Bacteria 1265
99 Ga0105238_10000055 3300009551 Bacteria 139232
100 Ga0105238_10229526 3300009551 Bacteria 1833
101 Ga0105249_10041130 3300009553 Bacteria 4201
102 Ga0105249_10569030 3300009553 Bacteria 1185
103 Ga0105239_10191734 3300010375 Bacteria 2288
104 Ga0157369_10000074 3300013105 Bacteria 136668
105 Ga0157378_10005546 3300013297 Bacteria 11048
106 Ga0157372_10000204 3300013307 Bacteria 65798
107 Ga0157375_10000127 3300013308 Bacteria 75142
108 Ga0157375_10117437 3300013308 Bacteria 2765
109 Ga0163163_10042918 3300014325 Bacteria 4431
110 Ga0157380_10051352 3300014326 Bacteria 3261
111 Ga0157377_10361278 3300014745 Bacteria 977
112 Ga0157379_10044087 3300014968 Bacteria 3982
113 Ga0157376_10112247 3300014969 Bacteria 2401
114 Ga0207656_10076456 3300025321 Bacteria 1498
115 Ga0207682_10000022 3300025893 Bacteria 62630
116 Ga0207710_10000157 3300025900 Bacteria 72764
117 Ga0207688_10001361 3300025901 Bacteria 12701
118 Ga0207680_10056593 3300025903 Bacteria 2369
119 Ga0207685_10000028 3300025905 Bacteria 97935
120 Ga0207705_10033575 3300025909 Bacteria 3667
121 Ga0207707_10073667 3300025912 Bacteria 2978
122 Ga0207693_10193855 3300025915 Bacteria 1599
123 Ga0207693_10274180 3300025915 Bacteria 1322
124 Ga0207663_10037879 3300025916 Bacteria 2910
125 Ga0207660_10034972 3300025917 Bacteria 3486
126 Ga0207662_10045924 3300025918 Bacteria 2583
127 Ga0207657_10001441 3300025919 Bacteria 25443
128 Ga0207649_10000127 3300025920 Bacteria 64603
129 Ga0207652_10000827 3300025921 Bacteria 29489
130 Ga0207652_10235143 3300025921 Bacteria 1651
131 Ga0207681_10074388 3300025923 Bacteria 2380
132 Ga0207694_10000063 3300025924 Bacteria 139700
133 Ga0207694_10306744 3300025924 Bacteria 1308
134 Ga0207659_10170383 3300025926 Bacteria 1717
135 Ga0207687_10000032 3300025927 Bacteria 143196
136 Ga0207644_10342492 3300025931 Bacteria 1213
137 Ga0207690_10003216 3300025932 Bacteria 9802
138 Ga0207686_10002554 3300025934 Bacteria 9893
139 Ga0207686_10072457 3300025934 Bacteria 2220
140 Ga0207709_10005203 3300025935 Bacteria 7407
141 Ga0207670_10047583 3300025936 Bacteria 2858
142 Ga0207670_10107532 3300025936 Bacteria 2003
143 Ga0207704_10018356 3300025938 Bacteria 3649
144 Ga0207691_10017653 3300025940 Bacteria 6763
145 Ga0207711_10387843 3300025941 Bacteria 1297
146 Ga0207661_10000988 3300025944 Bacteria 18799
147 Ga0207661_10013232 3300025944 Bacteria 6024
148 Ga0207679_10023480 3300025945 Bacteria 4218
149 Ga0207679_10107495 3300025945 Bacteria 2195
150 Ga0207667_10192579 3300025949 Bacteria 2092
151 Ga0207651_10047879 3300025960 Bacteria 2886
152 Ga0207712_10266525 3300025961 Bacteria 1391
153 Ga0207712_10377582 3300025961 Bacteria 1185
154 Ga0207668_10004644 3300025972 Bacteria 8076
155 Ga0207668_10802290 3300025972 Bacteria 833
156 Ga0207640_10141266 3300025981 Bacteria 1755
157 Ga0207658_10000785 3300025986 Bacteria 27036
158 Ga0207658_10011617 3300025986 Bacteria 5995
159 Ga0207658_10115216 3300025986 Bacteria 2133
160 Ga0207658_10676200 3300025986 Bacteria 932
161 Ga0207677_10015026 3300026023 Bacteria 4539
162 Ga0207703_10000103 3300026035 Bacteria 99918
163 Ga0207639_10061970 3300026041 Bacteria 2891
164 Ga0207678_10003982 3300026067 Bacteria 13290
165 Ga0207678_10721149 3300026067 Bacteria 878
166 Ga0207708_10000292 3300026075 Bacteria 39342
167 Ga0207708_10051779 3300026075 Bacteria 3126
168 Ga0207702_10014543 3300026078 Bacteria 6530
169 Ga0207641_10000016 3300026088 Bacteria 307363
170 Ga0207641_10573956 3300026088 Bacteria 1102
171 Ga0207648_10000960 3300026089 Bacteria 32619
172 Ga0207648_10015648 3300026089 Bacteria 6966
173 Ga0207648_10119192 3300026089 Bacteria 2319
174 Ga0207676_10123355 3300026095 Bacteria 2189
175 Ga0207674_10439778 3300026116 Bacteria 1260
176 Ga0207683_10026249 3300026121 Bacteria 5028
177 Ga0268266_10003660 3300028379 Bacteria 15184
178 Ga0268266_10049980 3300028379 Bacteria 3586
179 Ga0268266_10127006 3300028379 Bacteria 2277
180 Ga0268265_10008776 3300028380 Bacteria 6829
181 Ga0268265_10031714 3300028380 Bacteria 3819
182 Ga0268264_10019061 3300028381 Bacteria 5609
183 Ga0268264_10031725 3300028381 Bacteria 4332
184 Ga0268264_10972894 3300028381 Bacteria 854
185 Ga0265338_10202118 3300028800 Bacteria 1498
186 Ga0265338_10392180 3300028800 Bacteria 991
187 Ga0316579_10125412 3300031691 Bacteria 1235
188 Ga0307409_100585208 3300031995 Bacteria 1101
189 Ga0307411_10369742 3300032005 Bacteria 1176
190 Ga0373956_0206860 3300035119 Bacteria 931
191 Ga0373937_0162769 3300036401 Bacteria 2092
192 Ga0373925_0251025 3300037068 Bacteria 1419
193 Ga0395899_0229680 3300037312 Bacteria 1282
194 Ga0395900_0004975 3300037418 Bacteria 13973
195 Ga0395898_0002794 3300037466 Bacteria 20029
196 Ga0395898_0214441 3300037466 Bacteria 1836
197 Ga0395905_0015790 3300037471 Bacteria 7173
198 Ga0395901_0004551 3300038443 Bacteria 13994
199 Ga0451835_0819293 3300041492 Bacteria 774
200 Ga0451853_1872887 3300041512 Bacteria 2147
201 Ga0466963_0052051 3300044694 Bacteria 2716
202 Ga0466963_0090051 3300044694 Bacteria 2088
203 Ga0466964_0055275 3300044706 Bacteria 1639
204 Ga0466967_0000001 3300045976 Bacteria 229823
205 Ga0466967_0278694 3300045976 Bacteria 1604
206 Ga0466967_0611459 3300045976 Bacteria 1076
207 Ga0495603_0003660 3300046455 Bacteria 9145
208 Ga0495603_0004912 3300046455 Bacteria 7998
209 Ga0495603_0173128 3300046455 Bacteria 1250
210 Ga0495629_0003930 3300046459 Bacteria 11175
211 Ga0495629_0262266 3300046459 Bacteria 1188
212 Ga0495638_0117654 3300046460 Bacteria 1573
213 Ga0495641_0000312 3300046461 Bacteria 39169
214 Ga0495651_0106001 3300046462 Bacteria 2084
215 Ga0495651_0254739 3300046462 Bacteria 1197
216 Ga0495653_0162478 3300046463 Bacteria 1549
217 Ga0495582_0035005 3300046473 Bacteria 2761
218 Ga0495639_0071480 3300046475 Bacteria 1603
219 Ga0495594_0000030 3300046499 Bacteria 66443
220 Ga0495620_0082375 3300046515 Bacteria 1300
221 Ga0495628_0186510 3300046516 Bacteria 1567
222 Ga0495630_0045843 3300046517 Bacteria 3267
223 Ga0495586_0001547 3300046535 Bacteria 12691
224 Ga0495598_0005081 3300046537 Bacteria 2894
225 Ga0495645_0037555 3300046543 Bacteria 3531
226 Ga0495622_0000080 3300046557 Bacteria 85557
227 Ga0495667_0000020 3300046559 Bacteria 180876
228 Ga0495667_0028562 3300046559 Bacteria 3757
229 Ga0495634_0000031 3300046642 Bacteria 110396
230 Ga0495634_0036961 3300046642 Bacteria 3338
231 Ga0495625_0000409 3300046660 Bacteria 65188
232 Ga0495635_0045313 3300046663 Bacteria 3035
233 Ga0495599_0015917 3300046678 Bacteria 4668
234 Ga0495599_0380910 3300046678 Bacteria 842
235 Ga0495647_0000001 3300046681 Bacteria 222371
236 Ga0495658_0234644 3300046683 Bacteria 1151
237 Ga0495669_0000779 3300046684 Bacteria 13635
238 Ga0495669_0127415 3300046684 Bacteria 1197
239 Ga0495613_0146632 3300046689 Bacteria 1684
240 Ga0495649_0005501 3300046694 Bacteria 8035
241 Ga0495676_0000131 3300047321 Bacteria 56689
242 Ga0495676_0000805 3300047321 Bacteria 26189
243 Ga0495676_0033363 3300047321 Bacteria 4337
244 Ga0495680_0000241 3300047322 Bacteria 60168
245 Ga0495680_0037792 3300047322 Bacteria 3866
246 Ga0495680_0180246 3300047322 Bacteria 1525
247 Ga0495602_0093420 3300048088 Bacteria 2489
248 Ga0496100_0000001 3300048903 Bacteria 530179
249 Ga0496100_0000013 3300048903 Bacteria 177476
250 Ga0496100_0059988 3300048903 Bacteria 2502
251 Ga0496101_0000004 3300048904 Bacteria 331599
252 Ga0496101_0000035 3300048904 Bacteria 177237
253 Ga0496101_0040405 3300048904 Bacteria 3322
254 Ga0496101_0377072 3300048904 Bacteria 1116
255 Ga0496102_0004663 3300048905 Bacteria 11599
256 Ga0496104_0000015 3300048907 Bacteria 374530
257 Ga0496104_0000052 3300048907 Bacteria 137286
258 Ga0496104_0000387 3300048907 Bacteria 38531
259 Ga0496104_0013795 3300048907 Bacteria 7289
260 Ga0496104_0037865 3300048907 Bacteria 4510
261 Ga0496105_0000004 3300048908 Bacteria 475798
262 Ga0496105_0000030 3300048908 Bacteria 137325
263 Ga0496105_0001994 3300048908 Bacteria 14717
264 Ga0496105_0009852 3300048908 Bacteria 7490
265 Ga0496105_0012994 3300048908 Bacteria 6597
266 Ga0496105_0034227 3300048908 Bacteria 4177
267 Ga0496106_0000062 3300048909 Bacteria 85769
268 Ga0496106_0000076 3300048909 Bacteria 79088
269 Ga0496106_0024138 3300048909 Bacteria 4519
270 Ga0496106_0273647 3300048909 Bacteria 1352
271 Ga0496107_0000005 3300048910 Bacteria 281747
272 Ga0496107_0000020 3300048910 Bacteria 148990
273 Ga0496107_0014221 3300048910 Bacteria 5572
274 Ga0496107_0029690 3300048910 Bacteria 3892
275 Ga0496107_0111470 3300048910 Bacteria 2011
276 Ga0496107_0300604 3300048910 Bacteria 1194
277 Ga0496108_0001157 3300048911 Bacteria 20581
278 Ga0496108_0005281 3300048911 Bacteria 10426
279 Ga0496108_0022018 3300048911 Bacteria 5240
280 Ga0496108_0022257 3300048911 Bacteria 5212
281 Ga0496108_0162364 3300048911 Bacteria 1931
282 Ga0496109_0000009 3300048912 Bacteria 236561
283 Ga0496109_0000218 3300048912 Bacteria 56316
284 Ga0496109_0000261 3300048912 Bacteria 50812
285 Ga0496109_0066988 3300048912 Bacteria 3288
286 Ga0496109_0284893 3300048912 Bacteria 1557
287 Ga0496110_0019085 3300048913 Bacteria 5764
288 Ga0496110_0089809 3300048913 Bacteria 2746
289 Ga0496110_0290391 3300048913 Bacteria 1489
290 Ga0496111_0003990 3300048914 Bacteria 9260
291 Ga0496111_0045165 3300048914 Bacteria 3169
292 Ga0496111_0063636 3300048914 Bacteria 2675
293 Ga0496112_0783852 3300048915 Bacteria 878
294 Ga0496113_0058201 3300048916 Bacteria 2907
295 Ga0496113_0080001 3300048916 Bacteria 2502
296 Ga0496113_0094715 3300048916 Bacteria 2307
297 Ga0496113_0127694 3300048916 Bacteria 1992
298 Ga0496114_0000039 3300048917 Bacteria 138486
299 Ga0496114_0005484 3300048917 Bacteria 9929
300 Ga0496114_0007985 3300048917 Bacteria 8374
301 Ga0496115_0000011 3300048918 Bacteria 222529
302 Ga0496115_0000596 3300048918 Bacteria 27656
303 Ga0496116_0000176 3300048919 Bacteria 128426
304 Ga0496117_0002925 3300048920 Bacteria 20664
305 Ga0496118_0004080 3300048921 Bacteria 17711
306 Ga0496118_0038763 3300048921 Bacteria 3814
307 Ga0496119_0002021 3300048922 Bacteria 22972
308 Ga0496119_0012335 3300048922 Bacteria 6952
309 Ga0496119_0018115 3300048922 Bacteria 5259
310 Ga0496119_0080309 3300048922 Bacteria 1881
311 Ga0496120_0051656 3300048923 Bacteria 2346
312 Ga0496121_0008779 3300048924 Bacteria 11787
313 Ga0496121_0028248 3300048924 Bacteria 5227
314 Ga0496121_0061194 3300048924 Bacteria 3091
315 Ga0496124_0125119 3300048927 Bacteria 2049
316 Ga0496125_0050491 3300048928 Bacteria 3443
317 Ga0496125_0181123 3300048928 Bacteria 1403
318 Ga0496126_0221762 3300048929 Bacteria 1588
319 Ga0496126_0576000 3300048929 Bacteria 890
320 Ga0501034_0041603 3300049571 Bacteria 4650
321 Ga0501034_0076223 3300049571 Bacteria 3360
322 Ga0501042_0006285 3300049578 Bacteria 7710
323 Ga0501042_0312973 3300049578 Bacteria 1134
324 Ga0501043_0099912 3300049579 Bacteria 2281
325 Ga0501047_0070916 3300049581 Bacteria 3354
326 Ga0501068_0059027 3300049584 Bacteria 2329
327 Ga0501069_0017780 3300049585 Bacteria 3832
328 Ga0501069_0052937 3300049585 Bacteria 2261
329 Ga0501070_0048028 3300049586 Bacteria 3546
330 Ga0501070_0093566 3300049586 Bacteria 2486
331 Ga0501070_0111784 3300049586 Bacteria 2258
332 Ga0501070_0166062 3300049586 Bacteria 1819
333 Ga0501071_0064937 3300049587 Bacteria 2649
334 Ga0501072_0026243 3300049588 Bacteria 4542
335 Ga0501073_0069283 3300049589 Bacteria 2458
336 Ga0501074_0014538 3300049590 Bacteria 5727
337 Ga0501074_0083748 3300049590 Bacteria 2286
338 Ga0501076_0374410 3300049592 Bacteria 1170
339 Ga0501081_0111274 3300049743 Bacteria 1943
340 Ga0501083_0114327 3300049744 Bacteria 1772
341 Ga0501044_0008570 3300049823 Bacteria 11202
342 Ga0501044_0093108 3300049823 Bacteria 3039
343 Ga0501044_0262282 3300049823 Bacteria 1666
344 nmdc:mga03n38_107441_c1 3300050490 Bacteria 1354
345 nmdc:mga00v17_47042_c1 3300050491 Bacteria 2612
346 nmdc:mga0yw44_187068_c1 3300050492 Bacteria 1365
347 nmdc:mga06z11_154489_c1 3300050494 Bacteria 1307
348 nmdc:mga0qj67_2285_c1 3300050509 Bacteria 13613
349 nmdc:mga06r32_97063_c1 3300050510 Bacteria 2887
350 nmdc:mga0n895_1044427_c1 3300050512 Bacteria 796
351 nmdc:mga08x19_377888_c1 3300050514 Bacteria 992
352 nmdc:mga0a205_113_c1 3300050515 Bacteria 30301
353 Ga0495601_0000720 3300053077 Bacteria 17767
354 Ga0495601_0088080 3300053077 Bacteria 1996
355 Ga0495619_0000010 3300053085 Bacteria 302390
356 Ga0495619_0000084 3300053085 Bacteria 70164
357 Ga0495619_0005486 3300053085 Bacteria 8043
358 Ga0500566_0025285 3300053094 Bacteria 3481
359 Ga0500595_077012 3300053119 Bacteria 981
360 Ga0500614_000430 3300053123 Bacteria 10933
361 Ga0501084_0284915 3300054114 Bacteria 1395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_0180246 Ga0495680_0180246_867_1481 201
2 3300005347 Ga0070668_100407563 Ga0070668_1004075631 206
3 3300025972 Ga0207668_10802290 Ga0207668_108022901 206
4 3300037068 Ga0373925_0251025 Ga0373925_0251025_594_1331 206
5 3300046455 Ga0495603_0173128 Ga0495603_0173128_205_942 206
6 3300046473 Ga0495582_0035005 Ga0495582_0035005_1958_2695 206
7 3300047321 Ga0495676_0033363 Ga0495676_0033363_1347_2084 208
8 3300049592 Ga0501076_0374410 Ga0501076_0374410_74_814 208
9 3300006048 Ga0075363_100010930 Ga0075363_1000109302 210
10 3300005338 Ga0068868_100094724 Ga0068868_1000947243 213
11 3300026023 Ga0207677_10015026 Ga0207677_100150262 213
12 3300005544 Ga0070686_100002755 Ga0070686_1000027554 214
13 3300028381 Ga0268264_10972894 Ga0268264_109728941 218
14 3300005439 Ga0070711_100025241 Ga0070711_1000252414 219
15 3300005456 Ga0070678_100038011 Ga0070678_1000380112 219
16 3300005466 Ga0070685_10162130 Ga0070685_101621303 219
17 3300005545 Ga0070695_100220176 Ga0070695_1002201763 219
18 3300005843 Ga0068860_100469354 Ga0068860_1004693542 219
19 3300009098 Ga0105245_10024267 Ga0105245_100242676 219
20 3300009101 Ga0105247_10100792 Ga0105247_101007923 219
21 3300009176 Ga0105242_10134120 Ga0105242_101341203 219
22 3300009177 Ga0105248_10580401 Ga0105248_105804012 219
23 3300013308 Ga0157375_10117437 Ga0157375_101174372 219
24 3300025915 Ga0207693_10193855 Ga0207693_101938551 219
25 3300025916 Ga0207663_10037879 Ga0207663_100378793 219
26 3300025931 Ga0207644_10342492 Ga0207644_103424922 219
27 3300026121 Ga0207683_10026249 Ga0207683_100262493 219
28 3300037418 Ga0395900_0004975 Ga0395900_0004975_6575_7312 219
29 3300037466 Ga0395898_0002794 Ga0395898_0002794_5197_5934 219
30 3300037471 Ga0395905_0015790 Ga0395905_0015790_23_760 219
31 3300038443 Ga0395901_0004551 Ga0395901_0004551_5362_6099 219
32 3300048903 Ga0496100_0059988 Ga0496100_0059988_1064_1801 219
33 3300048904 Ga0496101_0040405 Ga0496101_0040405_2285_3022 219
34 3300048905 Ga0496102_0004663 Ga0496102_0004663_250_987 219
35 3300048907 Ga0496104_0013795 Ga0496104_0013795_4917_5654 219
36 3300048908 Ga0496105_0009852 Ga0496105_0009852_1282_2019 219
37 3300048909 Ga0496106_0024138 Ga0496106_0024138_3484_4221 219
38 3300048910 Ga0496107_0014221 Ga0496107_0014221_368_1105 219
39 3300048911 Ga0496108_0162364 Ga0496108_0162364_450_1187 219
40 3300048912 Ga0496109_0066988 Ga0496109_0066988_720_1457 219
41 3300048913 Ga0496110_0089809 Ga0496110_0089809_1281_2018 219
42 3300048914 Ga0496111_0003990 Ga0496111_0003990_4049_4786 219
43 3300048916 Ga0496113_0058201 Ga0496113_0058201_1759_2496 219
44 3300048917 Ga0496114_0005484 Ga0496114_0005484_3887_4624 219
45 3300048918 Ga0496115_0000596 Ga0496115_0000596_21000_21737 219
46 3300005459 Ga0068867_100208317 Ga0068867_1002083172 220
47 3300006175 Ga0070712_100025296 Ga0070712_1000252965 220
48 3300048915 Ga0496112_0783852 Ga0496112_0783852_64_801 220
49 3300006846 Ga0075430_100002638 Ga0075430_10000263818 221
50 3300050509 nmdc:mga0qj67_2285_c1 nmdc:mga0qj67_2285_c1_378_1118 221
51 3300005365 Ga0070688_100000137 Ga0070688_10000013717 222
52 3300005466 Ga0070685_10000118 Ga0070685_1000011817 222
53 3300013105 Ga0157369_10000074 Ga0157369_1000007488 222
54 3300006852 Ga0075433_10359063 Ga0075433_103590632 224
55 3300049571 Ga0501034_0041603 Ga0501034_0041603_1861_2595 224
56 3300049581 Ga0501047_0070916 Ga0501047_0070916_1467_2201 224
57 3300049823 Ga0501044_0093108 Ga0501044_0093108_2022_2756 224
58 3300037312 Ga0395899_0229680 Ga0395899_0229680_339_1076 225
59 3300037466 Ga0395898_0214441 Ga0395898_0214441_287_1024 225
60 3300009148 Ga0105243_10028632 Ga0105243_100286321 226
61 3300025986 Ga0207658_10676200 Ga0207658_106762001 226
62 3300049586 Ga0501070_0048028 Ga0501070_0048028_896_1642 226
63 3300005530 Ga0070679_100000818 Ga0070679_10000081821 229
64 3300005564 Ga0070664_100025036 Ga0070664_1000250365 229
65 3300025912 Ga0207707_10073667 Ga0207707_100736673 229
66 3300025921 Ga0207652_10000827 Ga0207652_100008276 229
67 3300025945 Ga0207679_10023480 Ga0207679_100234805 229
68 3300025949 Ga0207667_10192579 Ga0207667_101925793 229
69 3300049823 Ga0501044_0008570 Ga0501044_0008570_5191_5901 229
70 3300009176 Ga0105242_10000810 Ga0105242_1000081010 230
71 3300013307 Ga0157372_10000204 Ga0157372_1000020437 230
72 3300025934 Ga0207686_10002554 Ga0207686_1000255410 230
73 3300041492 Ga0451835_0819293 Ga0451835_0819293_12_755 231
74 3300046459 Ga0495629_0003930 Ga0495629_0003930_10298_11035 231
75 3300047321 Ga0495676_0000805 Ga0495676_0000805_23517_24254 231
76 3300048903 Ga0496100_0000001 Ga0496100_0000001_472614_473351 231
77 3300048904 Ga0496101_0000004 Ga0496101_0000004_273966_274703 231
78 3300048909 Ga0496106_0000076 Ga0496106_0000076_69804_70541 231
79 3300048910 Ga0496107_0000005 Ga0496107_0000005_56897_57634 231
80 3300048916 Ga0496113_0127694 Ga0496113_0127694_1105_1842 231
81 3300053094 Ga0500566_0025285 Ga0500566_0025285_54_791 231
82 3300005614 Ga0068856_100582059 Ga0068856_1005820592 232
83 3300009553 Ga0105249_10041130 Ga0105249_100411304 232
84 3300014968 Ga0157379_10044087 Ga0157379_100440874 232
85 3300026089 Ga0207648_10119192 Ga0207648_101191922 232
86 3300048916 Ga0496113_0080001 Ga0496113_0080001_1785_2489 232
87 3300050512 nmdc:mga0n895_1044427_c1 nmdc:mga0n895_1044427_c1_76_777 232
88 3300005344 Ga0070661_100000099 Ga0070661_10000009966 233
89 3300025920 Ga0207649_10000127 Ga0207649_100001275 233
90 3300049586 Ga0501070_0166062 Ga0501070_0166062_556_1296 233
91 3300046663 Ga0495635_0045313 Ga0495635_0045313_709_1449 234
92 3300050514 nmdc:mga08x19_377888_c1 nmdc:mga08x19_377888_c1_173_907 234
93 3300005937 Ga0081455_10008594 Ga0081455_100085943 235
94 3300028379 Ga0268266_10127006 Ga0268266_101270061 235
95 3300049584 Ga0501068_0059027 Ga0501068_0059027_963_1697 236
96 3300006051 Ga0075364_10247717 Ga0075364_102477172 237
97 3300005329 Ga0070683_100081805 Ga0070683_1000818054 238
98 3300005329 Ga0070683_100143832 Ga0070683_1001438323 238
99 3300005338 Ga0068868_100106486 Ga0068868_1001064862 238
100 3300005343 Ga0070687_100381162 Ga0070687_1003811621 238
101 3300005366 Ga0070659_100286309 Ga0070659_1002863091 238
102 3300025915 Ga0207693_10274180 Ga0207693_102741802 238
103 3300035119 Ga0373956_0206860 Ga0373956_0206860_159_887 238
104 3300036401 Ga0373937_0162769 Ga0373937_0162769_754_1482 238
105 3300045976 Ga0466967_0278694 Ga0466967_0278694_242_970 238
106 3300046462 Ga0495651_0254739 Ga0495651_0254739_206_934 238
107 3300048909 Ga0496106_0273647 Ga0496106_0273647_190_918 238
108 3300048910 Ga0496107_0300604 Ga0496107_0300604_227_955 238
109 3300005937 Ga0081455_10037338 Ga0081455_100373383 239
110 3300046516 Ga0495628_0186510 Ga0495628_0186510_610_1338 242
111 3300046543 Ga0495645_0037555 Ga0495645_0037555_2785_3513 242
112 3300046678 Ga0495599_0380910 Ga0495599_0380910_48_776 242
113 3300053077 Ga0495601_0088080 Ga0495601_0088080_240_968 242
114 3300005347 Ga0070668_100008836 Ga0070668_1000088363 243
115 3300009148 Ga0105243_10006671 Ga0105243_100066712 243
116 3300025935 Ga0207709_10005203 Ga0207709_100052038 243
117 3300025972 Ga0207668_10004644 Ga0207668_100046448 243
118 3300046642 Ga0495634_0036961 Ga0495634_0036961_162_893 243
119 3300046683 Ga0495658_0234644 Ga0495658_0234644_59_790 243
120 3300048903 Ga0496100_0000013 Ga0496100_0000013_116758_117489 243
121 3300048904 Ga0496101_0000035 Ga0496101_0000035_116758_117489 243
122 3300048907 Ga0496104_0000052 Ga0496104_0000052_80857_81588 243
123 3300048908 Ga0496105_0000030 Ga0496105_0000030_55738_56469 243
124 3300048909 Ga0496106_0000062 Ga0496106_0000062_25290_26021 243
125 3300048910 Ga0496107_0000020 Ga0496107_0000020_87907_88638 243
126 3300053085 Ga0495619_0005486 Ga0495619_0005486_1966_2697 243
127 3300005329 Ga0070683_100003010 Ga0070683_10000301012 244
128 3300005329 Ga0070683_100022449 Ga0070683_1000224494 244
129 3300005329 Ga0070683_100150355 Ga0070683_1001503552 244
130 3300005333 Ga0070677_10000008 Ga0070677_1000000823 244
131 3300005337 Ga0070682_100000090 Ga0070682_10000009055 244
132 3300005337 Ga0070682_100017907 Ga0070682_1000179073 244
133 3300005338 Ga0068868_100059799 Ga0068868_1000597993 244
134 3300005339 Ga0070660_100003444 Ga0070660_1000034449 244
135 3300005340 Ga0070689_100125596 Ga0070689_1001255961 244
136 3300005345 Ga0070692_10006910 Ga0070692_100069103 244
137 3300005356 Ga0070674_100000005 Ga0070674_10000000564 244
138 3300005364 Ga0070673_100017914 Ga0070673_1000179145 244
139 3300005365 Ga0070688_100060397 Ga0070688_1000603973 244
140 3300005365 Ga0070688_100236728 Ga0070688_1002367282 244
141 3300005366 Ga0070659_100000300 Ga0070659_10000030028 244
142 3300005367 Ga0070667_100026459 Ga0070667_1000264594 244
143 3300005441 Ga0070700_100051340 Ga0070700_1000513402 244
144 3300005455 Ga0070663_100002435 Ga0070663_1000024355 244
145 3300005455 Ga0070663_100082852 Ga0070663_1000828522 244
146 3300005456 Ga0070678_100247414 Ga0070678_1002474141 244
147 3300005459 Ga0068867_100032704 Ga0068867_1000327044 244
148 3300005466 Ga0070685_10000314 Ga0070685_100003146 244
149 3300005466 Ga0070685_10182224 Ga0070685_101822242 244
150 3300005535 Ga0070684_100017832 Ga0070684_1000178324 244
151 3300005535 Ga0070684_100060109 Ga0070684_1000601093 244
152 3300005535 Ga0070684_100198288 Ga0070684_1001982882 244
153 3300005539 Ga0068853_100036258 Ga0068853_1000362585 244
154 3300005539 Ga0068853_100078845 Ga0068853_1000788453 244
155 3300005544 Ga0070686_100034338 Ga0070686_1000343383 244
156 3300005548 Ga0070665_100023501 Ga0070665_1000235012 244
157 3300005549 Ga0070704_100417944 Ga0070704_1004179442 244
158 3300005577 Ga0068857_100060025 Ga0068857_1000600252 244
159 3300005577 Ga0068857_100302777 Ga0068857_1003027772 244
160 3300005578 Ga0068854_100035830 Ga0068854_1000358304 244
161 3300005615 Ga0070702_100038047 Ga0070702_1000380472 244
162 3300005616 Ga0068852_100010822 Ga0068852_1000108225 244
163 3300005617 Ga0068859_100113893 Ga0068859_1001138933 244
164 3300005618 Ga0068864_100825872 Ga0068864_1008258721 244
165 3300005841 Ga0068863_100000022 Ga0068863_100000022119 244
166 3300005841 Ga0068863_100674768 Ga0068863_1006747682 244
167 3300005842 Ga0068858_100000097 Ga0068858_10000009757 244
168 3300005843 Ga0068860_100010110 Ga0068860_1000101107 244
169 3300005843 Ga0068860_100164835 Ga0068860_1001648352 244
170 3300005843 Ga0068860_100217641 Ga0068860_1002176412 244
171 3300005844 Ga0068862_100004419 Ga0068862_1000044192 244
172 3300005844 Ga0068862_100023558 Ga0068862_1000235584 244
173 3300005937 Ga0081455_10031732 Ga0081455_100317325 244
174 3300005937 Ga0081455_10460147 Ga0081455_104601471 244
175 3300005981 Ga0081538_10000141 Ga0081538_1000014185 244
176 3300006038 Ga0075365_10046560 Ga0075365_100465603 244
177 3300006038 Ga0075365_10080324 Ga0075365_100803242 244
178 3300006051 Ga0075364_10026917 Ga0075364_100269175 244
179 3300006163 Ga0070715_10000021 Ga0070715_1000002159 244
180 3300006852 Ga0075433_10001579 Ga0075433_1000157914 244
181 3300006881 Ga0068865_100043371 Ga0068865_1000433713 244
182 3300006931 Ga0097620_100113886 Ga0097620_1001138862 244
183 3300007076 Ga0075435_100196549 Ga0075435_1001965493 244
184 3300009098 Ga0105245_10000130 Ga0105245_1000013036 244
185 3300009098 Ga0105245_10094172 Ga0105245_100941722 244
186 3300009101 Ga0105247_10000305 Ga0105247_1000030518 244
187 3300009148 Ga0105243_10947895 Ga0105243_109478952 244
188 3300009176 Ga0105242_10058928 Ga0105242_100589282 244
189 3300009177 Ga0105248_10561961 Ga0105248_105619612 244
190 3300009551 Ga0105238_10000055 Ga0105238_1000005574 244
191 3300009551 Ga0105238_10229526 Ga0105238_102295262 244
192 3300009553 Ga0105249_10569030 Ga0105249_105690302 244
193 3300010375 Ga0105239_10191734 Ga0105239_101917343 244
194 3300013297 Ga0157378_10005546 Ga0157378_100055463 244
195 3300013308 Ga0157375_10000127 Ga0157375_1000012715 244
196 3300014325 Ga0163163_10042918 Ga0163163_100429184 244
197 3300014326 Ga0157380_10051352 Ga0157380_100513524 244
198 3300014745 Ga0157377_10361278 Ga0157377_103612782 244
199 3300014969 Ga0157376_10112247 Ga0157376_101122472 244
200 3300025321 Ga0207656_10076456 Ga0207656_100764561 244
201 3300025893 Ga0207682_10000022 Ga0207682_1000002266 244
202 3300025900 Ga0207710_10000157 Ga0207710_1000015714 244
203 3300025901 Ga0207688_10001361 Ga0207688_100013613 244
204 3300025903 Ga0207680_10056593 Ga0207680_100565933 244
205 3300025905 Ga0207685_10000028 Ga0207685_1000002866 244
206 3300025909 Ga0207705_10033575 Ga0207705_100335754 244
207 3300025917 Ga0207660_10034972 Ga0207660_100349724 244
208 3300025918 Ga0207662_10045924 Ga0207662_100459243 244
209 3300025919 Ga0207657_10001441 Ga0207657_1000144128 244
210 3300025921 Ga0207652_10235143 Ga0207652_102351432 244
211 3300025923 Ga0207681_10074388 Ga0207681_100743883 244
212 3300025924 Ga0207694_10000063 Ga0207694_1000006367 244
213 3300025924 Ga0207694_10306744 Ga0207694_103067441 244
214 3300025926 Ga0207659_10170383 Ga0207659_101703832 244
215 3300025927 Ga0207687_10000032 Ga0207687_1000003276 244
216 3300025932 Ga0207690_10003216 Ga0207690_100032167 244
217 3300025934 Ga0207686_10072457 Ga0207686_100724572 244
218 3300025936 Ga0207670_10047583 Ga0207670_100475833 244
219 3300025936 Ga0207670_10107532 Ga0207670_101075323 244
220 3300025938 Ga0207704_10018356 Ga0207704_100183565 244
221 3300025940 Ga0207691_10017653 Ga0207691_100176533 244
222 3300025941 Ga0207711_10387843 Ga0207711_103878432 244
223 3300025944 Ga0207661_10000988 Ga0207661_1000098813 244
224 3300025944 Ga0207661_10013232 Ga0207661_100132322 244
225 3300025945 Ga0207679_10107495 Ga0207679_101074953 244
226 3300025960 Ga0207651_10047879 Ga0207651_100478793 244
227 3300025961 Ga0207712_10266525 Ga0207712_102665252 244
228 3300025961 Ga0207712_10377582 Ga0207712_103775822 244
229 3300025981 Ga0207640_10141266 Ga0207640_101412663 244
230 3300025986 Ga0207658_10000785 Ga0207658_100007854 244
231 3300025986 Ga0207658_10011617 Ga0207658_100116176 244
232 3300025986 Ga0207658_10115216 Ga0207658_101152163 244
233 3300026035 Ga0207703_10000103 Ga0207703_1000010368 244
234 3300026041 Ga0207639_10061970 Ga0207639_100619703 244
235 3300026067 Ga0207678_10003982 Ga0207678_1000398213 244
236 3300026067 Ga0207678_10721149 Ga0207678_107211491 244
237 3300026075 Ga0207708_10000292 Ga0207708_1000029228 244
238 3300026075 Ga0207708_10051779 Ga0207708_100517792 244
239 3300026078 Ga0207702_10014543 Ga0207702_100145432 244
240 3300026088 Ga0207641_10000016 Ga0207641_10000016241 244
241 3300026088 Ga0207641_10573956 Ga0207641_105739562 244
242 3300026089 Ga0207648_10000960 Ga0207648_1000096018 244
243 3300026089 Ga0207648_10015648 Ga0207648_100156485 244
244 3300026095 Ga0207676_10123355 Ga0207676_101233552 244
245 3300026116 Ga0207674_10439778 Ga0207674_104397782 244
246 3300028379 Ga0268266_10003660 Ga0268266_100036608 244
247 3300028379 Ga0268266_10049980 Ga0268266_100499802 244
248 3300028380 Ga0268265_10008776 Ga0268265_100087766 244
249 3300028380 Ga0268265_10031714 Ga0268265_100317143 244
250 3300028381 Ga0268264_10019061 Ga0268264_100190612 244
251 3300028381 Ga0268264_10031725 Ga0268264_100317252 244
252 3300028800 Ga0265338_10202118 Ga0265338_102021182 244
253 3300028800 Ga0265338_10392180 Ga0265338_103921801 244
254 3300031691 Ga0316579_10125412 Ga0316579_101254122 244
255 3300031995 Ga0307409_100585208 Ga0307409_1005852082 244
256 3300032005 Ga0307411_10369742 Ga0307411_103697422 244
257 3300041512 Ga0451853_1872887 Ga0451853_1872887_99_842 244
258 3300044694 Ga0466963_0052051 Ga0466963_0052051_1617_2354 244
259 3300044694 Ga0466963_0090051 Ga0466963_0090051_34_774 244
260 3300044706 Ga0466964_0055275 Ga0466964_0055275_552_1289 244
261 3300045976 Ga0466967_0000001 Ga0466967_0000001_57142_57879 244
262 3300045976 Ga0466967_0611459 Ga0466967_0611459_43_783 244
263 3300046455 Ga0495603_0003660 Ga0495603_0003660_5718_6455 244
264 3300046455 Ga0495603_0004912 Ga0495603_0004912_4340_5074 244
265 3300046459 Ga0495629_0262266 Ga0495629_0262266_166_903 244
266 3300046460 Ga0495638_0117654 Ga0495638_0117654_193_927 244
267 3300046461 Ga0495641_0000312 Ga0495641_0000312_29389_30123 244
268 3300046462 Ga0495651_0106001 Ga0495651_0106001_173_910 244
269 3300046463 Ga0495653_0162478 Ga0495653_0162478_336_1073 244
270 3300046475 Ga0495639_0071480 Ga0495639_0071480_310_1047 244
271 3300046499 Ga0495594_0000030 Ga0495594_0000030_50812_51546 244
272 3300046515 Ga0495620_0082375 Ga0495620_0082375_320_1054 244
273 3300046517 Ga0495630_0045843 Ga0495630_0045843_11_745 244
274 3300046535 Ga0495586_0001547 Ga0495586_0001547_2939_3673 244
275 3300046537 Ga0495598_0005081 Ga0495598_0005081_1254_1991 244
276 3300046557 Ga0495622_0000080 Ga0495622_0000080_23201_23935 244
277 3300046559 Ga0495667_0000020 Ga0495667_0000020_118035_118772 244
278 3300046559 Ga0495667_0028562 Ga0495667_0028562_2614_3351 244
279 3300046642 Ga0495634_0000031 Ga0495634_0000031_58780_59517 244
280 3300046660 Ga0495625_0000409 Ga0495625_0000409_26417_27154 244
281 3300046678 Ga0495599_0015917 Ga0495599_0015917_3014_3748 244
282 3300046681 Ga0495647_0000001 Ga0495647_0000001_162325_163062 244
283 3300046684 Ga0495669_0000779 Ga0495669_0000779_900_1637 244
284 3300046684 Ga0495669_0127415 Ga0495669_0127415_335_1069 244
285 3300046689 Ga0495613_0146632 Ga0495613_0146632_178_915 244
286 3300046694 Ga0495649_0005501 Ga0495649_0005501_350_1084 244
287 3300047321 Ga0495676_0000131 Ga0495676_0000131_10766_11500 244
288 3300047322 Ga0495680_0000241 Ga0495680_0000241_36594_37328 244
289 3300047322 Ga0495680_0037792 Ga0495680_0037792_631_1368 244
290 3300048088 Ga0495602_0093420 Ga0495602_0093420_954_1694 244
291 3300048904 Ga0496101_0377072 Ga0496101_0377072_226_966 244
292 3300048907 Ga0496104_0000015 Ga0496104_0000015_314656_315393 244
293 3300048907 Ga0496104_0000387 Ga0496104_0000387_9346_10083 244
294 3300048907 Ga0496104_0037865 Ga0496104_0037865_974_1714 244
295 3300048908 Ga0496105_0000004 Ga0496105_0000004_160406_161143 244
296 3300048908 Ga0496105_0001994 Ga0496105_0001994_5424_6161 244
297 3300048908 Ga0496105_0012994 Ga0496105_0012994_2129_2869 244
298 3300048908 Ga0496105_0034227 Ga0496105_0034227_3028_3765 244
299 3300048910 Ga0496107_0029690 Ga0496107_0029690_2027_2767 244
300 3300048910 Ga0496107_0111470 Ga0496107_0111470_891_1631 244
301 3300048911 Ga0496108_0001157 Ga0496108_0001157_19718_20455 244
302 3300048911 Ga0496108_0005281 Ga0496108_0005281_8892_9629 244
303 3300048911 Ga0496108_0022018 Ga0496108_0022018_2752_3492 244
304 3300048911 Ga0496108_0022257 Ga0496108_0022257_3013_3753 244
305 3300048912 Ga0496109_0000009 Ga0496109_0000009_56596_57339 244
306 3300048912 Ga0496109_0000218 Ga0496109_0000218_4827_5564 244
307 3300048912 Ga0496109_0000261 Ga0496109_0000261_21155_21892 244
308 3300048912 Ga0496109_0284893 Ga0496109_0284893_119_859 244
309 3300048913 Ga0496110_0019085 Ga0496110_0019085_2207_2941 244
310 3300048913 Ga0496110_0290391 Ga0496110_0290391_150_890 244
311 3300048914 Ga0496111_0045165 Ga0496111_0045165_1839_2579 244
312 3300048914 Ga0496111_0063636 Ga0496111_0063636_261_995 244
313 3300048916 Ga0496113_0094715 Ga0496113_0094715_275_1015 244
314 3300048917 Ga0496114_0000039 Ga0496114_0000039_82983_83720 244
315 3300048917 Ga0496114_0007985 Ga0496114_0007985_5007_5744 244
316 3300048918 Ga0496115_0000011 Ga0496115_0000011_51216_51953 244
317 3300048919 Ga0496116_0000176 Ga0496116_0000176_32399_33139 244
318 3300048920 Ga0496117_0002925 Ga0496117_0002925_18799_19539 244
319 3300048921 Ga0496118_0004080 Ga0496118_0004080_1544_2284 244
320 3300048921 Ga0496118_0038763 Ga0496118_0038763_1473_2213 244
321 3300048922 Ga0496119_0002021 Ga0496119_0002021_9242_9982 244
322 3300048922 Ga0496119_0012335 Ga0496119_0012335_602_1339 244
323 3300048922 Ga0496119_0018115 Ga0496119_0018115_3498_4238 244
324 3300048922 Ga0496119_0080309 Ga0496119_0080309_750_1490 244
325 3300048923 Ga0496120_0051656 Ga0496120_0051656_1017_1757 244
326 3300048924 Ga0496121_0008779 Ga0496121_0008779_951_1691 244
327 3300048924 Ga0496121_0028248 Ga0496121_0028248_4367_5107 244
328 3300048924 Ga0496121_0061194 Ga0496121_0061194_561_1301 244
329 3300048927 Ga0496124_0125119 Ga0496124_0125119_347_1087 244
330 3300048928 Ga0496125_0050491 Ga0496125_0050491_973_1713 244
331 3300048928 Ga0496125_0181123 Ga0496125_0181123_613_1356 244
332 3300048929 Ga0496126_0221762 Ga0496126_0221762_768_1502 244
333 3300048929 Ga0496126_0576000 Ga0496126_0576000_79_819 244
334 3300049571 Ga0501034_0076223 Ga0501034_0076223_2455_3189 244
335 3300049578 Ga0501042_0006285 Ga0501042_0006285_5420_6154 244
336 3300049578 Ga0501042_0312973 Ga0501042_0312973_252_989 244
337 3300049579 Ga0501043_0099912 Ga0501043_0099912_87_821 244
338 3300049585 Ga0501069_0017780 Ga0501069_0017780_2135_2869 244
339 3300049585 Ga0501069_0052937 Ga0501069_0052937_95_841 244
340 3300049586 Ga0501070_0093566 Ga0501070_0093566_994_1728 244
341 3300049586 Ga0501070_0111784 Ga0501070_0111784_534_1271 244
342 3300049587 Ga0501071_0064937 Ga0501071_0064937_736_1470 244
343 3300049588 Ga0501072_0026243 Ga0501072_0026243_899_1645 244
344 3300049589 Ga0501073_0069283 Ga0501073_0069283_1589_2335 244
345 3300049590 Ga0501074_0014538 Ga0501074_0014538_198_932 244
346 3300049590 Ga0501074_0083748 Ga0501074_0083748_68_814 244
347 3300049743 Ga0501081_0111274 Ga0501081_0111274_966_1703 244
348 3300049744 Ga0501083_0114327 Ga0501083_0114327_794_1534 244
349 3300049823 Ga0501044_0262282 Ga0501044_0262282_910_1650 244
350 3300050490 nmdc:mga03n38_107441_c1 nmdc:mga03n38_107441_c1_15_755 244
351 3300050491 nmdc:mga00v17_47042_c1 nmdc:mga00v17_47042_c1_132_872 244
352 3300050492 nmdc:mga0yw44_187068_c1 nmdc:mga0yw44_187068_c1_285_1025 244
353 3300050494 nmdc:mga06z11_154489_c1 nmdc:mga06z11_154489_c1_538_1278 244
354 3300050510 nmdc:mga06r32_97063_c1 nmdc:mga06r32_97063_c1_82_822 244
355 3300050515 nmdc:mga0a205_113_c1 nmdc:mga0a205_113_c1_11464_12201 244
356 3300053077 Ga0495601_0000720 Ga0495601_0000720_6540_7274 244
357 3300053085 Ga0495619_0000010 Ga0495619_0000010_58973_59710 244
358 3300053085 Ga0495619_0000084 Ga0495619_0000084_12145_12882 244
359 3300053119 Ga0500595_077012 Ga0500595_077012_109_849 244
360 3300053123 Ga0500614_000430 Ga0500614_000430_9051_9785 244
361 3300054114 Ga0501084_0284915 Ga0501084_0284915_289_1026 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

8

206

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fqb-assembly4.cif.gz_H murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 0.9203 2 232
5n9m-assembly2.cif.gz_B crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation 0.873 1 237
6fqb-assembly4.cif.gz_H murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 0.8629 2 232
5n9m-assembly2.cif.gz_B crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation 0.8425 1 237
1vhw-assembly1.cif.gz_F crystal structure of purine nucleoside phosphorylase with adenosine 0.8001 17 43
ID Description Score Start End Superfamily
af_I6XI14_15_209_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9339 20 212 3.40.50.880
af_Q2FX00_16_208_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9301 15 212 3.40.50.880
af_Q2FX00_16_208_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.921 15 212 3.40.50.880
af_I6XI14_15_209_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9065 20 212 3.40.50.880
af_Q57908_264_436_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8623 44 194 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V8W9A2-F1-model_v4 Glutamine amidotransferase 0.9692 2 160 GO:0006541
GO:0016740
AF-A0A538IXH5-F1-model_v4 Glutamine amidotransferase 0.9624 2 113 GO:0006541
GO:0016740
AF-A0A7W1IKL4-F1-model_v4 Glutamine amidotransferase 0.9618 2 194 GO:0004359
GO:0006541
GO:0009236
GO:0016740
GO:0071555
AF-A0A838FFP9-F1-model_v4 Glutamine amidotransferase 0.9534 2 96 GO:0016740
AF-A0A2Z5Y177-F1-model_v4 Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit GatD (EC 6.3.5.13) (Lipid II isoglutaminyl synthase glutaminase subunit) (EC 3.5.1.2) 0.953 2 213 GO:0004359
GO:0006541
GO:0008360
GO:0009236
GO:0009252
GO:0016740
GO:0071555
GO:0140282

Feature Viewer

pLDDT pTM Quality
94.35 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map