F421954

General Info

Members Datasets Scaffolds Average Seq Length
360 205 720 97

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0112979|Ga0466961_0112979_1293_1628
Length 111
Sequence MAGAGYVVICLFFGLAGGVVGRMKGSSFVLWFLISALVPVFGLLAAIFYRWEDRELRRRCSGCGRVVKLYDAKCMACGAELEFPEVALASEATMRDRRRTAVTERAGAINR

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 3.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.39
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 17.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0112979 3300044693 Unclassified 1708
2 LJNas_1029396 3300000546 Unclassified 590
3 Ga0070683_100329142 3300005329 Bacteria 1454
4 Ga0070683_102121045 3300005329 Bacteria 540
5 Ga0070680_100308712 3300005336 Bacteria 1342
6 Ga0070668_100121546 3300005347 Bacteria 2088
7 Ga0070674_100830146 3300005356 Bacteria 800
8 Ga0070659_102082332 3300005366 Bacteria 510
9 Ga0070667_100406274 3300005367 Bacteria 1240
10 Ga0070709_10183565 3300005434 Unclassified 1471
11 Ga0070709_10211218 3300005434 Bacteria 1380
12 Ga0070714_100002529 3300005435 Bacteria 13484
13 Ga0070714_100205935 3300005435 Unclassified 1801
14 Ga0070714_100255252 3300005435 Unclassified 1622
15 Ga0070714_100387289 3300005435 Bacteria 1319
16 Ga0070714_101085523 3300005435 Bacteria 780
17 Ga0070714_101087244 3300005435 Unclassified 779
18 Ga0070714_101881508 3300005435 Bacteria 584
19 Ga0070713_100042438 3300005436 Bacteria 3712
20 Ga0070713_100143214 3300005436 Bacteria 2119
21 Ga0070713_100256564 3300005436 Bacteria 1597
22 Ga0070710_10021342 3300005437 Bacteria 3373
23 Ga0070710_10248409 3300005437 Bacteria 1143
24 Ga0070710_11264616 3300005437 Unclassified 548
25 Ga0070711_100012144 3300005439 Bacteria 5374
26 Ga0070711_100207727 3300005439 Bacteria 1515
27 Ga0070678_102068190 3300005456 Bacteria 539
28 Ga0070681_11362927 3300005458 Bacteria 633
29 Ga0070685_10430306 3300005466 Unclassified 920
30 Ga0070685_10635699 3300005466 Bacteria 772
31 Ga0070684_100161516 3300005535 Bacteria 2033
32 Ga0070684_100885392 3300005535 Unclassified 836
33 Ga0070672_100976431 3300005543 Unclassified 750
34 Ga0070693_100474418 3300005547 Bacteria 883
35 Ga0070665_100008226 3300005548 Bacteria 10559
36 Ga0070664_100593432 3300005564 Bacteria 1027
37 Ga0068856_101301941 3300005614 Unclassified 742
38 Ga0068852_101723541 3300005616 Bacteria 649
39 Ga0068866_10404002 3300005718 Bacteria 882
40 Ga0081455_10420986 3300005937 Bacteria 921
41 Ga0081538_10001106 3300005981 Bacteria 28562
42 Ga0081539_10002591 3300005985 Bacteria 24852
43 Ga0081539_10042807 3300005985 Bacteria 2633
44 Ga0070717_10030019 3300006028 Bacteria 4367
45 Ga0070717_10091829 3300006028 Unclassified 2564
46 Ga0070717_10106750 3300006028 Bacteria 2384
47 Ga0070717_10626674 3300006028 Unclassified 976
48 Ga0070715_10029137 3300006163 Bacteria 2221
49 Ga0070716_100256013 3300006173 Unclassified 1195
50 Ga0070716_100457349 3300006173 Bacteria 932
51 Ga0070712_100010461 3300006175 Bacteria 5854
52 Ga0070712_100607268 3300006175 Unclassified 926
53 Ga0068871_101937798 3300006358 Bacteria 560
54 Ga0075434_100292905 3300006871 Bacteria 1648
55 Ga0075434_100706724 3300006871 Bacteria 1025
56 Ga0068865_100267775 3300006881 Unclassified 1355
57 Ga0068865_100581895 3300006881 Bacteria 944
58 Ga0068865_101717210 3300006881 Bacteria 566
59 Ga0105240_12091178 3300009093 Bacteria 588
60 Ga0105245_12834911 3300009098 Bacteria 537
61 Ga0105243_11523722 3300009148 Bacteria 693
62 Ga0105241_11246732 3300009174 Bacteria 706
63 Ga0105242_10809311 3300009176 Bacteria 928
64 Ga0105248_10566481 3300009177 Bacteria 1281
65 Ga0105237_12027850 3300009545 Bacteria 584
66 Ga0105249_10437506 3300009553 Bacteria 1344
67 Ga0105249_11627048 3300009553 Unclassified 718
68 Ga0157369_11129744 3300013105 Bacteria 800
69 Ga0157374_11405455 3300013296 Bacteria 721
70 Ga0157374_11447995 3300013296 Bacteria 710
71 Ga0163162_11353225 3300013306 Bacteria 810
72 Ga0157372_11571470 3300013307 Unclassified 757
73 Ga0163163_11441218 3300014325 Bacteria 750
74 Ga0157380_11408646 3300014326 Bacteria 748
75 Ga0182008_10288905 3300014497 Bacteria 855
76 Ga0163161_10740476 3300017792 Bacteria 821
77 Ga0197907_11187738 3300020069 Bacteria 1018
78 Ga0206353_10440907 3300020082 Bacteria 1563
79 Ga0213873_10017156 3300021358 Bacteria 1648
80 Ga0213873_10032622 3300021358 Bacteria 1302
81 Ga0213874_10000122 3300021377 Bacteria 12962
82 Ga0213874_10051072 3300021377 Bacteria 1269
83 Ga0213876_10062594 3300021384 Bacteria 1964
84 Ga0213876_10106286 3300021384 Bacteria 1489
85 Ga0213876_10241932 3300021384 Bacteria 959
86 Ga0213875_10058369 3300021388 Bacteria 1806
87 Ga0213875_10363064 3300021388 Bacteria 688
88 Ga0224712_10091749 3300022467 Bacteria 1274
89 Ga0224712_10220418 3300022467 Bacteria 868
90 Ga0207692_10040966 3300025898 Bacteria 2289
91 Ga0207692_10630772 3300025898 Unclassified 691
92 Ga0207685_10043686 3300025905 Bacteria 1690
93 Ga0207699_10085152 3300025906 Bacteria 1970
94 Ga0207699_10093581 3300025906 Bacteria 1892
95 Ga0207699_10438099 3300025906 Bacteria 936
96 Ga0207707_11002430 3300025912 Bacteria 685
97 Ga0207693_10003619 3300025915 Bacteria 13199
98 Ga0207693_10150998 3300025915 Bacteria 1827
99 Ga0207693_10198319 3300025915 Bacteria 1578
100 Ga0207663_10013869 3300025916 Bacteria 4394
101 Ga0207663_10232637 3300025916 Unclassified 1347
102 Ga0207663_10327287 3300025916 Bacteria 1153
103 Ga0207652_10177231 3300025921 Bacteria 1915
104 Ga0207650_11360374 3300025925 Bacteria 604
105 Ga0207700_10052023 3300025928 Bacteria 3060
106 Ga0207700_10596044 3300025928 Bacteria 983
107 Ga0207664_10003270 3300025929 Bacteria 10770
108 Ga0207664_10020267 3300025929 Bacteria 4925
109 Ga0207664_10030383 3300025929 Bacteria 4125
110 Ga0207664_10110437 3300025929 Unclassified 2286
111 Ga0207664_11154745 3300025929 Unclassified 691
112 Ga0207690_11609333 3300025932 Bacteria 543
113 Ga0207706_11400964 3300025933 Bacteria 574
114 Ga0207686_10655425 3300025934 Bacteria 831
115 Ga0207669_11356111 3300025937 Bacteria 605
116 Ga0207704_10255136 3300025938 Unclassified 1319
117 Ga0207665_10049904 3300025939 Bacteria 2813
118 Ga0207665_10255665 3300025939 Unclassified 1296
119 Ga0207665_11388266 3300025939 Unclassified 559
120 Ga0207661_10175887 3300025944 Bacteria 1866
121 Ga0207661_11721646 3300025944 Bacteria 572
122 Ga0207661_12150269 3300025944 Bacteria 504
123 Ga0207679_11018571 3300025945 Bacteria 759
124 Ga0207712_10287262 3300025961 Bacteria 1344
125 Ga0207668_10216802 3300025972 Bacteria 1534
126 Ga0207677_11207365 3300026023 Bacteria 692
127 Ga0207639_10426481 3300026041 Bacteria 1200
128 Ga0207702_11304066 3300026078 Bacteria 720
129 Ga0207648_11360162 3300026089 Bacteria 667
130 Ga0207675_100462942 3300026118 Bacteria 1258
131 Ga0268266_10051609 3300028379 Bacteria 3530
132 Ga0307406_10559878 3300031901 Unclassified 937
133 Ga0307406_11134971 3300031901 Bacteria 676
134 Ga0307412_10809747 3300031911 Bacteria 814
135 Ga0307412_11104759 3300031911 Unclassified 706
136 Ga0307409_100750445 3300031995 Bacteria 980
137 Ga0307409_101257427 3300031995 Bacteria 764
138 Ga0307409_102519272 3300031995 Bacteria 543
139 Ga0307416_100801237 3300032002 Bacteria 1038
140 Ga0307416_101499597 3300032002 Bacteria 780
141 Ga0307415_101016048 3300032126 Bacteria 772
142 Ga0373945_0123357 3300035116 Unclassified 1032
143 Ga0373953_0329859 3300035117 Unclassified 667
144 Ga0373954_0049040 3300035118 Bacteria 1980
145 Ga0373935_0729002 3300035692 Bacteria 730
146 Ga0373927_0287636 3300035695 Bacteria 1082
147 Ga0373933_0069823 3300035724 Bacteria 2136
148 Ga0373937_0035375 3300036401 Bacteria 4546
149 Ga0395898_0019693 3300037466 Bacteria 6864
150 Ga0436364_0018642 3300037853 Bacteria 1198
151 Ga0436364_0445774 3300037853 Bacteria 40627
152 Ga0436364_1463516 3300037853 Bacteria 978
153 Ga0395901_0061069 3300038443 Bacteria 3922
154 Ga0395901_1590719 3300038443 Bacteria 607
155 Ga0436365_0131866 3300039437 Bacteria 12761
156 Ga0436365_0356386 3300039437 Bacteria 16795
157 Ga0436365_0451312 3300039437 Bacteria 2069
158 Ga0436365_1022153 3300039437 Bacteria 1914
159 Ga0436365_1404890 3300039437 Unclassified 2992
160 Ga0436363_0328768 3300039450 Bacteria 547
161 Ga0436363_0335334 3300039450 Unclassified 603
162 Ga0436363_0466053 3300039450 Bacteria 1492
163 Ga0436363_0735149 3300039450 Bacteria 3029
164 Ga0436363_0983181 3300039450 Bacteria 38641
165 Ga0436363_1253158 3300039450 Bacteria 734
166 Ga0436363_1717305 3300039450 Bacteria 590
167 Ga0436362_0182869 3300039453 Bacteria 1491
168 Ga0436362_0470525 3300039453 Bacteria 3660
169 Ga0436362_0489362 3300039453 Bacteria 1325
170 Ga0436362_0495269 3300039453 Bacteria 1303
171 Ga0436362_0822266 3300039453 Bacteria 710
172 Ga0451789_1096168 3300041443 Bacteria 788
173 Ga0466969_0033265 3300044656 Bacteria 2619
174 Ga0466965_0166091 3300044683 Bacteria 1159
175 Ga0466965_0244163 3300044683 Bacteria 962
176 Ga0466965_0729920 3300044683 Bacteria 570
177 Ga0466966_0150093 3300044684 Bacteria 1422
178 Ga0466966_0177261 3300044684 Bacteria 1294
179 Ga0466966_0201071 3300044684 Bacteria 1206
180 Ga0466966_0490465 3300044684 Bacteria 739
181 Ga0466966_0764080 3300044684 Bacteria 583
182 Ga0466961_0060168 3300044693 Bacteria 2415
183 Ga0466961_0114792 3300044693 Bacteria 1693
184 Ga0466961_0209426 3300044693 Bacteria 1204
185 Ga0466961_0236976 3300044693 Bacteria 1122
186 Ga0466961_0304887 3300044693 Bacteria 972
187 Ga0466963_0002963 3300044694 Bacteria 9588
188 Ga0466963_0006690 3300044694 Bacteria 6846
189 Ga0466963_0189249 3300044694 Bacteria 1438
190 Ga0466963_0423006 3300044694 Unclassified 939
191 Ga0466963_0446566 3300044694 Bacteria 912
192 Ga0466964_0255396 3300044706 Bacteria 866
193 Ga0466968_0053552 3300044735 Bacteria 1729
194 Ga0466968_0099933 3300044735 Unclassified 1294
195 Ga0466968_0174576 3300044735 Bacteria 997
196 Ga0466968_0199758 3300044735 Bacteria 936
197 Ga0466968_0201580 3300044735 Bacteria 932
198 Ga0466968_0278872 3300044735 Bacteria 799
199 Ga0466968_0415115 3300044735 Bacteria 661
200 Ga0466968_0445686 3300044735 Unclassified 640
201 Ga0466970_0641327 3300044765 Unclassified 617
202 Ga0466970_0875084 3300044765 Bacteria 528
203 Ga0466957_0146421 3300044842 Bacteria 1525
204 Ga0466957_0149789 3300044842 Bacteria 1508
205 Ga0466957_0301906 3300044842 Bacteria 1076
206 Ga0466957_0782604 3300044842 Bacteria 677
207 Ga0466957_0801896 3300044842 Unclassified 669
208 Ga0466960_0051895 3300044901 Bacteria 1983
209 Ga0466960_0135190 3300044901 Bacteria 1305
210 Ga0466960_0181772 3300044901 Bacteria 1140
211 Ga0466960_0199529 3300044901 Bacteria 1092
212 Ga0466959_0013746 3300045049 Bacteria 5876
213 Ga0466959_0045358 3300045049 Bacteria 3237
214 Ga0466959_0186027 3300045049 Bacteria 1451
215 Ga0466959_0457049 3300045049 Bacteria 865
216 Ga0466959_0504679 3300045049 Bacteria 817
217 Ga0466959_0543926 3300045049 Bacteria 783
218 Ga0466959_0547782 3300045049 Bacteria 780
219 Ga0466959_1018547 3300045049 Bacteria 551
220 Ga0466958_0045378 3300045836 Bacteria 2650
221 Ga0466958_0048573 3300045836 Bacteria 2565
222 Ga0466958_0179482 3300045836 Unclassified 1343
223 Ga0466958_0229921 3300045836 Bacteria 1184
224 Ga0466958_0346791 3300045836 Bacteria 956
225 Ga0466958_0410770 3300045836 Bacteria 874
226 Ga0466958_0446753 3300045836 Bacteria 837
227 Ga0466967_0001605 3300045976 Bacteria 13329
228 Ga0466967_0009571 3300045976 Bacteria 7202
229 Ga0466967_0103928 3300045976 Bacteria 2600
230 Ga0466967_0112337 3300045976 Bacteria 2505
231 Ga0466967_0339393 3300045976 Bacteria 1452
232 Ga0466967_0847386 3300045976 Unclassified 908
233 Ga0466967_0900588 3300045976 Bacteria 880
234 Ga0466967_0944956 3300045976 Bacteria 858
235 Ga0495592_0019699 3300046454 Bacteria 5132
236 Ga0495590_0085214 3300046457 Unclassified 1115
237 Ga0495629_0511421 3300046459 Unclassified 809
238 Ga0495651_0022651 3300046462 Bacteria 4883
239 Ga0495651_0244801 3300046462 Bacteria 1228
240 Ga0495653_0101172 3300046463 Unclassified 2088
241 Ga0495580_0431795 3300046472 Bacteria 885
242 Ga0495662_0581377 3300046476 Unclassified 548
243 Ga0495664_0101601 3300046477 Bacteria 1733
244 Ga0495608_0038854 3300046511 Bacteria 3193
245 Ga0495618_0089969 3300046514 Bacteria 1963
246 Ga0495628_0167592 3300046516 Bacteria 1667
247 Ga0495628_0361358 3300046516 Bacteria 1066
248 Ga0495630_0531979 3300046517 Bacteria 901
249 Ga0495630_1336004 3300046517 Bacteria 540
250 Ga0495643_0228459 3300046522 Unclassified 879
251 Ga0495652_0049756 3300046529 Bacteria 3586
252 Ga0495640_0596123 3300046533 Bacteria 667
253 Ga0495587_0245404 3300046536 Bacteria 1007
254 Ga0495667_0000840 3300046559 Bacteria 19835
255 Ga0495634_0329951 3300046642 Unclassified 917
256 Ga0495635_0303370 3300046663 Bacteria 1070
257 Ga0495588_0592797 3300046674 Unclassified 580
258 Ga0495657_0087230 3300046675 Unclassified 2008
259 Ga0495599_0038813 3300046678 Bacteria 2993
260 Ga0495646_0030681 3300046680 Bacteria 3356
261 Ga0495647_0295523 3300046681 Unclassified 729
262 Ga0495624_0176211 3300046690 Unclassified 1304
263 Ga0495600_0673192 3300046809 Unclassified 624
264 Ga0495604_0061738 3300047317 Bacteria 2865
265 Ga0495674_0011695 3300047319 Bacteria 8281
266 Ga0495674_0772893 3300047319 Bacteria 749
267 Ga0495676_0322952 3300047321 Bacteria 1037
268 Ga0495680_0148485 3300047322 Bacteria 1710
269 Ga0495680_0530359 3300047322 Unclassified 796
270 Ga0495684_0009191 3300047471 Bacteria 7632
271 Ga0495684_0065457 3300047471 Bacteria 2763
272 Ga0495593_0100931 3300047673 Bacteria 1480
273 Ga0495602_0136760 3300048088 Unclassified 1945
274 Ga0496100_0140666 3300048903 Bacteria 1710
275 Ga0496101_0722190 3300048904 Bacteria 786
276 Ga0496102_0305521 3300048905 Bacteria 1499
277 Ga0496103_0038160 3300048906 Bacteria 2946
278 Ga0496104_0017791 3300048907 Bacteria 6481
279 Ga0496106_0396965 3300048909 Bacteria 1108
280 Ga0496106_1569034 3300048909 Bacteria 505
281 Ga0496107_0000526 3300048910 Bacteria 21321
282 Ga0496108_0203824 3300048911 Bacteria 1716
283 Ga0496109_0754454 3300048912 Unclassified 911
284 Ga0496110_0188297 3300048913 Unclassified 1874
285 Ga0496110_1388757 3300048913 Bacteria 612
286 Ga0496112_0024631 3300048915 Bacteria 5767
287 Ga0496112_0701124 3300048915 Unclassified 940
288 Ga0496113_0003207 3300048916 Bacteria 9748
289 Ga0496114_0408013 3300048917 Bacteria 1203
290 Ga0496114_0599913 3300048917 Bacteria 971
291 Ga0496114_1187541 3300048917 Unclassified 649
292 Ga0496114_1613499 3300048917 Bacteria 537
293 Ga0496115_0242177 3300048918 Unclassified 1486
294 Ga0496115_0968983 3300048918 Unclassified 652
295 Ga0496115_1126318 3300048918 Bacteria 593
296 Ga0501032_0221611 3300049569 Bacteria 1231
297 Ga0501033_0619549 3300049570 Bacteria 741
298 Ga0501034_0484591 3300049571 Bacteria 1152
299 Ga0501036_0069939 3300049572 Bacteria 2968
300 Ga0501037_0399723 3300049573 Bacteria 942
301 Ga0501038_0094201 3300049574 Bacteria 2504
302 Ga0501039_0032155 3300049575 Bacteria 4044
303 Ga0501039_0266449 3300049575 Bacteria 1346
304 Ga0501040_0039067 3300049576 Bacteria 3227
305 Ga0501040_0242670 3300049576 Bacteria 1284
306 Ga0501042_0009829 3300049578 Bacteria 6390
307 Ga0501043_0635338 3300049579 Bacteria 785
308 Ga0501043_0682280 3300049579 Bacteria 752
309 Ga0501048_0128888 3300049582 Bacteria 1789
310 Ga0501048_0992302 3300049582 Bacteria 604
311 Ga0501067_0044549 3300049583 Bacteria 2465
312 Ga0501068_0303753 3300049584 Bacteria 1022
313 Ga0501069_0298941 3300049585 Bacteria 944
314 Ga0501070_0447252 3300049586 Bacteria 1042
315 Ga0501070_0614244 3300049586 Bacteria 866
316 Ga0501071_0053638 3300049587 Bacteria 2908
317 Ga0501071_0259183 3300049587 Bacteria 1313
318 Ga0501071_0716509 3300049587 Bacteria 770
319 Ga0501072_0043704 3300049588 Bacteria 3522
320 Ga0501072_0193846 3300049588 Bacteria 1620
321 Ga0501074_0125600 3300049590 Bacteria 1835
322 Ga0501075_0165263 3300049591 Bacteria 1688
323 Ga0501075_0285851 3300049591 Bacteria 1256
324 Ga0501076_0036238 3300049592 Bacteria 3864
325 Ga0501076_0151714 3300049592 Bacteria 1885
326 Ga0501076_1168982 3300049592 Bacteria 633
327 Ga0501077_0096211 3300049593 Bacteria 1877
328 Ga0501077_0114352 3300049593 Bacteria 1711
329 Ga0501079_0291408 3300049741 Bacteria 1276
330 Ga0501079_0307867 3300049741 Bacteria 1239
331 Ga0501080_0289373 3300049742 Bacteria 1488
332 Ga0501080_0443866 3300049742 Bacteria 1164
333 Ga0501081_0348837 3300049743 Bacteria 1091
334 Ga0501083_0321733 3300049744 Bacteria 1006
335 Ga0501035_0637460 3300049822 Bacteria 865
336 Ga0501044_0519933 3300049823 Bacteria 1090
337 Ga0501045_0062132 3300049824 Bacteria 2740
338 Ga0501045_0073778 3300049824 Bacteria 2513
339 nmdc:mga05p37_1580366_c1 3300050507 Bacteria 647
340 nmdc:mga0rr50_883366_c1 3300050513 Bacteria 762
341 Ga0495601_0032707 3300053077 Bacteria 3239
342 Ga0495595_0017559 3300053084 Bacteria 3079
343 Ga0495619_0025995 3300053085 Bacteria 3763
344 Ga0501084_0142381 3300054114 Bacteria 2019
345 Ga0501084_0156882 3300054114 Bacteria 1919
346 Ga0587073_0075311 3300059492 Unclassified 825
347 Ga0587082_172293 3300059504 Unclassified 525
348 Ga0587083_0061731 3300059505 Unclassified 847
349 Ga0587083_0087433 3300059505 Bacteria 754
350 Ga0587106_056085 3300059605 Bacteria 712
351 Ga0587075_140816 3300059644 Bacteria 515
352 Ga0587114_121560 3300059655 Bacteria 529
353 Ga0587071_070632 3300060344 Unclassified 760
354 Ga0501082_0044765 3300060353 Bacteria 3817
355 Ga0501082_0354409 3300060353 Bacteria 1279
356 Ga0501082_0506380 3300060353 Bacteria 1055
357 Ga0466962_0074775 3300061719 Bacteria 1619
358 Ga0466962_0625273 3300061719 Unclassified 550
359 Ga0530510_0037771 3300061734 Bacteria 3484
360 Ga0530510_0088916 3300061734 Bacteria 2252
361 Ga0466961_0112979
362 LJNas_1029396
363 Ga0070683_100329142
364 Ga0070683_102121045
365 Ga0070680_100308712
366 Ga0070668_100121546
367 Ga0070674_100830146
368 Ga0070659_102082332
369 Ga0070667_100406274
370 Ga0070709_10183565
371 Ga0070709_10211218
372 Ga0070714_100002529
373 Ga0070714_100205935
374 Ga0070714_100255252
375 Ga0070714_100387289
376 Ga0070714_101085523
377 Ga0070714_101087244
378 Ga0070714_101881508
379 Ga0070713_100042438
380 Ga0070713_100143214
381 Ga0070713_100256564
382 Ga0070710_10021342
383 Ga0070710_10248409
384 Ga0070710_11264616
385 Ga0070711_100012144
386 Ga0070711_100207727
387 Ga0070678_102068190
388 Ga0070681_11362927
389 Ga0070685_10430306
390 Ga0070685_10635699
391 Ga0070684_100161516
392 Ga0070684_100885392
393 Ga0070672_100976431
394 Ga0070693_100474418
395 Ga0070665_100008226
396 Ga0070664_100593432
397 Ga0068856_101301941
398 Ga0068852_101723541
399 Ga0068866_10404002
400 Ga0081455_10420986
401 Ga0081538_10001106
402 Ga0081539_10002591
403 Ga0081539_10042807
404 Ga0070717_10030019
405 Ga0070717_10091829
406 Ga0070717_10106750
407 Ga0070717_10626674
408 Ga0070715_10029137
409 Ga0070716_100256013
410 Ga0070716_100457349
411 Ga0070712_100010461
412 Ga0070712_100607268
413 Ga0068871_101937798
414 Ga0075434_100292905
415 Ga0075434_100706724
416 Ga0068865_100267775
417 Ga0068865_100581895
418 Ga0068865_101717210
419 Ga0105240_12091178
420 Ga0105245_12834911
421 Ga0105243_11523722
422 Ga0105241_11246732
423 Ga0105242_10809311
424 Ga0105248_10566481
425 Ga0105237_12027850
426 Ga0105249_10437506
427 Ga0105249_11627048
428 Ga0157369_11129744
429 Ga0157374_11405455
430 Ga0157374_11447995
431 Ga0163162_11353225
432 Ga0157372_11571470
433 Ga0163163_11441218
434 Ga0157380_11408646
435 Ga0182008_10288905
436 Ga0163161_10740476
437 Ga0197907_11187738
438 Ga0206353_10440907
439 Ga0213873_10017156
440 Ga0213873_10032622
441 Ga0213874_10000122
442 Ga0213874_10051072
443 Ga0213876_10062594
444 Ga0213876_10106286
445 Ga0213876_10241932
446 Ga0213875_10058369
447 Ga0213875_10363064
448 Ga0224712_10091749
449 Ga0224712_10220418
450 Ga0207692_10040966
451 Ga0207692_10630772
452 Ga0207685_10043686
453 Ga0207699_10085152
454 Ga0207699_10093581
455 Ga0207699_10438099
456 Ga0207707_11002430
457 Ga0207693_10003619
458 Ga0207693_10150998
459 Ga0207693_10198319
460 Ga0207663_10013869
461 Ga0207663_10232637
462 Ga0207663_10327287
463 Ga0207652_10177231
464 Ga0207650_11360374
465 Ga0207700_10052023
466 Ga0207700_10596044
467 Ga0207664_10003270
468 Ga0207664_10020267
469 Ga0207664_10030383
470 Ga0207664_10110437
471 Ga0207664_11154745
472 Ga0207690_11609333
473 Ga0207706_11400964
474 Ga0207686_10655425
475 Ga0207669_11356111
476 Ga0207704_10255136
477 Ga0207665_10049904
478 Ga0207665_10255665
479 Ga0207665_11388266
480 Ga0207661_10175887
481 Ga0207661_11721646
482 Ga0207661_12150269
483 Ga0207679_11018571
484 Ga0207712_10287262
485 Ga0207668_10216802
486 Ga0207677_11207365
487 Ga0207639_10426481
488 Ga0207702_11304066
489 Ga0207648_11360162
490 Ga0207675_100462942
491 Ga0268266_10051609
492 Ga0307406_10559878
493 Ga0307406_11134971
494 Ga0307412_10809747
495 Ga0307412_11104759
496 Ga0307409_100750445
497 Ga0307409_101257427
498 Ga0307409_102519272
499 Ga0307416_100801237
500 Ga0307416_101499597
501 Ga0307415_101016048
502 Ga0373945_0123357
503 Ga0373953_0329859
504 Ga0373954_0049040
505 Ga0373935_0729002
506 Ga0373927_0287636
507 Ga0373933_0069823
508 Ga0373937_0035375
509 Ga0395898_0019693
510 Ga0436364_0018642
511 Ga0436364_0445774
512 Ga0436364_1463516
513 Ga0395901_0061069
514 Ga0395901_1590719
515 Ga0436365_0131866
516 Ga0436365_0356386
517 Ga0436365_0451312
518 Ga0436365_1022153
519 Ga0436365_1404890
520 Ga0436363_0328768
521 Ga0436363_0335334
522 Ga0436363_0466053
523 Ga0436363_0735149
524 Ga0436363_0983181
525 Ga0436363_1253158
526 Ga0436363_1717305
527 Ga0436362_0182869
528 Ga0436362_0470525
529 Ga0436362_0489362
530 Ga0436362_0495269
531 Ga0436362_0822266
532 Ga0451789_1096168
533 Ga0466969_0033265
534 Ga0466965_0166091
535 Ga0466965_0244163
536 Ga0466965_0729920
537 Ga0466966_0150093
538 Ga0466966_0177261
539 Ga0466966_0201071
540 Ga0466966_0490465
541 Ga0466966_0764080
542 Ga0466961_0060168
543 Ga0466961_0114792
544 Ga0466961_0209426
545 Ga0466961_0236976
546 Ga0466961_0304887
547 Ga0466963_0002963
548 Ga0466963_0006690
549 Ga0466963_0189249
550 Ga0466963_0423006
551 Ga0466963_0446566
552 Ga0466964_0255396
553 Ga0466968_0053552
554 Ga0466968_0099933
555 Ga0466968_0174576
556 Ga0466968_0199758
557 Ga0466968_0201580
558 Ga0466968_0278872
559 Ga0466968_0415115
560 Ga0466968_0445686
561 Ga0466970_0641327
562 Ga0466970_0875084
563 Ga0466957_0146421
564 Ga0466957_0149789
565 Ga0466957_0301906
566 Ga0466957_0782604
567 Ga0466957_0801896
568 Ga0466960_0051895
569 Ga0466960_0135190
570 Ga0466960_0181772
571 Ga0466960_0199529
572 Ga0466959_0013746
573 Ga0466959_0045358
574 Ga0466959_0186027
575 Ga0466959_0457049
576 Ga0466959_0504679
577 Ga0466959_0543926
578 Ga0466959_0547782
579 Ga0466959_1018547
580 Ga0466958_0045378
581 Ga0466958_0048573
582 Ga0466958_0179482
583 Ga0466958_0229921
584 Ga0466958_0346791
585 Ga0466958_0410770
586 Ga0466958_0446753
587 Ga0466967_0001605
588 Ga0466967_0009571
589 Ga0466967_0103928
590 Ga0466967_0112337
591 Ga0466967_0339393
592 Ga0466967_0847386
593 Ga0466967_0900588
594 Ga0466967_0944956
595 Ga0495592_0019699
596 Ga0495590_0085214
597 Ga0495629_0511421
598 Ga0495651_0022651
599 Ga0495651_0244801
600 Ga0495653_0101172
601 Ga0495580_0431795
602 Ga0495662_0581377
603 Ga0495664_0101601
604 Ga0495608_0038854
605 Ga0495618_0089969
606 Ga0495628_0167592
607 Ga0495628_0361358
608 Ga0495630_0531979
609 Ga0495630_1336004
610 Ga0495643_0228459
611 Ga0495652_0049756
612 Ga0495640_0596123
613 Ga0495587_0245404
614 Ga0495667_0000840
615 Ga0495634_0329951
616 Ga0495635_0303370
617 Ga0495588_0592797
618 Ga0495657_0087230
619 Ga0495599_0038813
620 Ga0495646_0030681
621 Ga0495647_0295523
622 Ga0495624_0176211
623 Ga0495600_0673192
624 Ga0495604_0061738
625 Ga0495674_0011695
626 Ga0495674_0772893
627 Ga0495676_0322952
628 Ga0495680_0148485
629 Ga0495680_0530359
630 Ga0495684_0009191
631 Ga0495684_0065457
632 Ga0495593_0100931
633 Ga0495602_0136760
634 Ga0496100_0140666
635 Ga0496101_0722190
636 Ga0496102_0305521
637 Ga0496103_0038160
638 Ga0496104_0017791
639 Ga0496106_0396965
640 Ga0496106_1569034
641 Ga0496107_0000526
642 Ga0496108_0203824
643 Ga0496109_0754454
644 Ga0496110_0188297
645 Ga0496110_1388757
646 Ga0496112_0024631
647 Ga0496112_0701124
648 Ga0496113_0003207
649 Ga0496114_0408013
650 Ga0496114_0599913
651 Ga0496114_1187541
652 Ga0496114_1613499
653 Ga0496115_0242177
654 Ga0496115_0968983
655 Ga0496115_1126318
656 Ga0501032_0221611
657 Ga0501033_0619549
658 Ga0501034_0484591
659 Ga0501036_0069939
660 Ga0501037_0399723
661 Ga0501038_0094201
662 Ga0501039_0032155
663 Ga0501039_0266449
664 Ga0501040_0039067
665 Ga0501040_0242670
666 Ga0501042_0009829
667 Ga0501043_0635338
668 Ga0501043_0682280
669 Ga0501048_0128888
670 Ga0501048_0992302
671 Ga0501067_0044549
672 Ga0501068_0303753
673 Ga0501069_0298941
674 Ga0501070_0447252
675 Ga0501070_0614244
676 Ga0501071_0053638
677 Ga0501071_0259183
678 Ga0501071_0716509
679 Ga0501072_0043704
680 Ga0501072_0193846
681 Ga0501074_0125600
682 Ga0501075_0165263
683 Ga0501075_0285851
684 Ga0501076_0036238
685 Ga0501076_0151714
686 Ga0501076_1168982
687 Ga0501077_0096211
688 Ga0501077_0114352
689 Ga0501079_0291408
690 Ga0501079_0307867
691 Ga0501080_0289373
692 Ga0501080_0443866
693 Ga0501081_0348837
694 Ga0501083_0321733
695 Ga0501035_0637460
696 Ga0501044_0519933
697 Ga0501045_0062132
698 Ga0501045_0073778
699 nmdc:mga05p37_1580366_c1
700 nmdc:mga0rr50_883366_c1
701 Ga0495601_0032707
702 Ga0495595_0017559
703 Ga0495619_0025995
704 Ga0501084_0142381
705 Ga0501084_0156882
706 Ga0587073_0075311
707 Ga0587082_172293
708 Ga0587083_0061731
709 Ga0587083_0087433
710 Ga0587106_056085
711 Ga0587075_140816
712 Ga0587114_121560
713 Ga0587071_070632
714 Ga0501082_0044765
715 Ga0501082_0354409
716 Ga0501082_0506380
717 Ga0466962_0074775
718 Ga0466962_0625273
719 Ga0530510_0037771
720 Ga0530510_0088916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1z-assembly2.cif.gz_I crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin 0.8729 57 81
4s1z-assembly1.cif.gz_G crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin 0.8683 57 82
4s1z-assembly5.cif.gz_H crystal structure of trabid nzf1 in complex with k29 linked di-ubiquitin 0.8656 57 82
4owf-assembly1.cif.gz_G crystal structure of the nemo cozi in complex with hoip nzf1 domain 0.8576 57 80
5af6-assembly1.cif.gz_H structure of lys33-linked diub bound to trabid nzf1 0.8532 57 82
ID Description Score Start End Superfamily
4nb5B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9418 10 38 1.10.10.10
af_Q54UQ6_98_225_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.8939 57 85 1.10.287.110
af_Q6ERE5_80_240_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8617 7 47 1.20.1260.10
af_A0A1D6LT02_190_443_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8498 7 42 1.20.1530.20
af_Q9P6J2_71_223_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8449 7 44 1.20.1260.10
ID Description Score Start End GO Terms
AF-K4Z7E0-F1-model_v4 deleted 0.9335 57 82
AF-A0A5E6NNP3-F1-model_v4 DUF637 domain-containing protein 0.9325 7 47
AF-A0A483ALF5-F1-model_v4 Glucokinase 0.9257 10 42
AF-A0A5E6NMT0-F1-model_v4 Uncharacterized protein 0.9252 10 42
AF-A0A5E5PSA4-F1-model_v4 Rhs family protein-like 0.9223 10 42 GO:0016020

Map