metagRoot

F421898

General Info

Members	Datasets	Scaffolds	Average Seq Length
360	256	352	88

Family's Representative Sequence

Representative Sequence	3300025933\|Ga0207706_10146815\|Ga0207706_101468153
Length	95
Sequence	MKLVFSSRAWEDYLHWQGDDRRGLERVNALIKECLRDPFRGTGKPEPLSGNLSGWWSRRINREHRLVYRVSGKDDAQALEMELANGEDWHIVIVA

Samples

	Sample ID	Description	Type	Environment
1	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
2	2643221588	Altererythrobacter sp. Root672	Isolate	Unclassified
3	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
4	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
5	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
6	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
7	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
8	2898795034	Rhodobacter sp. SGA-6-6	Isolate	Rhizosphere
9	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
10	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
11	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
12	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
13	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
14	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
15	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
16	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
17	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
18	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
19	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
20	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
21	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
26	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
27	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
28	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
29	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
30	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
33	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
36	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
37	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
38	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
39	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
40	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
41	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
42	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
43	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
44	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
45	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
46	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
47	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
48	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
49	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
50	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
51	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
52	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
53	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
54	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
55	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
56	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
57	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
58	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
59	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
60	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
61	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
62	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
63	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
64	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
65	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
66	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
67	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
68	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
69	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
70	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
71	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
72	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
73	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
108	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
109	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
112	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
113	3300031018	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
114	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
115	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
116	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
117	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
118	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
119	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
120	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
121	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
122	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
123	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
124	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
125	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
126	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
127	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
128	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
129	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
130	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
131	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
132	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
133	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
134	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
135	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
136	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
137	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
138	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
139	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
140	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
141	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
142	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
143	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
144	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
145	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
146	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
147	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
148	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
149	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
150	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
151	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
152	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
153	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
154	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
155	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
156	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
157	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
158	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
159	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
160	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
161	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
162	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
163	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
164	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
165	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
166	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
167	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
168	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
169	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
170	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
171	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
172	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
173	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
174	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
175	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
176	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
177	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
178	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
179	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
180	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
181	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
182	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
183	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
184	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
185	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
186	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
187	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
188	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
189	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
190	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
191	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
192	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
193	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
194	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
195	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
196	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
197	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
198	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
199	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
200	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
201	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
202	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
203	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
204	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
205	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
206	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
207	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
208	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
216	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
218	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
219	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
220	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
221	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
222	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
223	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049850	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control	Metagenome	Rhizosphere
227	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
228	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
229	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
230	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
231	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
232	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
233	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
234	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
235	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
236	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
237	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
238	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
239	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
240	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
241	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
242	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
243	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
244	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
245	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
246	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
247	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
248	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
249	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
250	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
251	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
252	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
253	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
254	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
255	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
256	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.5
Metatranscriptomes	0.28
Isolates	2.22

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.83
Nodule	0.83
Rhizoplane	6.11
Rhizosphere	71.39
Stem	0
Stem Tuber	0
Unclassified	10.83

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24747J21853_1017740	3300001978	Bacteria	760
2	JGI24744J21845_10003363	3300002077	Bacteria	3285
3	Ga0055525_1000139	3300003759	Bacteria	102623
4	Ga0065165_1040146	3300005262	Bacteria	1398
5	Ga0070658_10973895	3300005327	Bacteria	738
6	Ga0070676_10315565	3300005328	Bacteria	1064
7	Ga0070683_101878027	3300005329	Unclassified	576
8	Ga0070670_100793999	3300005331	Bacteria	855
9	Ga0070666_10420527	3300005335	Bacteria	962
10	Ga0068868_100026949	3300005338	Bacteria	4382
11	Ga0070660_100001694	3300005339	Bacteria	15120
12	Ga0070660_100131817	3300005339	Bacteria	2000
13	Ga0070692_10681621	3300005345	Bacteria	689
14	Ga0070675_100097344	3300005354	Bacteria	2474
15	Ga0070675_102094772	3300005354	Bacteria	521
16	Ga0070674_100000483	3300005356	Bacteria	20099
17	Ga0070674_100621100	3300005356	Bacteria	916
18	Ga0070674_101764481	3300005356	Bacteria	560
19	Ga0070673_100331358	3300005364	Bacteria	1347
20	Ga0070673_100690346	3300005364	Bacteria	937
21	Ga0070659_100000032	3300005366	Bacteria	120241
22	Ga0070659_101915634	3300005366	Bacteria	532
23	Ga0070667_100863251	3300005367	Bacteria	842
24	Ga0070709_10037310	3300005434	Bacteria	2967
25	Ga0070714_100245543	3300005435	Bacteria	1654
26	Ga0070710_10639106	3300005437	Unclassified	745
27	Ga0070663_101150197	3300005455	Bacteria	680
28	Ga0070678_100001925	3300005456	Bacteria	11196
29	Ga0068867_102401385	3300005459	Bacteria	502
30	Ga0070706_100886006	3300005467	Bacteria	825
31	Ga0070684_100598537	3300005535	Bacteria	1025
32	Ga0068853_100301389	3300005539	Bacteria	1481
33	Ga0068853_101240720	3300005539	Bacteria	720
34	Ga0070672_100665547	3300005543	Bacteria	910
35	Ga0070665_100000317	3300005548	Bacteria	74997
36	Ga0070665_100781834	3300005548	Bacteria	968
37	Ga0070665_102624500	3300005548	Bacteria	504
38	Ga0068855_100400643	3300005563	Bacteria	1504
39	Ga0068855_101383234	3300005563	Bacteria	726
40	Ga0068857_100028071	3300005577	Bacteria	4965
41	Ga0068857_102162374	3300005577	Bacteria	546
42	Ga0068854_100010640	3300005578	Bacteria	5969
43	Ga0068852_101299590	3300005616	Bacteria	749
44	Ga0068862_101422380	3300005844	Bacteria	697
45	Ga0070717_10103259	3300006028	Bacteria	2423
46	Ga0070717_10736777	3300006028	Bacteria	896
47	Ga0070716_100232744	3300006173	Bacteria	1245
48	Ga0070716_100345785	3300006173	Bacteria	1051
49	Ga0075369_10258812	3300006186	Bacteria	809
50	Ga0075366_10066606	3300006195	Bacteria	2143
51	Ga0075370_10197532	3300006353	Bacteria	1186
52	Ga0075434_100005100	3300006871	Bacteria	11927
53	Ga0105244_10157867	3300009036	Bacteria	1084
54	Ga0105240_10001331	3300009093	Bacteria	42512
55	Ga0105247_10744978	3300009101	Bacteria	742
56	Ga0105243_10001132	3300009148	Bacteria	24182
57	Ga0105243_10593392	3300009148	Bacteria	1065
58	Ga0105241_10901027	3300009174	Bacteria	821
59	Ga0105242_10695696	3300009176	Bacteria	994
60	Ga0105248_10042465	3300009177	Bacteria	5100
61	Ga0105248_10334498	3300009177	Unclassified	1705
62	Ga0105237_10006917	3300009545	Bacteria	12510
63	Ga0105238_10014287	3300009551	Bacteria	8025
64	Ga0105238_11516151	3300009551	Bacteria	699
65	Ga0105238_12917080	3300009551	Bacteria	514
66	Ga0105249_10866411	3300009553	Bacteria	969
67	Ga0105239_10000271	3300010375	Bacteria	76812
68	Ga0105239_10160777	3300010375	Bacteria	2509
69	Ga0157373_10774533	3300013100	Bacteria	706
70	Ga0157369_10072235	3300013105	Bacteria	3703
71	Ga0157369_10842192	3300013105	Bacteria	942
72	Ga0157369_11201108	3300013105	Bacteria	774
73	Ga0157374_10234264	3300013296	Bacteria	1804
74	Ga0157374_10464135	3300013296	Bacteria	1268
75	Ga0157378_11272126	3300013297	Bacteria	776
76	Ga0157372_10717818	3300013307	Bacteria	1163
77	Ga0157372_11033189	3300013307	Bacteria	951
78	Ga0157372_11752135	3300013307	Bacteria	714
79	Ga0157375_11500857	3300013308	Unclassified	795
80	Ga0157375_12176890	3300013308	Unclassified	660
81	Ga0157375_12544837	3300013308	Bacteria	611
82	Ga0182008_10045333	3300014497	Bacteria	2186
83	Ga0213874_10455037	3300021377	Bacteria	506
84	Ga0213876_10001580	3300021384	Bacteria	14004
85	Ga0213875_10354100	3300021388	Bacteria	697
86	Ga0213871_10046568	3300021441	Unclassified	1177
87	Ga0224572_1013190	3300024225	Bacteria	1575
88	Ga0209563_100070	3300025230	Bacteria	249779
89	Ga0209026_1016931	3300025250	Bacteria	1173
90	Ga0207692_10265348	3300025898	Bacteria	1034
91	Ga0207688_10420898	3300025901	Bacteria	830
92	Ga0207647_10017043	3300025904	Bacteria	4945
93	Ga0207705_10305644	3300025909	Bacteria	1220
94	Ga0207705_11021407	3300025909	Bacteria	638
95	Ga0207684_11229003	3300025910	Bacteria	619
96	Ga0207695_10004839	3300025913	Bacteria	18183
97	Ga0207671_10001194	3300025914	Bacteria	30831
98	Ga0207657_10004276	3300025919	Bacteria	15131
99	Ga0207657_10097986	3300025919	Bacteria	2437
100	Ga0207649_10081034	3300025920	Bacteria	2101
101	Ga0207694_10041588	3300025924	Bacteria	3542
102	Ga0207694_10130851	3300025924	Bacteria	2011
103	Ga0207650_10490546	3300025925	Bacteria	1026
104	Ga0207659_10054132	3300025926	Bacteria	2865
105	Ga0207664_10014649	3300025929	Bacteria	5670
106	Ga0207644_10154479	3300025931	Bacteria	1778
107	Ga0207644_11488282	3300025931	Unclassified	568
108	Ga0207690_10000001	3300025932	Bacteria	807539
109	Ga0207706_10146815	3300025933	Bacteria	2075
110	Ga0207706_10590388	3300025933	Unclassified	955
111	Ga0207686_10218408	3300025934	Bacteria	1375
112	Ga0207709_10000005	3300025935	Bacteria	806813
113	Ga0207669_10008360	3300025937	Bacteria	4853
114	Ga0207669_11309719	3300025937	Bacteria	615
115	Ga0207665_10086369	3300025939	Bacteria	2166
116	Ga0207691_10592656	3300025940	Bacteria	939
117	Ga0207711_10003539	3300025941	Bacteria	13523
118	Ga0207711_10207711	3300025941	Bacteria	1788
119	Ga0207661_11071074	3300025944	Bacteria	742
120	Ga0207667_10367795	3300025949	Bacteria	1466
121	Ga0207667_10379621	3300025949	Bacteria	1440
122	Ga0207651_10241185	3300025960	Bacteria	1473
123	Ga0207651_10298937	3300025960	Bacteria	1338
124	Ga0207651_10484885	3300025960	Bacteria	1066
125	Ga0207712_10552048	3300025961	Bacteria	991
126	Ga0207668_10983409	3300025972	Bacteria	754
127	Ga0207640_10007871	3300025981	Bacteria	5880
128	Ga0207658_10461170	3300025986	Bacteria	1126
129	Ga0207677_10000176	3300026023	Bacteria	50717
130	Ga0207639_11860049	3300026041	Bacteria	563
131	Ga0207674_10068684	3300026116	Bacteria	3566
132	Ga0207683_10005199	3300026121	Bacteria	11175
133	Ga0207683_11659358	3300026121	Bacteria	588
134	Ga0207698_10092790	3300026142	Bacteria	2476
135	Ga0207428_11071884	3300027907	Bacteria	564
136	Ga0265357_1000786	3300028023	Bacteria	2069
137	Ga0268266_10000388	3300028379	Bacteria	66871
138	Ga0268265_12193382	3300028380	Bacteria	559
139	Ga0307517_10124468	3300028786	Unclassified	1888
140	Ga0307517_10345696	3300028786	Unclassified	810
141	Ga0265338_10464302	3300028800	Unclassified	895
142	Ga0265773_1011253	3300031018	Bacteria	767
143	Ga0307408_100135640	3300031548	Bacteria	1925
144	Ga0307408_100613752	3300031548	Bacteria	968
145	Ga0307516_10112408	3300031730	Bacteria	2524
146	Ga0307405_10095523	3300031731	Bacteria	1979
147	Ga0307405_10132166	3300031731	Bacteria	1726
148	Ga0307413_10429203	3300031824	Bacteria	1043
149	Ga0307413_10476173	3300031824	Bacteria	997
150	Ga0307413_10813097	3300031824	Bacteria	786
151	Ga0307410_10559614	3300031852	Bacteria	949
152	Ga0307407_10185455	3300031903	Bacteria	1382
153	Ga0307407_10484390	3300031903	Bacteria	904
154	Ga0307412_10031611	3300031911	Bacteria	3345
155	Ga0307412_10144591	3300031911	Unclassified	1746
156	Ga0307412_10175678	3300031911	Bacteria	1605
157	Ga0307412_11473162	3300031911	Bacteria	618
158	Ga0307409_100039127	3300031995	Bacteria	3516
159	Ga0307409_100290403	3300031995	Bacteria	1516
160	Ga0307409_100770631	3300031995	Bacteria	967
161	Ga0307416_100104352	3300032002	Bacteria	2478
162	Ga0307416_100105104	3300032002	Bacteria	2470
163	Ga0307414_10128365	3300032004	Bacteria	1963
164	Ga0307411_10359689	3300032005	Bacteria	1190
165	Ga0307411_10602157	3300032005	Bacteria	945
166	Ga0307415_100038546	3300032126	Bacteria	3151
167	Ga0307415_100038587	3300032126	Bacteria	3149
168	Ga0307415_100107141	3300032126	Bacteria	2064
169	Ga0307415_102168493	3300032126	Bacteria	543
170	Ga0307510_10148018	3300033180	Bacteria	1975
171	Ga0373945_0092911	3300035116	Bacteria	1170
172	Ga0373943_0152013	3300035170	Bacteria	1255
173	Ga0373935_0015614	3300035692	Bacteria	4593
174	Ga0373927_0229516	3300035695	Bacteria	1219
175	Ga0373947_0021163	3300035725	Bacteria	3763
176	Ga0373947_0506373	3300035725	Bacteria	821
177	Ga0373925_0022391	3300037068	Bacteria	4608
178	Ga0436364_0238769	3300037853	Bacteria	2642
179	Ga0395901_0144817	3300038443	Bacteria	2498
180	Ga0395901_0733886	3300038443	Bacteria	982
181	Ga0436365_0449657	3300039437	Bacteria	710
182	Ga0436365_0857765	3300039437	Bacteria	1348
183	Ga0436365_1312492	3300039437	Bacteria	36510
184	Ga0436365_1889063	3300039437	Bacteria	2948
185	Ga0436365_1936118	3300039437	Bacteria	822
186	Ga0436360_1186917	3300039438	Bacteria	2618
187	Ga0436363_0069258	3300039450	Bacteria	784
188	Ga0436363_1442690	3300039450	Bacteria	618
189	Ga0436362_0365673	3300039453	Bacteria	2161
190	Ga0439465_0089765	3300041413	Bacteria	1050
191	Ga0451800_1262866	3300041459	Bacteria	659
192	Ga0439448_0311480	3300042005	Bacteria	559
193	Ga0439434_0140869	3300042435	Bacteria	795
194	Ga0466972_0317018	3300044658	Bacteria	728
195	Ga0466968_0166767	3300044735	Bacteria	1019
196	Ga0466968_0534432	3300044735	Bacteria	587
197	Ga0466960_0309048	3300044901	Bacteria	893
198	Ga0495638_0000731	3300046460	Bacteria	35358
199	Ga0495650_0010259	3300046471	Bacteria	5241
200	Ga0495662_0138624	3300046476	Bacteria	1197
201	Ga0495664_0340758	3300046477	Bacteria	903
202	Ga0495584_0052588	3300046491	Bacteria	2050
203	Ga0495585_0230187	3300046492	Bacteria	932
204	Ga0495594_0860912	3300046499	Unclassified	510
205	Ga0495583_0002358	3300046506	Bacteria	16323
206	Ga0495583_0037275	3300046506	Bacteria	2306
207	Ga0495583_0040307	3300046506	Bacteria	2195
208	Ga0495583_0113324	3300046506	Bacteria	1147
209	Ga0495606_0007432	3300046507	Bacteria	9812
210	Ga0495610_0033509	3300046512	Bacteria	2655
211	Ga0495616_0388063	3300046513	Bacteria	576
212	Ga0495630_0357343	3300046517	Bacteria	1118
213	Ga0495631_0126218	3300046518	Bacteria	1100
214	Ga0495637_0015674	3300046520	Bacteria	3554
215	Ga0495643_0061582	3300046522	Bacteria	1989
216	Ga0495643_0132196	3300046522	Bacteria	1252
217	Ga0495643_0346215	3300046522	Bacteria	666
218	Ga0495648_0092702	3300046524	Bacteria	1686
219	Ga0495663_0001846	3300046525	Bacteria	6531
220	Ga0495640_0244847	3300046533	Bacteria	1124
221	Ga0495622_0254222	3300046557	Bacteria	772
222	Ga0495667_0790237	3300046559	Unclassified	585
223	Ga0495668_0342733	3300046616	Bacteria	820
224	Ga0495634_0071837	3300046642	Bacteria	2277
225	Ga0495611_0016361	3300046648	Bacteria	3171
226	Ga0495611_0044388	3300046648	Bacteria	1988
227	Ga0495625_0017622	3300046660	Bacteria	5589
228	Ga0495625_0040517	3300046660	Bacteria	3396
229	Ga0495625_0351534	3300046660	Bacteria	931
230	Ga0495625_0649385	3300046660	Bacteria	628
231	Ga0495661_0271683	3300046665	Unclassified	857
232	Ga0495624_0210582	3300046690	Bacteria	1179
233	Ga0495671_0217621	3300046692	Bacteria	925
234	Ga0495649_0030503	3300046694	Bacteria	2978
235	Ga0495649_0517900	3300046694	Bacteria	592
236	Ga0495600_0068983	3300046809	Bacteria	2311
237	Ga0495636_0468567	3300047318	Unclassified	606
238	Ga0495674_0199290	3300047319	Bacteria	1661
239	Ga0495683_0008964	3300047323	Bacteria	5338
240	Ga0495687_000499	3300047443	Bacteria	47300
241	Ga0495687_001696	3300047443	Bacteria	19624
242	Ga0495677_0248656	3300047445	Bacteria	695
243	Ga0495673_0084792	3300047469	Bacteria	1305
244	Ga0495681_0008159	3300047470	Bacteria	6592
245	Ga0495686_0280948	3300047472	Unclassified	925
246	Ga0495614_0571427	3300048089	Bacteria	542
247	Ga0496101_0084413	3300048904	Bacteria	2352
248	Ga0496101_0156255	3300048904	Bacteria	1747
249	Ga0496101_1340643	3300048904	Bacteria	559
250	Ga0496102_0000022	3300048905	Bacteria	246314
251	Ga0496102_0040747	3300048905	Bacteria	4203
252	Ga0496103_0000075	3300048906	Bacteria	114569
253	Ga0496103_0101006	3300048906	Bacteria	1826
254	Ga0496104_0193531	3300048907	Bacteria	1946
255	Ga0496105_0021589	3300048908	Bacteria	5211
256	Ga0496106_0503174	3300048909	Bacteria	973
257	Ga0496107_0259453	3300048910	Bacteria	1293
258	Ga0496110_0035849	3300048913	Bacteria	4307
259	Ga0496111_0016874	3300048914	Bacteria	5039
260	Ga0496112_1302057	3300048915	Unclassified	642
261	Ga0496113_0329504	3300048916	Bacteria	1224
262	Ga0496113_1125786	3300048916	Bacteria	615
263	Ga0496114_0036720	3300048917	Bacteria	4050
264	Ga0496114_0590373	3300048917	Bacteria	980
265	Ga0496115_0017647	3300048918	Bacteria	5463
266	Ga0496115_0017872	3300048918	Bacteria	5431
267	Ga0496115_1422569	3300048918	Unclassified	511
268	Ga0496116_0126881	3300048919	Bacteria	1463
269	Ga0496117_0010437	3300048920	Bacteria	8467
270	Ga0496118_0000039	3300048921	Bacteria	305458
271	Ga0496118_0327368	3300048921	Bacteria	828
272	Ga0496119_0017347	3300048922	Bacteria	5418
273	Ga0496120_0043007	3300048923	Bacteria	2635
274	Ga0496121_0001414	3300048924	Bacteria	40691
275	Ga0496121_0007281	3300048924	Bacteria	13391
276	Ga0496121_0013716	3300048924	Bacteria	8685
277	Ga0496121_0024276	3300048924	Bacteria	5806
278	Ga0496121_0119970	3300048924	Bacteria	1988
279	Ga0496121_0583811	3300048924	Bacteria	693
280	Ga0496122_0057428	3300048925	Bacteria	2890
281	Ga0496123_0186963	3300048926	Bacteria	1075
282	Ga0496124_0000076	3300048927	Bacteria	215767
283	Ga0496125_0011759	3300048928	Bacteria	8724
284	Ga0496126_0023885	3300048929	Bacteria	5913
285	Ga0496126_0092887	3300048929	Bacteria	2650
286	Ga0496126_1109601	3300048929	Bacteria	587
287	Ga0501031_0645174	3300049568	Unclassified	680
288	Ga0501033_0046287	3300049570	Bacteria	3234
289	Ga0501033_0077730	3300049570	Bacteria	2435
290	Ga0501033_0344170	3300049570	Bacteria	1045
291	Ga0501036_0341234	3300049572	Bacteria	1251
292	Ga0501039_0445762	3300049575	Bacteria	1017
293	Ga0501043_0156200	3300049579	Bacteria	1784
294	Ga0501043_0549297	3300049579	Bacteria	858
295	Ga0501047_0062226	3300049581	Bacteria	3600
296	Ga0501048_0143628	3300049582	Bacteria	1688
297	Ga0501069_0163043	3300049585	Bacteria	1284
298	Ga0501070_0322910	3300049586	Bacteria	1255
299	Ga0501070_0444100	3300049586	Bacteria	1046
300	Ga0501070_0536466	3300049586	Bacteria	938
301	Ga0501198_046588	3300049649	Bacteria	763
302	Ga0501202_027168	3300049652	Bacteria	1175
303	Ga0501224_019423	3300049664	Bacteria	1012
304	Ga0501249_000229	3300049679	Bacteria	16831
305	Ga0501253_184251	3300049683	Bacteria	544
306	Ga0501259_017550	3300049688	Bacteria	1242
307	Ga0501080_0112239	3300049742	Bacteria	2527
308	Ga0501080_1359034	3300049742	Bacteria	607
309	Ga0501035_0077788	3300049822	Bacteria	2931
310	Ga0501035_0125961	3300049822	Bacteria	2236
311	Ga0501035_1250022	3300049822	Bacteria	574
312	Ga0501035_1356615	3300049822	Bacteria	546
313	Ga0501044_0024777	3300049823	Bacteria	6365
314	Ga0501044_0813436	3300049823	Bacteria	813
315	Ga0501204_000462	3300049850	Bacteria	3515
316	nmdc:mga0k408_39203_c1	3300050493	Bacteria	2721
317	nmdc:mga07m45_230165_c1	3300050496	Bacteria	1078
318	nmdc:mga0n895_169843_c1	3300050512	Bacteria	2213
319	Ga0495601_0403287	3300053077	Bacteria	886
320	Ga0500610_0000255	3300053079	Bacteria	16041
321	Ga0500635_0324180	3300053080	Bacteria	609
322	Ga0500644_0003890	3300053088	Bacteria	3718
323	Ga0500651_0026497	3300053093	Bacteria	3645
324	Ga0500566_0003016	3300053094	Bacteria	10069
325	Ga0500640_018737	3300053095	Bacteria	2958
326	Ga0500554_073743	3300053102	Bacteria	1115
327	Ga0500572_104228	3300053111	Bacteria	908
328	Ga0500592_000331	3300053116	Bacteria	8029
329	Ga0500607_000077	3300053121	Bacteria	71543
330	Ga0500607_032359	3300053121	Bacteria	2871
331	Ga0500614_155446	3300053123	Bacteria	690
332	Ga0500642_0040200	3300053130	Bacteria	2015
333	Ga0500658_0155319	3300053134	Bacteria	1033
334	Ga0500658_0169398	3300053134	Bacteria	991
335	Ga0500559_0002676	3300053136	Bacteria	9068
336	Ga0500559_0254379	3300053136	Bacteria	827
337	Ga0500564_158119	3300053138	Bacteria	961
338	Ga0500590_081143	3300053148	Bacteria	1593
339	Ga0500590_248249	3300053148	Bacteria	709
340	Ga0500604_0016344	3300053151	Bacteria	2043
341	Ga0500604_0342779	3300053151	Bacteria	519
342	Ga0500620_002753	3300053155	Bacteria	3620
343	Ga0500627_0001815	3300053158	Bacteria	6084
344	Ga0500627_0019861	3300053158	Bacteria	2685
345	Ga0500638_219746	3300053162	Bacteria	789
346	Ga0500636_0000915	3300053177	Bacteria	15899
347	Ga0500649_117818	3300053722	Bacteria	1018
348	Ga0500645_000003	3300053730	Bacteria	305887
349	Ga0500645_012910	3300053730	Bacteria	2692
350	Ga0501084_0618675	3300054114	Bacteria	915
351	Ga0500661_020472	3300055283	Bacteria	1176
352	Ga0501082_0665447	3300060353	Bacteria	911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009101	Ga0105247_10744978	Ga0105247_107449781	77
2	iso_pu_bacteria	2898795034	2898798670	80
3	3300027907	Ga0207428_11071884	Ga0207428_110718841	84
4	3300042435	Ga0439434_0140869	Ga0439434_0140869_330_584	84
5	3300046460	Ga0495638_0000731	Ga0495638_0000731_16135_16389	84
6	3300046471	Ga0495650_0010259	Ga0495650_0010259_473_727	84
7	3300046512	Ga0495610_0033509	Ga0495610_0033509_2387_2641	84
8	3300046513	Ga0495616_0388063	Ga0495616_0388063_48_302	84
9	3300046520	Ga0495637_0015674	Ga0495637_0015674_2881_3135	84
10	3300047470	Ga0495681_0008159	Ga0495681_0008159_6157_6411	84
11	3300047472	Ga0495686_0280948	Ga0495686_0280948_93_347	84
12	3300053088	Ga0500644_0003890	Ga0500644_0003890_2473_2733	84
13	3300053093	Ga0500651_0026497	Ga0500651_0026497_1765_2025	84
14	iso_pu_bacteria	2524023210	2524464507	84
15	iso_pu_bacteria	2643221588	2643951935	84
16	iso_pu_bacteria	2643221607	2644048288	84
17	iso_pu_bacteria	2643221636	2644200785	84
18	iso_pu_bacteria	2643221686	2644485265	84
19	iso_pu_bacteria	2849076700	2849080187	84
20	iso_pu_bacteria	2874612657	2874613304	84
21	3300046692	Ga0495671_0217621	Ga0495671_0217621_279_554	85
22	3300005563	Ga0068855_100400643	Ga0068855_1004006432	87
23	3300006353	Ga0075370_10197532	Ga0075370_101975322	87
24	3300009174	Ga0105241_10901027	Ga0105241_109010272	87
25	3300025949	Ga0207667_10379621	Ga0207667_103796212	87
26	3300031730	Ga0307516_10112408	Ga0307516_101124083	87
27	3300035116	Ga0373945_0092911	Ga0373945_0092911_274_537	87
28	3300035170	Ga0373943_0152013	Ga0373943_0152013_785_1048	87
29	3300035692	Ga0373935_0015614	Ga0373935_0015614_1128_1391	87
30	3300035695	Ga0373927_0229516	Ga0373927_0229516_157_420	87
31	3300035725	Ga0373947_0021163	Ga0373947_0021163_3105_3368	87
32	3300037068	Ga0373925_0022391	Ga0373925_0022391_3600_3863	87
33	3300044658	Ga0466972_0317018	Ga0466972_0317018_53_316	87
34	3300046476	Ga0495662_0138624	Ga0495662_0138624_584_847	87
35	3300046477	Ga0495664_0340758	Ga0495664_0340758_533_796	87
36	3300046499	Ga0495594_0860912	Ga0495594_0860912_173_436	87
37	3300046517	Ga0495630_0357343	Ga0495630_0357343_166_429	87
38	3300046533	Ga0495640_0244847	Ga0495640_0244847_655_918	87
39	3300046559	Ga0495667_0790237	Ga0495667_0790237_232_495	87
40	3300046642	Ga0495634_0071837	Ga0495634_0071837_457_720	87
41	3300046690	Ga0495624_0210582	Ga0495624_0210582_504_767	87
42	3300047319	Ga0495674_0199290	Ga0495674_0199290_558_821	87
43	3300048089	Ga0495614_0571427	Ga0495614_0571427_211_474	87
44	3300048924	Ga0496121_0119970	Ga0496121_0119970_621_884	87
45	3300049570	Ga0501033_0046287	Ga0501033_0046287_904_1173	87
46	3300049579	Ga0501043_0549297	Ga0501043_0549297_28_297	87
47	3300049586	Ga0501070_0444100	Ga0501070_0444100_123_392	87
48	3300049822	Ga0501035_1250022	Ga0501035_1250022_14_283	87
49	3300049823	Ga0501044_0813436	Ga0501044_0813436_273_542	87
50	3300050496	nmdc:mga07m45_230165_c1	nmdc:mga07m45_230165_c1_282_545	87
51	3300053077	Ga0495601_0403287	Ga0495601_0403287_187_450	87
52	3300053148	Ga0500590_081143	Ga0500590_081143_1282_1563	87
53	3300001978	JGI24747J21853_1017740	JGI24747J21853_10177403	88
54	3300002077	JGI24744J21845_10003363	JGI24744J21845_100033633	88
55	3300003759	Ga0055525_1000139	Ga0055525_10001392	88
56	3300005262	Ga0065165_1040146	Ga0065165_10401461	88
57	3300005327	Ga0070658_10973895	Ga0070658_109738952	88
58	3300005328	Ga0070676_10315565	Ga0070676_103155653	88
59	3300005329	Ga0070683_101878027	Ga0070683_1018780272	88
60	3300005331	Ga0070670_100793999	Ga0070670_1007939992	88
61	3300005335	Ga0070666_10420527	Ga0070666_104205272	88
62	3300005338	Ga0068868_100026949	Ga0068868_1000269498	88
63	3300005339	Ga0070660_100001694	Ga0070660_1000016948	88
64	3300005339	Ga0070660_100131817	Ga0070660_1001318173	88
65	3300005345	Ga0070692_10681621	Ga0070692_106816211	88
66	3300005354	Ga0070675_100097344	Ga0070675_1000973442	88
67	3300005354	Ga0070675_102094772	Ga0070675_1020947722	88
68	3300005356	Ga0070674_100000483	Ga0070674_1000004833	88
69	3300005356	Ga0070674_100621100	Ga0070674_1006211003	88
70	3300005356	Ga0070674_101764481	Ga0070674_1017644811	88
71	3300005364	Ga0070673_100331358	Ga0070673_1003313582	88
72	3300005364	Ga0070673_100690346	Ga0070673_1006903462	88
73	3300005366	Ga0070659_100000032	Ga0070659_100000032110	88
74	3300005366	Ga0070659_101915634	Ga0070659_1019156341	88
75	3300005367	Ga0070667_100863251	Ga0070667_1008632512	88
76	3300005434	Ga0070709_10037310	Ga0070709_100373104	88
77	3300005435	Ga0070714_100245543	Ga0070714_1002455433	88
78	3300005437	Ga0070710_10639106	Ga0070710_106391062	88
79	3300005455	Ga0070663_101150197	Ga0070663_1011501971	88
80	3300005456	Ga0070678_100001925	Ga0070678_1000019256	88
81	3300005459	Ga0068867_102401385	Ga0068867_1024013851	88
82	3300005467	Ga0070706_100886006	Ga0070706_1008860061	88
83	3300005535	Ga0070684_100598537	Ga0070684_1005985372	88
84	3300005539	Ga0068853_100301389	Ga0068853_1003013893	88
85	3300005539	Ga0068853_101240720	Ga0068853_1012407202	88
86	3300005543	Ga0070672_100665547	Ga0070672_1006655472	88
87	3300005548	Ga0070665_100000317	Ga0070665_10000031753	88
88	3300005548	Ga0070665_100781834	Ga0070665_1007818342	88
89	3300005548	Ga0070665_102624500	Ga0070665_1026245002	88
90	3300005563	Ga0068855_101383234	Ga0068855_1013832342	88
91	3300005577	Ga0068857_100028071	Ga0068857_1000280716	88
92	3300005577	Ga0068857_102162374	Ga0068857_1021623742	88
93	3300005578	Ga0068854_100010640	Ga0068854_1000106407	88
94	3300005616	Ga0068852_101299590	Ga0068852_1012995902	88
95	3300005844	Ga0068862_101422380	Ga0068862_1014223802	88
96	3300006028	Ga0070717_10103259	Ga0070717_101032593	88
97	3300006028	Ga0070717_10736777	Ga0070717_107367773	88
98	3300006173	Ga0070716_100232744	Ga0070716_1002327442	88
99	3300006173	Ga0070716_100345785	Ga0070716_1003457852	88
100	3300006186	Ga0075369_10258812	Ga0075369_102588121	88
101	3300006195	Ga0075366_10066606	Ga0075366_100666064	88
102	3300006871	Ga0075434_100005100	Ga0075434_10000510011	88
103	3300009036	Ga0105244_10157867	Ga0105244_101578671	88
104	3300009093	Ga0105240_10001331	Ga0105240_1000133122	88
105	3300009148	Ga0105243_10001132	Ga0105243_1000113228	88
106	3300009148	Ga0105243_10593392	Ga0105243_105933922	88
107	3300009176	Ga0105242_10695696	Ga0105242_106956961	88
108	3300009177	Ga0105248_10042465	Ga0105248_100424656	88
109	3300009177	Ga0105248_10334498	Ga0105248_103344982	88
110	3300009545	Ga0105237_10006917	Ga0105237_100069178	88
111	3300009551	Ga0105238_10014287	Ga0105238_100142876	88
112	3300009551	Ga0105238_11516151	Ga0105238_115161511	88
113	3300009551	Ga0105238_12917080	Ga0105238_129170801	88
114	3300009553	Ga0105249_10866411	Ga0105249_108664112	88
115	3300010375	Ga0105239_10000271	Ga0105239_1000027125	88
116	3300010375	Ga0105239_10160777	Ga0105239_101607775	88
117	3300013100	Ga0157373_10774533	Ga0157373_107745332	88
118	3300013105	Ga0157369_10072235	Ga0157369_100722354	88
119	3300013105	Ga0157369_10842192	Ga0157369_108421921	88
120	3300013105	Ga0157369_11201108	Ga0157369_112011082	88
121	3300013296	Ga0157374_10234264	Ga0157374_102342643	88
122	3300013296	Ga0157374_10464135	Ga0157374_104641354	88
123	3300013297	Ga0157378_11272126	Ga0157378_112721261	88
124	3300013307	Ga0157372_10717818	Ga0157372_107178182	88
125	3300013307	Ga0157372_11033189	Ga0157372_110331892	88
126	3300013307	Ga0157372_11752135	Ga0157372_117521352	88
127	3300013308	Ga0157375_11500857	Ga0157375_115008571	88
128	3300013308	Ga0157375_12176890	Ga0157375_121768902	88
129	3300013308	Ga0157375_12544837	Ga0157375_125448372	88
130	3300014497	Ga0182008_10045333	Ga0182008_100453333	88
131	3300021377	Ga0213874_10455037	Ga0213874_104550371	88
132	3300021384	Ga0213876_10001580	Ga0213876_100015805	88
133	3300021388	Ga0213875_10354100	Ga0213875_103541001	88
134	3300021441	Ga0213871_10046568	Ga0213871_100465682	88
135	3300024225	Ga0224572_1013190	Ga0224572_10131902	88
136	3300025230	Ga0209563_100070	Ga0209563_100070153	88
137	3300025250	Ga0209026_1016931	Ga0209026_10169312	88
138	3300025898	Ga0207692_10265348	Ga0207692_102653482	88
139	3300025901	Ga0207688_10420898	Ga0207688_104208982	88
140	3300025904	Ga0207647_10017043	Ga0207647_100170434	88
141	3300025909	Ga0207705_10305644	Ga0207705_103056442	88
142	3300025909	Ga0207705_11021407	Ga0207705_110214072	88
143	3300025910	Ga0207684_11229003	Ga0207684_112290032	88
144	3300025913	Ga0207695_10004839	Ga0207695_1000483917	88
145	3300025914	Ga0207671_10001194	Ga0207671_1000119417	88
146	3300025919	Ga0207657_10004276	Ga0207657_100042768	88
147	3300025919	Ga0207657_10097986	Ga0207657_100979862	88
148	3300025920	Ga0207649_10081034	Ga0207649_100810344	88
149	3300025924	Ga0207694_10041588	Ga0207694_100415882	88
150	3300025924	Ga0207694_10130851	Ga0207694_101308513	88
151	3300025925	Ga0207650_10490546	Ga0207650_104905463	88
152	3300025926	Ga0207659_10054132	Ga0207659_100541323	88
153	3300025929	Ga0207664_10014649	Ga0207664_100146498	88
154	3300025931	Ga0207644_10154479	Ga0207644_101544793	88
155	3300025931	Ga0207644_11488282	Ga0207644_114882821	88
156	3300025932	Ga0207690_10000001	Ga0207690_10000001720	88
157	3300025933	Ga0207706_10146815	Ga0207706_101468153	88
158	3300025933	Ga0207706_10590388	Ga0207706_105903883	88
159	3300025934	Ga0207686_10218408	Ga0207686_102184082	88
160	3300025935	Ga0207709_10000005	Ga0207709_10000005404	88
161	3300025937	Ga0207669_10008360	Ga0207669_100083603	88
162	3300025937	Ga0207669_11309719	Ga0207669_113097192	88
163	3300025939	Ga0207665_10086369	Ga0207665_100863693	88
164	3300025940	Ga0207691_10592656	Ga0207691_105926562	88
165	3300025941	Ga0207711_10003539	Ga0207711_1000353914	88
166	3300025941	Ga0207711_10207711	Ga0207711_102077112	88
167	3300025944	Ga0207661_11071074	Ga0207661_110710742	88
168	3300025949	Ga0207667_10367795	Ga0207667_103677952	88
169	3300025960	Ga0207651_10241185	Ga0207651_102411852	88
170	3300025960	Ga0207651_10298937	Ga0207651_102989372	88
171	3300025960	Ga0207651_10484885	Ga0207651_104848852	88
172	3300025961	Ga0207712_10552048	Ga0207712_105520481	88
173	3300025972	Ga0207668_10983409	Ga0207668_109834092	88
174	3300025981	Ga0207640_10007871	Ga0207640_100078713	88
175	3300025986	Ga0207658_10461170	Ga0207658_104611703	88
176	3300026023	Ga0207677_10000176	Ga0207677_1000017640	88
177	3300026041	Ga0207639_11860049	Ga0207639_118600492	88
178	3300026116	Ga0207674_10068684	Ga0207674_100686844	88
179	3300026121	Ga0207683_10005199	Ga0207683_100051999	88
180	3300026121	Ga0207683_11659358	Ga0207683_116593582	88
181	3300026142	Ga0207698_10092790	Ga0207698_100927905	88
182	3300028023	Ga0265357_1000786	Ga0265357_10007864	88
183	3300028379	Ga0268266_10000388	Ga0268266_1000038825	88
184	3300028380	Ga0268265_12193382	Ga0268265_121933821	88
185	3300028786	Ga0307517_10124468	Ga0307517_101244684	88
186	3300028786	Ga0307517_10345696	Ga0307517_103456962	88
187	3300028800	Ga0265338_10464302	Ga0265338_104643022	88
188	3300031018	Ga0265773_1011253	Ga0265773_10112532	88
189	3300031548	Ga0307408_100135640	Ga0307408_1001356402	88
190	3300031548	Ga0307408_100613752	Ga0307408_1006137522	88
191	3300031731	Ga0307405_10095523	Ga0307405_100955232	88
192	3300031731	Ga0307405_10132166	Ga0307405_101321661	88
193	3300031824	Ga0307413_10429203	Ga0307413_104292033	88
194	3300031824	Ga0307413_10476173	Ga0307413_104761732	88
195	3300031824	Ga0307413_10813097	Ga0307413_108130973	88
196	3300031852	Ga0307410_10559614	Ga0307410_105596142	88
197	3300031903	Ga0307407_10185455	Ga0307407_101854553	88
198	3300031903	Ga0307407_10484390	Ga0307407_104843902	88
199	3300031911	Ga0307412_10031611	Ga0307412_100316111	88
200	3300031911	Ga0307412_10144591	Ga0307412_101445911	88
201	3300031911	Ga0307412_10175678	Ga0307412_101756782	88
202	3300031911	Ga0307412_11473162	Ga0307412_114731621	88
203	3300031995	Ga0307409_100039127	Ga0307409_1000391273	88
204	3300031995	Ga0307409_100290403	Ga0307409_1002904033	88
205	3300031995	Ga0307409_100770631	Ga0307409_1007706312	88
206	3300032002	Ga0307416_100104352	Ga0307416_1001043523	88
207	3300032002	Ga0307416_100105104	Ga0307416_1001051042	88
208	3300032004	Ga0307414_10128365	Ga0307414_101283654	88
209	3300032005	Ga0307411_10359689	Ga0307411_103596893	88
210	3300032005	Ga0307411_10602157	Ga0307411_106021573	88
211	3300032126	Ga0307415_100038546	Ga0307415_1000385464	88
212	3300032126	Ga0307415_100038587	Ga0307415_1000385871	88
213	3300032126	Ga0307415_100107141	Ga0307415_1001071412	88
214	3300032126	Ga0307415_102168493	Ga0307415_1021684931	88
215	3300033180	Ga0307510_10148018	Ga0307510_101480182	88
216	3300035725	Ga0373947_0506373	Ga0373947_0506373_198_476	88
217	3300037853	Ga0436364_0238769	Ga0436364_0238769_2158_2427	88
218	3300038443	Ga0395901_0144817	Ga0395901_0144817_679_945	88
219	3300038443	Ga0395901_0733886	Ga0395901_0733886_157_429	88
220	3300039437	Ga0436365_0449657	Ga0436365_0449657_390_656	88
221	3300039437	Ga0436365_0857765	Ga0436365_0857765_237_506	88
222	3300039437	Ga0436365_1312492	Ga0436365_1312492_34096_34362	88
223	3300039437	Ga0436365_1889063	Ga0436365_1889063_689_958	88
224	3300039437	Ga0436365_1936118	Ga0436365_1936118_101_367	88
225	3300039438	Ga0436360_1186917	Ga0436360_1186917_2155_2421	88
226	3300039450	Ga0436363_0069258	Ga0436363_0069258_410_679	88
227	3300039450	Ga0436363_1442690	Ga0436363_1442690_93_359	88
228	3300039453	Ga0436362_0365673	Ga0436362_0365673_653_922	88
229	3300041413	Ga0439465_0089765	Ga0439465_0089765_579_845	88
230	3300041459	Ga0451800_1262866	Ga0451800_1262866_338_604	88
231	3300042005	Ga0439448_0311480	Ga0439448_0311480_251_517	88
232	3300044735	Ga0466968_0166767	Ga0466968_0166767_727_993	88
233	3300044735	Ga0466968_0534432	Ga0466968_0534432_70_336	88
234	3300044901	Ga0466960_0309048	Ga0466960_0309048_460_726	88
235	3300046491	Ga0495584_0052588	Ga0495584_0052588_1042_1308	88
236	3300046492	Ga0495585_0230187	Ga0495585_0230187_377_643	88
237	3300046506	Ga0495583_0002358	Ga0495583_0002358_1099_1365	88
238	3300046506	Ga0495583_0037275	Ga0495583_0037275_1702_1968	88
239	3300046506	Ga0495583_0040307	Ga0495583_0040307_432_698	88
240	3300046506	Ga0495583_0113324	Ga0495583_0113324_124_390	88
241	3300046507	Ga0495606_0007432	Ga0495606_0007432_647_913	88
242	3300046518	Ga0495631_0126218	Ga0495631_0126218_430_696	88
243	3300046522	Ga0495643_0061582	Ga0495643_0061582_1276_1542	88
244	3300046522	Ga0495643_0132196	Ga0495643_0132196_336_602	88
245	3300046522	Ga0495643_0346215	Ga0495643_0346215_145_429	88
246	3300046524	Ga0495648_0092702	Ga0495648_0092702_1109_1375	88
247	3300046525	Ga0495663_0001846	Ga0495663_0001846_5801_6067	88
248	3300046557	Ga0495622_0254222	Ga0495622_0254222_312_578	88
249	3300046616	Ga0495668_0342733	Ga0495668_0342733_175_441	88
250	3300046648	Ga0495611_0016361	Ga0495611_0016361_1670_1936	88
251	3300046648	Ga0495611_0044388	Ga0495611_0044388_449_715	88
252	3300046660	Ga0495625_0017622	Ga0495625_0017622_1647_1913	88
253	3300046660	Ga0495625_0040517	Ga0495625_0040517_1082_1348	88
254	3300046660	Ga0495625_0351534	Ga0495625_0351534_411_677	88
255	3300046660	Ga0495625_0649385	Ga0495625_0649385_227_493	88
256	3300046665	Ga0495661_0271683	Ga0495661_0271683_141_407	88
257	3300046694	Ga0495649_0030503	Ga0495649_0030503_1163_1429	88
258	3300046694	Ga0495649_0517900	Ga0495649_0517900_58_324	88
259	3300046809	Ga0495600_0068983	Ga0495600_0068983_110_376	88
260	3300047318	Ga0495636_0468567	Ga0495636_0468567_264_530	88
261	3300047323	Ga0495683_0008964	Ga0495683_0008964_4362_4628	88
262	3300047443	Ga0495687_000499	Ga0495687_000499_45598_45864	88
263	3300047443	Ga0495687_001696	Ga0495687_001696_612_878	88
264	3300047445	Ga0495677_0248656	Ga0495677_0248656_370_636	88
265	3300047469	Ga0495673_0084792	Ga0495673_0084792_359_625	88
266	3300048904	Ga0496101_0084413	Ga0496101_0084413_430_696	88
267	3300048904	Ga0496101_0156255	Ga0496101_0156255_37_303	88
268	3300048904	Ga0496101_1340643	Ga0496101_1340643_232_498	88
269	3300048905	Ga0496102_0000022	Ga0496102_0000022_1398_1664	88
270	3300048905	Ga0496102_0040747	Ga0496102_0040747_2166_2432	88
271	3300048906	Ga0496103_0000075	Ga0496103_0000075_1634_1900	88
272	3300048906	Ga0496103_0101006	Ga0496103_0101006_384_650	88
273	3300048907	Ga0496104_0193531	Ga0496104_0193531_283_549	88
274	3300048908	Ga0496105_0021589	Ga0496105_0021589_3596_3862	88
275	3300048909	Ga0496106_0503174	Ga0496106_0503174_667_933	88
276	3300048910	Ga0496107_0259453	Ga0496107_0259453_217_483	88
277	3300048913	Ga0496110_0035849	Ga0496110_0035849_1294_1560	88
278	3300048914	Ga0496111_0016874	Ga0496111_0016874_3573_3839	88
279	3300048915	Ga0496112_1302057	Ga0496112_1302057_100_366	88
280	3300048916	Ga0496113_0329504	Ga0496113_0329504_827_1093	88
281	3300048916	Ga0496113_1125786	Ga0496113_1125786_315_581	88
282	3300048917	Ga0496114_0036720	Ga0496114_0036720_196_462	88
283	3300048917	Ga0496114_0590373	Ga0496114_0590373_682_948	88
284	3300048918	Ga0496115_0017647	Ga0496115_0017647_1601_1867	88
285	3300048918	Ga0496115_0017872	Ga0496115_0017872_916_1182	88
286	3300048918	Ga0496115_1422569	Ga0496115_1422569_107_376	88
287	3300048919	Ga0496116_0126881	Ga0496116_0126881_741_1007	88
288	3300048920	Ga0496117_0010437	Ga0496117_0010437_1801_2067	88
289	3300048921	Ga0496118_0000039	Ga0496118_0000039_92295_92561	88
290	3300048921	Ga0496118_0327368	Ga0496118_0327368_107_373	88
291	3300048922	Ga0496119_0017347	Ga0496119_0017347_3644_3910	88
292	3300048923	Ga0496120_0043007	Ga0496120_0043007_1611_1877	88
293	3300048924	Ga0496121_0001414	Ga0496121_0001414_38932_39198	88
294	3300048924	Ga0496121_0007281	Ga0496121_0007281_11493_11759	88
295	3300048924	Ga0496121_0013716	Ga0496121_0013716_677_943	88
296	3300048924	Ga0496121_0024276	Ga0496121_0024276_1944_2210	88
297	3300048924	Ga0496121_0583811	Ga0496121_0583811_249_515	88
298	3300048925	Ga0496122_0057428	Ga0496122_0057428_564_830	88
299	3300048926	Ga0496123_0186963	Ga0496123_0186963_47_313	88
300	3300048927	Ga0496124_0000076	Ga0496124_0000076_213939_214205	88
301	3300048928	Ga0496125_0011759	Ga0496125_0011759_6431_6697	88
302	3300048929	Ga0496126_0023885	Ga0496126_0023885_3670_3936	88
303	3300048929	Ga0496126_0092887	Ga0496126_0092887_455_721	88
304	3300048929	Ga0496126_1109601	Ga0496126_1109601_268_534	88
305	3300049568	Ga0501031_0645174	Ga0501031_0645174_301_576	88
306	3300049570	Ga0501033_0077730	Ga0501033_0077730_1271_1543	88
307	3300049570	Ga0501033_0344170	Ga0501033_0344170_116_388	88
308	3300049572	Ga0501036_0341234	Ga0501036_0341234_859_1131	88
309	3300049575	Ga0501039_0445762	Ga0501039_0445762_144_416	88
310	3300049579	Ga0501043_0156200	Ga0501043_0156200_497_769	88
311	3300049581	Ga0501047_0062226	Ga0501047_0062226_2427_2699	88
312	3300049582	Ga0501048_0143628	Ga0501048_0143628_578_850	88
313	3300049585	Ga0501069_0163043	Ga0501069_0163043_184_456	88
314	3300049586	Ga0501070_0322910	Ga0501070_0322910_357_629	88
315	3300049586	Ga0501070_0536466	Ga0501070_0536466_282_554	88
316	3300049649	Ga0501198_046588	Ga0501198_046588_440_706	88
317	3300049652	Ga0501202_027168	Ga0501202_027168_713_979	88
318	3300049664	Ga0501224_019423	Ga0501224_019423_239_505	88
319	3300049679	Ga0501249_000229	Ga0501249_000229_15461_15727	88
320	3300049683	Ga0501253_184251	Ga0501253_184251_48_314	88
321	3300049688	Ga0501259_017550	Ga0501259_017550_907_1173	88
322	3300049742	Ga0501080_0112239	Ga0501080_0112239_165_437	88
323	3300049742	Ga0501080_1359034	Ga0501080_1359034_112_378	88
324	3300049822	Ga0501035_0077788	Ga0501035_0077788_1542_1814	88
325	3300049822	Ga0501035_0125961	Ga0501035_0125961_1212_1484	88
326	3300049822	Ga0501035_1356615	Ga0501035_1356615_159_431	88
327	3300049823	Ga0501044_0024777	Ga0501044_0024777_4823_5095	88
328	3300049850	Ga0501204_000462	Ga0501204_000462_2302_2568	88
329	3300050493	nmdc:mga0k408_39203_c1	nmdc:mga0k408_39203_c1_1312_1578	88
330	3300050512	nmdc:mga0n895_169843_c1	nmdc:mga0n895_169843_c1_1362_1628	88
331	3300053079	Ga0500610_0000255	Ga0500610_0000255_1078_1344	88
332	3300053080	Ga0500635_0324180	Ga0500635_0324180_175_441	88
333	3300053094	Ga0500566_0003016	Ga0500566_0003016_239_505	88
334	3300053095	Ga0500640_018737	Ga0500640_018737_1755_2021	88
335	3300053102	Ga0500554_073743	Ga0500554_073743_407_673	88
336	3300053111	Ga0500572_104228	Ga0500572_104228_520_786	88
337	3300053116	Ga0500592_000331	Ga0500592_000331_2442_2708	88
338	3300053121	Ga0500607_000077	Ga0500607_000077_39181_39450	88
339	3300053121	Ga0500607_032359	Ga0500607_032359_172_438	88
340	3300053123	Ga0500614_155446	Ga0500614_155446_95_361	88
341	3300053130	Ga0500642_0040200	Ga0500642_0040200_856_1122	88
342	3300053134	Ga0500658_0155319	Ga0500658_0155319_588_854	88
343	3300053134	Ga0500658_0169398	Ga0500658_0169398_611_877	88
344	3300053136	Ga0500559_0002676	Ga0500559_0002676_5255_5524	88
345	3300053136	Ga0500559_0254379	Ga0500559_0254379_258_524	88
346	3300053138	Ga0500564_158119	Ga0500564_158119_154_420	88
347	3300053148	Ga0500590_248249	Ga0500590_248249_347_613	88
348	3300053151	Ga0500604_0016344	Ga0500604_0016344_931_1197	88
349	3300053151	Ga0500604_0342779	Ga0500604_0342779_13_279	88
350	3300053155	Ga0500620_002753	Ga0500620_002753_1422_1688	88
351	3300053158	Ga0500627_0001815	Ga0500627_0001815_2355_2621	88
352	3300053158	Ga0500627_0019861	Ga0500627_0019861_1735_2001	88
353	3300053162	Ga0500638_219746	Ga0500638_219746_292_558	88
354	3300053177	Ga0500636_0000915	Ga0500636_0000915_6115_6381	88
355	3300053722	Ga0500649_117818	Ga0500649_117818_148_414	88
356	3300053730	Ga0500645_000003	Ga0500645_000003_1617_1883	88
357	3300053730	Ga0500645_012910	Ga0500645_012910_38_304	88
358	3300054114	Ga0501084_0618675	Ga0501084_0618675_546_812	88
359	3300055283	Ga0500661_020472	Ga0500661_020472_695_961	88
360	3300060353	Ga0501082_0665447	Ga0501082_0665447_418_690	88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

5

82

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6n90-assembly1.cif.gz_B	yoeb/pare toxin from agrobacterium tumefaciens	0.9781	1	88
6n90-assembly1.cif.gz_A	yoeb/pare toxin from agrobacterium tumefaciens	0.9673	1	88
6n90-assembly1.cif.gz_B	yoeb/pare toxin from agrobacterium tumefaciens	0.967	1	88
4v8x-assembly2.cif.gz_CY	structure of thermus thermophilus ribosome	0.9336	1	88
3oei-assembly4.cif.gz_O	crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358-relbe3)	0.932	2	88

ID	Description	Score	Start	End	Superfamily
af_P9WF09_1_85_3.30.2310.20	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.938	2	88	3.30.2310.20
4bydY00	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.9336	1	88	3.30.2310.20
4bydY00	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.9231	1	88	3.30.2310.20
af_P9WF09_1_85_3.30.2310.20	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.9062	2	88	3.30.2310.20
af_Q2FVF8_1_87_3.30.2310.20	Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like	0.8879	2	88	3.30.2310.20

ID	Description	Score	Start	End	GO Terms
AF-A0A480A579-F1-model_v4	Putative mRNA interferase YoeB	1.003	1	68	GO:0004519 GO:0006401
AF-A0A7G5IGR1-F1-model_v4	Putative mRNA interferase YoeB	0.9908	1	88	GO:0004519 GO:0006401 GO:0098795
AF-A0A139QRD3-F1-model_v4	Putative mRNA interferase YoeB	0.9907	1	88	GO:0004519 GO:0006401 GO:0045892
AF-Q8DNR3-F1-model_v4	Putative mRNA interferase YoeB	0.9902	1	88	GO:0004519 GO:0006401 GO:0045892
AF-A0A2I1TM99-F1-model_v4	deleted	0.9901	1	88

Feature Viewer

pLDDT	pTM	Quality
96.39	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F421898

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

5

82

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map