F422160

General Info

Members Datasets Scaffolds Average Seq Length
361 106 720 161

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10090061|Ga0081538_100900613
Length 194
Sequence VTWVWHVLAAWRHEITAYRRNARGLRDRQAFEGVRLQAGELFAAGHAQAEVARQLGVARQNVSRWHARWQAGGQQALRSAGPTGPDPRLSDAQLAAIDQALREGARAHGFDTDHWTLGRVTTVIERATGVAYHPGHVWKLLRHRLHYPAALPVGEGHLQAHRRPARQRTTGEPTALATTRGARRFPTCRGRAPP

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
3 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
5 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
6 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
7 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
8 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
9 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
10 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
11 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
12 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
15 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
16 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
17 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
18 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
19 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
20 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
21 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
22 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
23 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
24 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
25 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
26 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
27 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
34 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
35 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
36 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
37 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
38 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
39 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
40 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
41 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
42 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
43 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
44 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
45 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
46 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
47 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
48 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
49 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
50 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
51 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
52 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
53 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
54 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
55 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
56 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
57 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
58 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
59 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
60 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
61 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
78 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
79 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
84 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
85 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
90 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
91 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
104 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 23.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10090061 3300005981 Bacteria 1590
2 Ga0070698_100012420 3300005471 Bacteria 9019
3 Ga0081538_10004012 3300005981 Bacteria 13706
4 Ga0081538_10014981 3300005981 Bacteria 6034
5 Ga0081539_10080491 3300005985 Bacteria 1714
6 Ga0075432_10054782 3300006058 Bacteria 1412
7 Ga0075428_100417555 3300006844 Bacteria 1437
8 Ga0075430_100127153 3300006846 Unclassified 2124
9 Ga0075431_100767554 3300006847 Bacteria 939
10 Ga0075433_10114524 3300006852 Bacteria 2392
11 Ga0075433_10242918 3300006852 Bacteria 1598
12 Ga0075434_100431100 3300006871 Unclassified 1340
13 Ga0075429_100070415 3300006880 Bacteria 3045
14 Ga0075429_100928295 3300006880 Bacteria 761
15 Ga0075435_100202219 3300007076 Bacteria 1683
16 Ga0111539_10230220 3300009094 Unclassified 2158
17 Ga0111539_10319803 3300009094 Unclassified 1806
18 Ga0111539_10769453 3300009094 Unclassified 1121
19 Ga0114129_10024205 3300009147 Bacteria 8605
20 Ga0114129_10361013 3300009147 Unclassified 1922
21 Ga0114129_10487456 3300009147 Unclassified 1612
22 Ga0114129_10864871 3300009147 Unclassified 1148
23 Ga0114129_11523266 3300009147 Unclassified 821
24 Ga0182008_10236231 3300014497 Bacteria 939
25 Ga0182008_10308636 3300014497 Unclassified 830
26 Ga0207428_10092869 3300027907 Bacteria 2342
27 Ga0207428_10225093 3300027907 Unclassified 1405
28 Ga0307408_100042222 3300031548 Bacteria 3238
29 Ga0307408_101064603 3300031548 Unclassified 748
30 Ga0307408_101112661 3300031548 Bacteria 733
31 Ga0307408_101161799 3300031548 Bacteria 718
32 Ga0307405_10016889 3300031731 Bacteria 3992
33 Ga0307405_10124448 3300031731 Bacteria 1770
34 Ga0307405_10224105 3300031731 Bacteria 1381
35 Ga0307405_10461685 3300031731 Bacteria 1009
36 Ga0307405_11037554 3300031731 Bacteria 701
37 Ga0307405_11843755 3300031731 Bacteria 538
38 Ga0307413_10130692 3300031824 Bacteria 1718
39 Ga0307413_10215297 3300031824 Bacteria 1398
40 Ga0307413_10281428 3300031824 Bacteria 1251
41 Ga0307413_10410577 3300031824 Bacteria 1063
42 Ga0307413_10803969 3300031824 Bacteria 790
43 Ga0307410_10008562 3300031852 Bacteria 5683
44 Ga0307410_10156986 3300031852 Bacteria 1700
45 Ga0307410_10177660 3300031852 Bacteria 1609
46 Ga0307410_10303608 3300031852 Unclassified 1260
47 Ga0307410_10371261 3300031852 Bacteria 1148
48 Ga0307410_10840396 3300031852 Bacteria 783
49 Ga0307410_10992729 3300031852 Bacteria 723
50 Ga0307406_10008534 3300031901 Bacteria 5719
51 Ga0307406_10156304 3300031901 Bacteria 1633
52 Ga0307406_10206392 3300031901 Bacteria 1450
53 Ga0307406_10262943 3300031901 Bacteria 1306
54 Ga0307406_11278746 3300031901 Bacteria 639
55 Ga0307407_10153328 3300031903 Bacteria 1500
56 Ga0307407_10222363 3300031903 Bacteria 1277
57 Ga0307412_10069210 3300031911 Unclassified 2402
58 Ga0307412_10167273 3300031911 Bacteria 1640
59 Ga0307412_10346839 3300031911 Bacteria 1190
60 Ga0307412_10353744 3300031911 Bacteria 1180
61 Ga0307412_10454981 3300031911 Bacteria 1055
62 Ga0307412_10637076 3300031911 Unclassified 907
63 Ga0307412_10637468 3300031911 Bacteria 907
64 Ga0307412_10983558 3300031911 Unclassified 744
65 Ga0307409_100023809 3300031995 Bacteria 4253
66 Ga0307409_100314203 3300031995 Bacteria 1463
67 Ga0307409_100496341 3300031995 Bacteria 1187
68 Ga0307409_101743976 3300031995 Unclassified 651
69 Ga0307409_101927226 3300031995 Bacteria 620
70 Ga0307416_100020889 3300032002 Bacteria 4684
71 Ga0307416_100057504 3300032002 Bacteria 3146
72 Ga0307416_100212329 3300032002 Bacteria 1847
73 Ga0307416_100453157 3300032002 Bacteria 1336
74 Ga0307416_100520495 3300032002 Bacteria 1257
75 Ga0307416_100572616 3300032002 Bacteria 1205
76 Ga0307416_101135613 3300032002 Bacteria 886
77 Ga0307416_102188478 3300032002 Unclassified 654
78 Ga0307414_10363811 3300032004 Bacteria 1245
79 Ga0307414_10446445 3300032004 Bacteria 1133
80 Ga0307414_10492209 3300032004 Bacteria 1083
81 Ga0307414_10674760 3300032004 Unclassified 933
82 Ga0307414_11508924 3300032004 Unclassified 625
83 Ga0307411_10016422 3300032005 Bacteria 4189
84 Ga0307411_10113782 3300032005 Bacteria 1942
85 Ga0307411_10304101 3300032005 Bacteria 1280
86 Ga0307411_10361925 3300032005 Bacteria 1186
87 Ga0307411_10435409 3300032005 Unclassified 1093
88 Ga0307411_11129744 3300032005 Bacteria 707
89 Ga0307411_11334194 3300032005 Unclassified 654
90 Ga0307415_100004345 3300032126 Bacteria 7339
91 Ga0307415_100012680 3300032126 Bacteria 4883
92 Ga0307415_100047032 3300032126 Bacteria 2902
93 Ga0307415_100052406 3300032126 Bacteria 2774
94 Ga0307415_100281108 3300032126 Bacteria 1368
95 Ga0307415_100286898 3300032126 Bacteria 1356
96 Ga0307415_100302991 3300032126 Bacteria 1324
97 Ga0307415_100328408 3300032126 Unclassified 1278
98 Ga0307415_100362427 3300032126 Unclassified 1224
99 Ga0307415_100392287 3300032126 Bacteria 1182
100 Ga0307415_100408398 3300032126 Unclassified 1161
101 Ga0307415_100566326 3300032126 Bacteria 1005
102 Ga0307415_100568485 3300032126 Bacteria 1003
103 Ga0307415_100722433 3300032126 Unclassified 901
104 Ga0307415_101607773 3300032126 Unclassified 624
105 Ga0395899_0063676 3300037312 Plasmid 2712
106 Ga0395899_0105364 3300037312 Bacteria 2031
107 Ga0395899_0158689 3300037312 Bacteria 1599
108 Ga0395899_0234221 3300037312 Unclassified 1266
109 Ga0395899_0239781 3300037312 Unclassified 1248
110 Ga0395899_0263002 3300037312 Bacteria 1179
111 Ga0395899_0299569 3300037312 Bacteria 1088
112 Ga0395899_0352237 3300037312 Unclassified 984
113 Ga0395899_0367180 3300037312 Unclassified 959
114 Ga0395899_0599730 3300037312 Bacteria 702
115 Ga0395900_0024279 3300037418 Bacteria 6207
116 Ga0395900_0080540 3300037418 Bacteria 3346
117 Ga0395900_0104065 3300037418 Plasmid 2916
118 Ga0395900_0144021 3300037418 Bacteria 2438
119 Ga0395900_0177270 3300037418 Bacteria 2167
120 Ga0395900_0201855 3300037418 Bacteria 2011
121 Ga0395900_0305621 3300037418 Bacteria 1575
122 Ga0395900_0365626 3300037418 Bacteria 1413
123 Ga0395900_0434507 3300037418 Unclassified 1271
124 Ga0395900_0452133 3300037418 Unclassified 1240
125 Ga0395900_0505333 3300037418 Bacteria 1158
126 Ga0395900_0829222 3300037418 Bacteria 851
127 Ga0395900_0856668 3300037418 Bacteria 834
128 Ga0395900_1229106 3300037418 Bacteria 664
129 Ga0395900_1518380 3300037418 Unclassified 582
130 Ga0395898_0030872 3300037466 Bacteria 5360
131 Ga0395898_0123938 3300037466 Bacteria 2476
132 Ga0395898_0216781 3300037466 Bacteria 1825
133 Ga0395898_0216808 3300037466 Bacteria 1825
134 Ga0395898_0245825 3300037466 Unclassified 1706
135 Ga0395898_0265819 3300037466 Bacteria 1636
136 Ga0395898_0382894 3300037466 Unclassified 1341
137 Ga0395898_0403964 3300037466 Bacteria 1302
138 Ga0395898_0437126 3300037466 Bacteria 1246
139 Ga0395898_0457958 3300037466 Bacteria 1214
140 Ga0395898_0471591 3300037466 Unclassified 1194
141 Ga0395898_0583364 3300037466 Bacteria 1060
142 Ga0395898_0779819 3300037466 Bacteria 897
143 Ga0395898_0938737 3300037466 Unclassified 802
144 Ga0395898_1218494 3300037466 Bacteria 683
145 Ga0395898_1410717 3300037466 Unclassified 624
146 Ga0395905_0072227 3300037471 Bacteria 3235
147 Ga0395905_0097776 3300037471 Bacteria 2756
148 Ga0395905_0110936 3300037471 Bacteria 2576
149 Ga0395905_0120929 3300037471 Unclassified 2461
150 Ga0395905_0179145 3300037471 Unclassified 1990
151 Ga0395905_0266239 3300037471 Unclassified 1599
152 Ga0395905_0345033 3300037471 Bacteria 1380
153 Ga0395905_0393883 3300037471 Unclassified 1279
154 Ga0395905_0411620 3300037471 Unclassified 1247
155 Ga0395905_0415136 3300037471 Bacteria 1241
156 Ga0395905_0457053 3300037471 Bacteria 1175
157 Ga0395905_0469522 3300037471 Bacteria 1157
158 Ga0395905_0498058 3300037471 Bacteria 1118
159 Ga0395905_0860674 3300037471 Unclassified 809
160 Ga0395905_0897250 3300037471 Unclassified 789
161 Ga0395901_0018234 3300038443 Bacteria 7166
162 Ga0395901_0041667 3300038443 Bacteria 4759
163 Ga0395901_0046368 3300038443 Bacteria 4514
164 Ga0395901_0052739 3300038443 Bacteria 4227
165 Ga0395901_0059013 3300038443 Bacteria 3991
166 Ga0395901_0063894 3300038443 Bacteria 3831
167 Ga0395901_0080871 3300038443 Bacteria 3393
168 Ga0395901_0090023 3300038443 Bacteria 3211
169 Ga0395901_0150014 3300038443 Bacteria 2450
170 Ga0395901_0211925 3300038443 Bacteria 2027
171 Ga0395901_0320275 3300038443 Bacteria 1604
172 Ga0395901_0348161 3300038443 Bacteria 1529
173 Ga0395901_0390221 3300038443 Unclassified 1431
174 Ga0395901_0393962 3300038443 Bacteria 1423
175 Ga0395901_0408344 3300038443 Bacteria 1394
176 Ga0395901_0434774 3300038443 Bacteria 1344
177 Ga0395901_0479896 3300038443 Bacteria 1268
178 Ga0395901_0486873 3300038443 Unclassified 1257
179 Ga0395901_0492096 3300038443 Bacteria 1249
180 Ga0395901_0496854 3300038443 Bacteria 1242
181 Ga0395901_0597339 3300038443 Bacteria 1113
182 Ga0395901_0858153 3300038443 Bacteria 893
183 Ga0395901_0951937 3300038443 Bacteria 837
184 Ga0395901_1081756 3300038443 Bacteria 773
185 Ga0395901_1880441 3300038443 Bacteria 546
186 Ga0439443_000877 3300042003 Plasmid 3037
187 Ga0439443_003395 3300042003 Bacteria 2003
188 Ga0439448_0052829 3300042005 Unclassified 1332
189 Ga0439448_0074972 3300042005 Bacteria 1130
190 Ga0439448_0159160 3300042005 Bacteria 785
191 Ga0439448_0192325 3300042005 Bacteria 714
192 Ga0439450_015648 3300042008 Bacteria 1557
193 Ga0439450_022323 3300042008 Bacteria 1365
194 Ga0439450_040261 3300042008 Unclassified 1082
195 Ga0439450_183986 3300042008 Bacteria 555
196 Ga0439451_008846 3300042009 Bacteria 2040
197 Ga0439451_071708 3300042009 Bacteria 694
198 Ga0439454_008373 3300042011 Bacteria 1320
199 Ga0439454_016383 3300042011 Bacteria 1047
200 Ga0439454_018672 3300042011 Unclassified 1001
201 Ga0439455_0011442 3300042012 Bacteria 1971
202 Ga0439455_0055694 3300042012 Bacteria 1040
203 Ga0439455_0116413 3300042012 Unclassified 746
204 Ga0439455_0157426 3300042012 Unclassified 648
205 Ga0439456_007103 3300042013 Unclassified 2294
206 Ga0439456_073991 3300042013 Bacteria 756
207 Ga0439456_132942 3300042013 Bacteria 575
208 Ga0439463_008391 3300042016 Bacteria 2547
209 Ga0439463_021475 3300042016 Bacteria 1612
210 Ga0439463_039618 3300042016 Bacteria 1196
211 Ga0450912_007010 3300042116 Bacteria 907
212 Ga0450913_000602 3300042117 Bacteria 1623
213 Ga0450913_011510 3300042117 Unclassified 721
214 Ga0450915_008467 3300042119 Bacteria 689
215 Ga0450888_010072 3300042126 Bacteria 1089
216 Ga0450888_011533 3300042126 Unclassified 1037
217 Ga0450891_012022 3300042129 Bacteria 804
218 Ga0450900_004933 3300042136 Bacteria 1556
219 Ga0450905_013238 3300042142 Bacteria 1167
220 Ga0450889_008208 3300042144 Bacteria 1058
221 Ga0439458_0003953 3300042157 Bacteria 3424
222 Ga0439458_0023551 3300042157 Unclassified 1436
223 Ga0439435_0014131 3300042436 Bacteria 1968
224 Ga0439444_0012807 3300042437 Bacteria 1380
225 Ga0439444_0013395 3300042437 Unclassified 1357
226 Ga0439459_0020355 3300042438 Unclassified 1265
227 Ga0439459_0023353 3300042438 Bacteria 1204
228 Ga0439459_0029564 3300042438 Bacteria 1106
229 Ga0439464_0028741 3300042439 Bacteria 1550
230 Ga0439464_0045269 3300042439 Bacteria 1262
231 Ga0439464_0073239 3300042439 Bacteria 1015
232 Ga0439460_0025639 3300042461 Bacteria 1643
233 Ga0439460_0056219 3300042461 Bacteria 1191
234 Ga0439460_0100558 3300042461 Unclassified 928
235 Ga0450916_008475 3300042530 Bacteria 1251
236 Ga0450893_0038613 3300042532 Unclassified 869
237 Ga0439440_0004291 3300042993 Bacteria 2794
238 Ga0439440_0025918 3300042993 Bacteria 1353
239 Ga0495620_0252064 3300046515 Bacteria 673
240 Ga0495642_0301621 3300046528 Bacteria 702
241 Ga0495656_0258126 3300046615 Unclassified 882
242 Ga0501031_0009434 3300049568 Bacteria 6343
243 Ga0501031_0061380 3300049568 Bacteria 2449
244 Ga0501032_0364793 3300049569 Bacteria 929
245 Ga0501032_0639760 3300049569 Bacteria 676
246 Ga0501033_0271542 3300049570 Unclassified 1198
247 Ga0501033_0330444 3300049570 Bacteria 1070
248 Ga0501034_0137249 3300049571 Bacteria 2426
249 Ga0501036_0003507 3300049572 Bacteria 12542
250 Ga0501036_0008753 3300049572 Bacteria 8306
251 Ga0501036_0045906 3300049572 Bacteria 3700
252 Ga0501037_0012227 3300049573 Bacteria 6317
253 Ga0501037_0166963 3300049573 Bacteria 1566
254 Ga0501038_0034884 3300049574 Bacteria 4421
255 Ga0501038_0049964 3300049574 Bacteria 3614
256 Ga0501038_0050129 3300049574 Bacteria 3608
257 Ga0501039_0000471 3300049575 Bacteria 29261
258 Ga0501039_0004823 3300049575 Bacteria 10212
259 Ga0501040_0000080 3300049576 Bacteria 46687
260 Ga0501040_0007546 3300049576 Bacteria 7033
261 Ga0501040_0538725 3300049576 Unclassified 842
262 Ga0501041_0011921 3300049577 Bacteria 5146
263 Ga0501041_0146833 3300049577 Bacteria 1471
264 Ga0501042_0002511 3300049578 Bacteria 11300
265 Ga0501042_0012337 3300049578 Bacteria 5785
266 Ga0501042_0015641 3300049578 Bacteria 5195
267 Ga0501042_0026785 3300049578 Bacteria 4050
268 Ga0501042_0232037 3300049578 Unclassified 1331
269 Ga0501042_0528078 3300049578 Unclassified 857
270 Ga0501043_0023441 3300049579 Bacteria 4841
271 Ga0501043_0071322 3300049579 Bacteria 2729
272 Ga0501043_0446260 3300049579 Bacteria 972
273 Ga0501046_0000825 3300049580 Bacteria 30281
274 Ga0501046_0003053 3300049580 Bacteria 15466
275 Ga0501047_0343657 3300049581 Bacteria 1329
276 Ga0501048_0002289 3300049582 Bacteria 14606
277 Ga0501048_0003015 3300049582 Bacteria 12854
278 Ga0501048_0579525 3300049582 Unclassified 805
279 Ga0501068_0026680 3300049584 Bacteria 3405
280 Ga0501069_0161685 3300049585 Bacteria 1289
281 Ga0501070_0037409 3300049586 Bacteria 4051
282 Ga0501070_0566872 3300049586 Bacteria 908
283 Ga0501071_0001410 3300049587 Bacteria 13814
284 Ga0501071_0133948 3300049587 Bacteria 1843
285 Ga0501072_0000653 3300049588 Bacteria 24954
286 Ga0501072_0018954 3300049588 Bacteria 5311
287 Ga0501073_0192436 3300049589 Bacteria 1411
288 Ga0501073_0975354 3300049589 Bacteria 583
289 Ga0501073_1100375 3300049589 Bacteria 546
290 Ga0501074_0006276 3300049590 Bacteria 8582
291 Ga0501074_0008389 3300049590 Bacteria 7489
292 Ga0501074_0275395 3300049590 Bacteria 1196
293 Ga0501074_0368214 3300049590 Bacteria 1019
294 Ga0501074_0577462 3300049590 Unclassified 795
295 Ga0501075_0017623 3300049591 Bacteria 5157
296 Ga0501075_0318810 3300049591 Bacteria 1184
297 Ga0501076_0000011 3300049592 Bacteria 115142
298 Ga0501076_0004115 3300049592 Bacteria 10282
299 Ga0501076_1012232 3300049592 Bacteria 684
300 Ga0501077_0000033 3300049593 Bacteria 69645
301 Ga0501077_0020797 3300049593 Bacteria 4154
302 Ga0501077_0574855 3300049593 Bacteria 723
303 Ga0501079_0001261 3300049741 Bacteria 17754
304 Ga0501079_0002151 3300049741 Bacteria 14182
305 Ga0501079_0059535 3300049741 Bacteria 2946
306 Ga0501079_0525368 3300049741 Unclassified 930
307 Ga0501080_0145883 3300049742 Bacteria 2187
308 Ga0501080_0512992 3300049742 Bacteria 1070
309 Ga0501080_0694394 3300049742 Bacteria 898
310 Ga0501081_0327622 3300049743 Bacteria 1126
311 Ga0501081_0555628 3300049743 Bacteria 858
312 Ga0501083_0105220 3300049744 Bacteria 1858
313 Ga0501083_0463879 3300049744 Bacteria 824
314 Ga0501083_0497853 3300049744 Bacteria 793
315 Ga0501276_022582 3300049773 Unclassified 613
316 Ga0501035_0106843 3300049822 Bacteria 2453
317 Ga0501044_0097389 3300049823 Bacteria 2963
318 Ga0501044_0621668 3300049823 Bacteria 971
319 Ga0501045_0002838 3300049824 Bacteria 11826
320 Ga0501045_0005372 3300049824 Bacteria 8877
321 Ga0501045_0008939 3300049824 Bacteria 6996
322 Ga0501045_0092824 3300049824 Unclassified 2232
323 Ga0501045_0419910 3300049824 Unclassified 995
324 Ga0501045_0589362 3300049824 Bacteria 823
325 nmdc:mga05p37_1636917_c1 3300050507 Unclassified 632
326 nmdc:mga05p37_567840_c1 3300050507 Unclassified 1288
327 nmdc:mga05p37_596798_c1 3300050507 Unclassified 1247
328 nmdc:mga09592_387795_c1 3300050508 Bacteria 1208
329 nmdc:mga09592_398495_c1 3300050508 Unclassified 1190
330 nmdc:mga09592_667542_c1 3300050508 Bacteria 887
331 nmdc:mga0qj67_1520587_c1 3300050509 Unclassified 514
332 nmdc:mga0qj67_305972_c1 3300050509 Bacteria 1288
333 nmdc:mga0qj67_397275_c1 3300050509 Unclassified 1113
334 nmdc:mga06r32_373181_c1 3300050510 Bacteria 1410
335 nmdc:mga06r32_622983_c1 3300050510 Unclassified 1049
336 nmdc:mga08y16_169484_c1 3300050511 Bacteria 2268
337 nmdc:mga08y16_204406_c1 3300050511 Unclassified 2047
338 nmdc:mga08y16_536250_c1 3300050511 Unclassified 1186
339 nmdc:mga08y16_92425_c1 3300050511 Bacteria 3153
340 nmdc:mga0n895_31455_c1 3300050512 Bacteria 5082
341 nmdc:mga0n895_391887_c1 3300050512 Unclassified 1405
342 nmdc:mga0n895_530910_c1 3300050512 Unclassified 1184
343 nmdc:mga0rr50_346599_c1 3300050513 Bacteria 1249
344 nmdc:mga0a205_296714_c1 3300050515 Bacteria 1490
345 nmdc:mga0a205_355112_c1 3300050515 Bacteria 1333
346 nmdc:mga0a205_911866_c1 3300050515 Bacteria 726
347 Ga0501084_0046125 3300054114 Bacteria 3649
348 Ga0501084_0068508 3300054114 Bacteria 2970
349 Ga0501084_0097655 3300054114 Bacteria 2466
350 Ga0501084_0137671 3300054114 Bacteria 2055
351 Ga0501084_0324006 3300054114 Unclassified 1301
352 Ga0501084_0767097 3300054114 Bacteria 812
353 Ga0501084_1023676 3300054114 Unclassified 694
354 Ga0590071_032314 3300059421 Bacteria 1249
355 Ga0590075_036974 3300059424 Bacteria 1244
356 Ga0501082_0005675 3300060353 Bacteria 10831
357 Ga0501082_0015917 3300060353 Bacteria 6468
358 Ga0501082_0718338 3300060353 Bacteria 874
359 Ga0530510_0000788 3300061734 Bacteria 20604
360 Ga0530510_0011117 3300061734 Bacteria 6314
361 Ga0081538_10090061
362 Ga0070698_100012420
363 Ga0081538_10004012
364 Ga0081538_10014981
365 Ga0081539_10080491
366 Ga0075432_10054782
367 Ga0075428_100417555
368 Ga0075430_100127153
369 Ga0075431_100767554
370 Ga0075433_10114524
371 Ga0075433_10242918
372 Ga0075434_100431100
373 Ga0075429_100070415
374 Ga0075429_100928295
375 Ga0075435_100202219
376 Ga0111539_10230220
377 Ga0111539_10319803
378 Ga0111539_10769453
379 Ga0114129_10024205
380 Ga0114129_10361013
381 Ga0114129_10487456
382 Ga0114129_10864871
383 Ga0114129_11523266
384 Ga0182008_10236231
385 Ga0182008_10308636
386 Ga0207428_10092869
387 Ga0207428_10225093
388 Ga0307408_100042222
389 Ga0307408_101064603
390 Ga0307408_101112661
391 Ga0307408_101161799
392 Ga0307405_10016889
393 Ga0307405_10124448
394 Ga0307405_10224105
395 Ga0307405_10461685
396 Ga0307405_11037554
397 Ga0307405_11843755
398 Ga0307413_10130692
399 Ga0307413_10215297
400 Ga0307413_10281428
401 Ga0307413_10410577
402 Ga0307413_10803969
403 Ga0307410_10008562
404 Ga0307410_10156986
405 Ga0307410_10177660
406 Ga0307410_10303608
407 Ga0307410_10371261
408 Ga0307410_10840396
409 Ga0307410_10992729
410 Ga0307406_10008534
411 Ga0307406_10156304
412 Ga0307406_10206392
413 Ga0307406_10262943
414 Ga0307406_11278746
415 Ga0307407_10153328
416 Ga0307407_10222363
417 Ga0307412_10069210
418 Ga0307412_10167273
419 Ga0307412_10346839
420 Ga0307412_10353744
421 Ga0307412_10454981
422 Ga0307412_10637076
423 Ga0307412_10637468
424 Ga0307412_10983558
425 Ga0307409_100023809
426 Ga0307409_100314203
427 Ga0307409_100496341
428 Ga0307409_101743976
429 Ga0307409_101927226
430 Ga0307416_100020889
431 Ga0307416_100057504
432 Ga0307416_100212329
433 Ga0307416_100453157
434 Ga0307416_100520495
435 Ga0307416_100572616
436 Ga0307416_101135613
437 Ga0307416_102188478
438 Ga0307414_10363811
439 Ga0307414_10446445
440 Ga0307414_10492209
441 Ga0307414_10674760
442 Ga0307414_11508924
443 Ga0307411_10016422
444 Ga0307411_10113782
445 Ga0307411_10304101
446 Ga0307411_10361925
447 Ga0307411_10435409
448 Ga0307411_11129744
449 Ga0307411_11334194
450 Ga0307415_100004345
451 Ga0307415_100012680
452 Ga0307415_100047032
453 Ga0307415_100052406
454 Ga0307415_100281108
455 Ga0307415_100286898
456 Ga0307415_100302991
457 Ga0307415_100328408
458 Ga0307415_100362427
459 Ga0307415_100392287
460 Ga0307415_100408398
461 Ga0307415_100566326
462 Ga0307415_100568485
463 Ga0307415_100722433
464 Ga0307415_101607773
465 Ga0395899_0063676
466 Ga0395899_0105364
467 Ga0395899_0158689
468 Ga0395899_0234221
469 Ga0395899_0239781
470 Ga0395899_0263002
471 Ga0395899_0299569
472 Ga0395899_0352237
473 Ga0395899_0367180
474 Ga0395899_0599730
475 Ga0395900_0024279
476 Ga0395900_0080540
477 Ga0395900_0104065
478 Ga0395900_0144021
479 Ga0395900_0177270
480 Ga0395900_0201855
481 Ga0395900_0305621
482 Ga0395900_0365626
483 Ga0395900_0434507
484 Ga0395900_0452133
485 Ga0395900_0505333
486 Ga0395900_0829222
487 Ga0395900_0856668
488 Ga0395900_1229106
489 Ga0395900_1518380
490 Ga0395898_0030872
491 Ga0395898_0123938
492 Ga0395898_0216781
493 Ga0395898_0216808
494 Ga0395898_0245825
495 Ga0395898_0265819
496 Ga0395898_0382894
497 Ga0395898_0403964
498 Ga0395898_0437126
499 Ga0395898_0457958
500 Ga0395898_0471591
501 Ga0395898_0583364
502 Ga0395898_0779819
503 Ga0395898_0938737
504 Ga0395898_1218494
505 Ga0395898_1410717
506 Ga0395905_0072227
507 Ga0395905_0097776
508 Ga0395905_0110936
509 Ga0395905_0120929
510 Ga0395905_0179145
511 Ga0395905_0266239
512 Ga0395905_0345033
513 Ga0395905_0393883
514 Ga0395905_0411620
515 Ga0395905_0415136
516 Ga0395905_0457053
517 Ga0395905_0469522
518 Ga0395905_0498058
519 Ga0395905_0860674
520 Ga0395905_0897250
521 Ga0395901_0018234
522 Ga0395901_0041667
523 Ga0395901_0046368
524 Ga0395901_0052739
525 Ga0395901_0059013
526 Ga0395901_0063894
527 Ga0395901_0080871
528 Ga0395901_0090023
529 Ga0395901_0150014
530 Ga0395901_0211925
531 Ga0395901_0320275
532 Ga0395901_0348161
533 Ga0395901_0390221
534 Ga0395901_0393962
535 Ga0395901_0408344
536 Ga0395901_0434774
537 Ga0395901_0479896
538 Ga0395901_0486873
539 Ga0395901_0492096
540 Ga0395901_0496854
541 Ga0395901_0597339
542 Ga0395901_0858153
543 Ga0395901_0951937
544 Ga0395901_1081756
545 Ga0395901_1880441
546 Ga0439443_000877
547 Ga0439443_003395
548 Ga0439448_0052829
549 Ga0439448_0074972
550 Ga0439448_0159160
551 Ga0439448_0192325
552 Ga0439450_015648
553 Ga0439450_022323
554 Ga0439450_040261
555 Ga0439450_183986
556 Ga0439451_008846
557 Ga0439451_071708
558 Ga0439454_008373
559 Ga0439454_016383
560 Ga0439454_018672
561 Ga0439455_0011442
562 Ga0439455_0055694
563 Ga0439455_0116413
564 Ga0439455_0157426
565 Ga0439456_007103
566 Ga0439456_073991
567 Ga0439456_132942
568 Ga0439463_008391
569 Ga0439463_021475
570 Ga0439463_039618
571 Ga0450912_007010
572 Ga0450913_000602
573 Ga0450913_011510
574 Ga0450915_008467
575 Ga0450888_010072
576 Ga0450888_011533
577 Ga0450891_012022
578 Ga0450900_004933
579 Ga0450905_013238
580 Ga0450889_008208
581 Ga0439458_0003953
582 Ga0439458_0023551
583 Ga0439435_0014131
584 Ga0439444_0012807
585 Ga0439444_0013395
586 Ga0439459_0020355
587 Ga0439459_0023353
588 Ga0439459_0029564
589 Ga0439464_0028741
590 Ga0439464_0045269
591 Ga0439464_0073239
592 Ga0439460_0025639
593 Ga0439460_0056219
594 Ga0439460_0100558
595 Ga0450916_008475
596 Ga0450893_0038613
597 Ga0439440_0004291
598 Ga0439440_0025918
599 Ga0495620_0252064
600 Ga0495642_0301621
601 Ga0495656_0258126
602 Ga0501031_0009434
603 Ga0501031_0061380
604 Ga0501032_0364793
605 Ga0501032_0639760
606 Ga0501033_0271542
607 Ga0501033_0330444
608 Ga0501034_0137249
609 Ga0501036_0003507
610 Ga0501036_0008753
611 Ga0501036_0045906
612 Ga0501037_0012227
613 Ga0501037_0166963
614 Ga0501038_0034884
615 Ga0501038_0049964
616 Ga0501038_0050129
617 Ga0501039_0000471
618 Ga0501039_0004823
619 Ga0501040_0000080
620 Ga0501040_0007546
621 Ga0501040_0538725
622 Ga0501041_0011921
623 Ga0501041_0146833
624 Ga0501042_0002511
625 Ga0501042_0012337
626 Ga0501042_0015641
627 Ga0501042_0026785
628 Ga0501042_0232037
629 Ga0501042_0528078
630 Ga0501043_0023441
631 Ga0501043_0071322
632 Ga0501043_0446260
633 Ga0501046_0000825
634 Ga0501046_0003053
635 Ga0501047_0343657
636 Ga0501048_0002289
637 Ga0501048_0003015
638 Ga0501048_0579525
639 Ga0501068_0026680
640 Ga0501069_0161685
641 Ga0501070_0037409
642 Ga0501070_0566872
643 Ga0501071_0001410
644 Ga0501071_0133948
645 Ga0501072_0000653
646 Ga0501072_0018954
647 Ga0501073_0192436
648 Ga0501073_0975354
649 Ga0501073_1100375
650 Ga0501074_0006276
651 Ga0501074_0008389
652 Ga0501074_0275395
653 Ga0501074_0368214
654 Ga0501074_0577462
655 Ga0501075_0017623
656 Ga0501075_0318810
657 Ga0501076_0000011
658 Ga0501076_0004115
659 Ga0501076_1012232
660 Ga0501077_0000033
661 Ga0501077_0020797
662 Ga0501077_0574855
663 Ga0501079_0001261
664 Ga0501079_0002151
665 Ga0501079_0059535
666 Ga0501079_0525368
667 Ga0501080_0145883
668 Ga0501080_0512992
669 Ga0501080_0694394
670 Ga0501081_0327622
671 Ga0501081_0555628
672 Ga0501083_0105220
673 Ga0501083_0463879
674 Ga0501083_0497853
675 Ga0501276_022582
676 Ga0501035_0106843
677 Ga0501044_0097389
678 Ga0501044_0621668
679 Ga0501045_0002838
680 Ga0501045_0005372
681 Ga0501045_0008939
682 Ga0501045_0092824
683 Ga0501045_0419910
684 Ga0501045_0589362
685 nmdc:mga05p37_1636917_c1
686 nmdc:mga05p37_567840_c1
687 nmdc:mga05p37_596798_c1
688 nmdc:mga09592_387795_c1
689 nmdc:mga09592_398495_c1
690 nmdc:mga09592_667542_c1
691 nmdc:mga0qj67_1520587_c1
692 nmdc:mga0qj67_305972_c1
693 nmdc:mga0qj67_397275_c1
694 nmdc:mga06r32_373181_c1
695 nmdc:mga06r32_622983_c1
696 nmdc:mga08y16_169484_c1
697 nmdc:mga08y16_204406_c1
698 nmdc:mga08y16_536250_c1
699 nmdc:mga08y16_92425_c1
700 nmdc:mga0n895_31455_c1
701 nmdc:mga0n895_391887_c1
702 nmdc:mga0n895_530910_c1
703 nmdc:mga0rr50_346599_c1
704 nmdc:mga0a205_296714_c1
705 nmdc:mga0a205_355112_c1
706 nmdc:mga0a205_911866_c1
707 Ga0501084_0046125
708 Ga0501084_0068508
709 Ga0501084_0097655
710 Ga0501084_0137671
711 Ga0501084_0324006
712 Ga0501084_0767097
713 Ga0501084_1023676
714 Ga0590071_032314
715 Ga0590075_036974
716 Ga0501082_0005675
717 Ga0501082_0015917
718 Ga0501082_0718338
719 Ga0530510_0000788
720 Ga0530510_0011117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13384

HTH_23

Homeodomain-like domain

29

78

0.93

PF13565

HTH_32

Homeodomain-like domain

61

141

0.9

PF13592

HTH_33

Winged helix-turn helix

111

150

0.9

PF13518

HTH_28

Helix-turn-helix domain

34

85

0.89

PF13551

HTH_29

Winged helix-turn helix

35

95

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x48-assembly1.cif.gz_A orf 55 from sulfolobus islandicus rudivirus 1 0.9438 22 53
1tc3-assembly1.cif.gz_C transposase tc3a1-65 from caenorhabditis elegans 0.9183 21 55
1gdt-assembly1.cif.gz_B crystal structure of a site-specific recombinase, gamma-delta resolvase complexed with a 34 bp cleavage site 0.9105 23 55
4y13-assembly1.cif.gz_A sdia in complex with octanoyl-rac-glycerol 0.8863 23 53
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.8746 23 55
ID Description Score Start End Superfamily
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9216 20 60 1.10.10.10
af_Q20551_91_164_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9208 20 60 1.10.10.10
1gdtA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9197 23 54 1.10.10.60
1tc3C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9183 21 55 1.10.10.60
1gdtB03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9105 23 55 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1Q5HBN1-F1-model_v4 Transposase 0.8485 77 160
AF-A0A0G3A3R6-F1-model_v4 deleted 0.8345 9 80
AF-A0A5M3W321-F1-model_v4 DNA-binding domain-containing protein 0.8212 10 78
AF-A0A1Q5HBN1-F1-model_v4 Transposase 0.7957 77 160
AF-A0A291Q1X5-F1-model_v4 Mobile element protein 0.7746 5 78

Map