F421832

General Info

Members Datasets Scaffolds Average Seq Length
360 211 720 251

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100069370|Ga0070712_1000693702
Length 288
Sequence MTTGLWDRETFVEKLQAIGVRAYHDKHPFHVAMNEGGLSPEALRGWIANRFYYQRNIPIKDAAILANCPVREVRRAWIHRILDHDGVSSSAAESDSSAVALAEADVLRGESAAPHVLGTAHATANEGGIEAWLRLGEACGISRDELLDNRHLVPGVRFAVDAYVNFARSQPWPIAIASSLTELFAPDLMTARLAAFEKFYSWIDERGLNYFRRRVTQARRDSDEALAITLEYCNTPELQREAVRALEFKCDVLWSMLDAIHHAHFKEGRSPVRPSAGNFGDREIAAPA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 5.56
Rhizosphere 92.22
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100069370 3300006175 Bacteria 2514
2 JGI24035J26624_1004916 3300002126 Bacteria 1273
3 rootH2_10070950 3300003320 Bacteria 4032
4 rootH2_10184108 3300003320 Bacteria 3696
5 rootH1_10254908 3300003323 Bacteria 2531
6 Ga0055530_10026527 3300003791 Bacteria 1599
7 JGI25405J52794_10025340 3300003911 Bacteria 1215
8 Ga0065704_10009506 3300005289 Bacteria 4783
9 Ga0065712_10108408 3300005290 Bacteria 1857
10 Ga0065712_10259903 3300005290 Bacteria 937
11 Ga0065715_10019845 3300005293 Bacteria 2664
12 Ga0065715_10028985 3300005293 Unclassified 2106
13 Ga0065707_10035841 3300005295 Bacteria 2317
14 Ga0070658_10001174 3300005327 Bacteria 22371
15 Ga0070658_10020306 3300005327 Bacteria 5323
16 Ga0070676_10076626 3300005328 Bacteria 2019
17 Ga0070683_100039583 3300005329 Bacteria 4329
18 Ga0070683_100151169 3300005329 Bacteria 2201
19 Ga0070690_100354940 3300005330 Bacteria 1065
20 Ga0070670_100063194 3300005331 Plasmid 3177
21 Ga0070670_100183216 3300005331 Bacteria 1818
22 Ga0068869_100315908 3300005334 Bacteria 1266
23 Ga0068869_100382564 3300005334 Bacteria 1154
24 Ga0070666_10015001 3300005335 Bacteria 4937
25 Ga0070666_10229444 3300005335 Bacteria 1311
26 Ga0070680_100082636 3300005336 Bacteria 2651
27 Ga0068868_100517253 3300005338 Bacteria 1047
28 Ga0070660_100205554 3300005339 Bacteria 1598
29 Ga0070689_100006218 3300005340 Bacteria 8241
30 Ga0070689_100024398 3300005340 Bacteria 4536
31 Ga0070689_100211067 3300005340 Bacteria 1589
32 Ga0070687_100178050 3300005343 Bacteria 1271
33 Ga0070661_100070887 3300005344 Bacteria 2564
34 Ga0070661_100794387 3300005344 Unclassified 776
35 Ga0070668_100134587 3300005347 Bacteria 1986
36 Ga0070668_100204101 3300005347 Bacteria 1624
37 Ga0070669_100079198 3300005353 Bacteria 2443
38 Ga0070675_100003613 3300005354 Bacteria 11765
39 Ga0070675_100003972 3300005354 Bacteria 11213
40 Ga0070675_100133833 3300005354 Bacteria 2115
41 Ga0070675_100226879 3300005354 Bacteria 1628
42 Ga0070671_100170653 3300005355 Bacteria 1840
43 Ga0070671_100298253 3300005355 Bacteria 1372
44 Ga0070688_100008327 3300005365 Bacteria 5627
45 Ga0070688_100211569 3300005365 Bacteria 1361
46 Ga0070688_100560101 3300005365 Bacteria 870
47 Ga0070659_100015510 3300005366 Bacteria 5709
48 Ga0070667_100057220 3300005367 Bacteria 3295
49 Ga0070667_100415723 3300005367 Bacteria 1225
50 Ga0070709_10104716 3300005434 Bacteria 1891
51 Ga0070709_10178204 3300005434 Bacteria 1490
52 Ga0070714_100127770 3300005435 Bacteria 2268
53 Ga0070711_100433291 3300005439 Bacteria 1073
54 Ga0070711_100858795 3300005439 Bacteria 772
55 Ga0070705_100016385 3300005440 Bacteria 3851
56 Ga0070700_100032937 3300005441 Bacteria 3119
57 Ga0070694_100010036 3300005444 Bacteria 5824
58 Ga0070708_100056171 3300005445 Bacteria 3501
59 Ga0070708_100223796 3300005445 Bacteria 1765
60 Ga0070708_100371777 3300005445 Bacteria 1348
61 Ga0070708_100404477 3300005445 Bacteria 1287
62 Ga0070663_100091357 3300005455 Bacteria 2256
63 Ga0070662_100032627 3300005457 Bacteria 3660
64 Ga0070662_100078141 3300005457 Bacteria 2457
65 Ga0070662_100109485 3300005457 Bacteria 2102
66 Ga0070681_10009000 3300005458 Bacteria 9817
67 Ga0070681_10142538 3300005458 Bacteria 2326
68 Ga0068867_100248678 3300005459 Bacteria 1445
69 Ga0070685_10008215 3300005466 Bacteria 5354
70 Ga0070706_100011114 3300005467 Bacteria 8360
71 Ga0070706_100125112 3300005467 Bacteria 2397
72 Ga0070706_100130682 3300005467 Bacteria 2343
73 Ga0070707_100017609 3300005468 Bacteria 6720
74 Ga0070707_100186142 3300005468 Bacteria 2025
75 Ga0070698_100020341 3300005471 Bacteria 6956
76 Ga0070684_100003184 3300005535 Bacteria 12275
77 Ga0070684_100218774 3300005535 Bacteria 1738
78 Ga0070684_100276282 3300005535 Bacteria 1538
79 Ga0070697_100253147 3300005536 Bacteria 1506
80 Ga0068853_100066603 3300005539 Bacteria 3128
81 Ga0068853_100592849 3300005539 Unclassified 1052
82 Ga0070686_100150700 3300005544 Bacteria 1628
83 Ga0070665_100001482 3300005548 Bacteria 27442
84 Ga0070665_100032163 3300005548 Bacteria 5279
85 Ga0070665_100154843 3300005548 Bacteria 2294
86 Ga0070665_100165428 3300005548 Bacteria 2214
87 Ga0070665_100165964 3300005548 Bacteria 2210
88 Ga0070704_100010836 3300005549 Bacteria 5561
89 Ga0068855_100005044 3300005563 Bacteria 16113
90 Ga0068855_100069290 3300005563 Bacteria 4105
91 Ga0068855_100161873 3300005563 Bacteria 2539
92 Ga0068855_100960134 3300005563 Bacteria 900
93 Ga0070664_100089164 3300005564 Bacteria 2668
94 Ga0070664_100222528 3300005564 Bacteria 1689
95 Ga0068854_100009719 3300005578 Bacteria 6215
96 Ga0068856_100480117 3300005614 Bacteria 1264
97 Ga0070702_100015394 3300005615 Bacteria 3905
98 Ga0068852_100105905 3300005616 Bacteria 2548
99 Ga0068852_100329598 3300005616 Unclassified 1485
100 Ga0068859_100043096 3300005617 Bacteria 4535
101 Ga0068861_100145809 3300005719 Bacteria 1937
102 Ga0068863_100005582 3300005841 Bacteria 12362
103 Ga0068863_100136650 3300005841 Bacteria 2342
104 Ga0068858_100001325 3300005842 Bacteria 25564
105 Ga0068858_100010371 3300005842 Bacteria 8826
106 Ga0068858_100086006 3300005842 Bacteria 2925
107 Ga0068860_100039062 3300005843 Bacteria 4541
108 Ga0068862_100071657 3300005844 Bacteria 2992
109 Ga0068862_100169231 3300005844 Bacteria 1955
110 Ga0081455_10003444 3300005937 Bacteria 18188
111 Ga0081455_10005689 3300005937 Bacteria 13602
112 Ga0081455_10009463 3300005937 Bacteria 10023
113 Ga0081455_10012503 3300005937 Bacteria 8467
114 Ga0081455_10015827 3300005937 Bacteria 7305
115 Ga0081455_10032288 3300005937 Bacteria 4720
116 Ga0081455_10063276 3300005937 Bacteria 3105
117 Ga0081455_10106577 3300005937 Bacteria 2236
118 Ga0081455_10160161 3300005937 Bacteria 1726
119 Ga0081540_1000380 3300005983 Bacteria 44546
120 Ga0081540_1121298 3300005983 Bacteria 1084
121 Ga0070717_10060497 3300006028 Bacteria 3136
122 Ga0070716_100035495 3300006173 Bacteria 2742
123 Ga0070712_100368505 3300006175 Bacteria 1180
124 Ga0097621_100078376 3300006237 Bacteria 2745
125 Ga0068871_100386638 3300006358 Bacteria 1244
126 Ga0068871_100457444 3300006358 Bacteria 1145
127 Ga0075428_100803049 3300006844 Bacteria 1000
128 Ga0075433_10073939 3300006852 Bacteria 2999
129 Ga0075434_100120025 3300006871 Bacteria 2644
130 Ga0068865_100028776 3300006881 Bacteria 3680
131 Ga0068865_100190072 3300006881 Bacteria 1587
132 Ga0097620_100043096 3300006931 Bacteria 4535
133 Ga0075435_100657893 3300007076 Bacteria 910
134 Ga0099795_10104683 3300007788 Bacteria 1114
135 Ga0105240_10000309 3300009093 Bacteria 93964
136 Ga0105240_10009028 3300009093 Bacteria 14157
137 Ga0105240_10228544 3300009093 Bacteria 2164
138 Ga0111539_10500004 3300009094 Bacteria 1416
139 Ga0105245_10491850 3300009098 Bacteria 1241
140 Ga0105247_10071269 3300009101 Bacteria 2173
141 Ga0114129_10064534 3300009147 Bacteria 5111
142 Ga0105241_10190297 3300009174 Bacteria 1708
143 Ga0105237_10234724 3300009545 Bacteria 1835
144 Ga0105249_10007092 3300009553 Bacteria 9781
145 Ga0105249_10087483 3300009553 Bacteria 2907
146 Ga0105249_10810209 3300009553 Bacteria 1001
147 Ga0099796_10119211 3300010159 Bacteria 1012
148 Ga0105239_10028602 3300010375 Bacteria 6128
149 Ga0105239_10091552 3300010375 Bacteria 3356
150 Ga0105239_10129640 3300010375 Bacteria 2804
151 Ga0105239_10163957 3300010375 Bacteria 2484
152 Ga0105239_10222051 3300010375 Bacteria 2119
153 Ga0157371_10069516 3300013102 Unclassified 2493
154 Ga0157369_10180547 3300013105 Bacteria 2221
155 Ga0157374_10290896 3300013296 Bacteria 1615
156 Ga0157374_10700775 3300013296 Bacteria 1026
157 Ga0157378_10063627 3300013297 Bacteria 3297
158 Ga0157378_10103531 3300013297 Bacteria 2601
159 Ga0157378_10167142 3300013297 Unclassified 2061
160 Ga0157378_10193004 3300013297 Bacteria 1922
161 Ga0157378_10613393 3300013297 Bacteria 1100
162 Ga0163162_10021995 3300013306 Bacteria 6283
163 Ga0163162_10338786 3300013306 Bacteria 1636
164 Ga0163162_10450960 3300013306 Bacteria 1418
165 Ga0157372_10624946 3300013307 Bacteria 1255
166 Ga0157375_10004337 3300013308 Bacteria 12316
167 Ga0157375_10147239 3300013308 Bacteria 2486
168 Ga0157375_10491531 3300013308 Unclassified 1392
169 Ga0163163_10032399 3300014325 Bacteria 5047
170 Ga0163163_10051190 3300014325 Bacteria 4072
171 Ga0157379_10013410 3300014968 Bacteria 7180
172 Ga0157376_10006760 3300014969 Bacteria 8116
173 Ga0157376_10126516 3300014969 Bacteria 2274
174 Ga0207666_1000262 3300025271 Bacteria 7683
175 Ga0207673_1002726 3300025290 Bacteria 2032
176 Ga0207673_1009114 3300025290 Bacteria 1264
177 Ga0209050_1001647 3300025298 Bacteria 22774
178 Ga0207697_10000909 3300025315 Bacteria 16724
179 Ga0207697_10003385 3300025315 Bacteria 7918
180 Ga0207697_10004500 3300025315 Bacteria 6649
181 Ga0207697_10013094 3300025315 Bacteria 3464
182 Ga0207697_10043420 3300025315 Bacteria 1848
183 Ga0207656_10015702 3300025321 Bacteria 2935
184 Ga0207692_10158164 3300025898 Bacteria 1304
185 Ga0207680_10003078 3300025903 Bacteria 7827
186 Ga0207647_10002915 3300025904 Bacteria 12879
187 Ga0207647_10017234 3300025904 Bacteria 4913
188 Ga0207685_10076439 3300025905 Bacteria 1373
189 Ga0207699_10106850 3300025906 Bacteria 1787
190 Ga0207699_10267688 3300025906 Bacteria 1183
191 Ga0207645_10010003 3300025907 Bacteria 6532
192 Ga0207645_10193464 3300025907 Bacteria 1337
193 Ga0207705_10005635 3300025909 Bacteria 9354
194 Ga0207705_10045188 3300025909 Bacteria 3166
195 Ga0207684_10008809 3300025910 Bacteria 8957
196 Ga0207684_10238520 3300025910 Bacteria 1569
197 Ga0207654_10200922 3300025911 Bacteria 1312
198 Ga0207707_10192060 3300025912 Bacteria 1781
199 Ga0207695_10000635 3300025913 Bacteria 70312
200 Ga0207695_10005921 3300025913 Bacteria 16024
201 Ga0207695_10269743 3300025913 Bacteria 1597
202 Ga0207671_10113674 3300025914 Bacteria 2063
203 Ga0207671_10408507 3300025914 Bacteria 1080
204 Ga0207693_10083352 3300025915 Bacteria 2504
205 Ga0207693_10104530 3300025915 Bacteria 2221
206 Ga0207662_10001771 3300025918 Bacteria 10599
207 Ga0207662_10110254 3300025918 Bacteria 1715
208 Ga0207657_10333464 3300025919 Bacteria 1198
209 Ga0207649_10062338 3300025920 Bacteria 2350
210 Ga0207649_10100685 3300025920 Bacteria 1912
211 Ga0207652_10224378 3300025921 Bacteria 1693
212 Ga0207694_10059797 3300025924 Bacteria 2964
213 Ga0207659_10005069 3300025926 Bacteria 7991
214 Ga0207659_10038315 3300025926 Bacteria 3333
215 Ga0207659_10157617 3300025926 Bacteria 1779
216 Ga0207700_10002677 3300025928 Bacteria 10261
217 Ga0207700_10090171 3300025928 Bacteria 2419
218 Ga0207700_10156648 3300025928 Bacteria 1888
219 Ga0207664_10106658 3300025929 Bacteria 2323
220 Ga0207664_10474147 3300025929 Bacteria 1119
221 Ga0207644_10215437 3300025931 Bacteria 1520
222 Ga0207644_10307895 3300025931 Bacteria 1278
223 Ga0207690_10027491 3300025932 Bacteria 3595
224 Ga0207706_10001926 3300025933 Bacteria 20387
225 Ga0207706_10031716 3300025933 Bacteria 4706
226 Ga0207706_10091029 3300025933 Bacteria 2682
227 Ga0207670_10004308 3300025936 Bacteria 7641
228 Ga0207704_10002823 3300025938 Bacteria 7836
229 Ga0207704_10153773 3300025938 Bacteria 1627
230 Ga0207665_10019872 3300025939 Bacteria 4414
231 Ga0207665_10056609 3300025939 Bacteria 2647
232 Ga0207691_10216576 3300025940 Bacteria 1662
233 Ga0207661_10097207 3300025944 Bacteria 2465
234 Ga0207661_10352736 3300025944 Bacteria 1328
235 Ga0207679_10647515 3300025945 Bacteria 955
236 Ga0207667_10004581 3300025949 Bacteria 16947
237 Ga0207667_10103156 3300025949 Bacteria 2942
238 Ga0207667_10125915 3300025949 Unclassified 2639
239 Ga0207667_10652276 3300025949 Bacteria 1058
240 Ga0207651_10038613 3300025960 Bacteria 3140
241 Ga0207651_10517047 3300025960 Bacteria 1034
242 Ga0207712_10000165 3300025961 Bacteria 68118
243 Ga0207712_10014146 3300025961 Bacteria 5122
244 Ga0207668_10183491 3300025972 Bacteria 1652
245 Ga0207658_10064495 3300025986 Bacteria 2748
246 Ga0207658_10087220 3300025986 Bacteria 2409
247 Ga0207658_10126739 3300025986 Bacteria 2045
248 Ga0207658_10400563 3300025986 Bacteria 1206
249 Ga0207677_10081146 3300026023 Bacteria 2326
250 Ga0207703_10000553 3300026035 Bacteria 38426
251 Ga0207703_10011087 3300026035 Bacteria 7022
252 Ga0207703_10032819 3300026035 Bacteria 4112
253 Ga0207639_10000217 3300026041 Bacteria 42907
254 Ga0207639_10064361 3300026041 Bacteria 2843
255 Ga0207678_10005262 3300026067 Bacteria 11593
256 Ga0207678_10012655 3300026067 Bacteria 7413
257 Ga0207708_10020294 3300026075 Bacteria 5012
258 Ga0207641_10019040 3300026088 Bacteria 5630
259 Ga0207641_10223325 3300026088 Bacteria 1748
260 Ga0207648_10083359 3300026089 Bacteria 2789
261 Ga0207648_10606681 3300026089 Bacteria 1009
262 Ga0207676_10083180 3300026095 Bacteria 2606
263 Ga0207675_100151250 3300026118 Bacteria 2209
264 Ga0207698_10258128 3300026142 Bacteria 1599
265 Ga0207698_10265253 3300026142 Bacteria 1580
266 Ga0268266_10000006 3300028379 Bacteria 1410021
267 Ga0268266_10038912 3300028379 Bacteria 4049
268 Ga0268266_10320997 3300028379 Bacteria 1449
269 Ga0268266_10894557 3300028379 Bacteria 858
270 Ga0268265_10106368 3300028380 Bacteria 2279
271 Ga0268265_10157952 3300028380 Bacteria 1922
272 Ga0268264_10546915 3300028381 Bacteria 1135
273 Ga0265334_10019221 3300028573 Bacteria 2814
274 Ga0265338_10012788 3300028800 Bacteria 9545
275 Ga0265338_10039659 3300028800 Bacteria 4438
276 Ga0265338_10086635 3300028800 Bacteria 2605
277 Ga0265320_10094888 3300031240 Bacteria 1379
278 Ga0265320_10154267 3300031240 Unclassified 1036
279 Ga0373957_0047421 3300035120 Bacteria 1634
280 Ga0373935_0001921 3300035692 Bacteria 11690
281 Ga0373935_0036790 3300035692 Bacteria 3062
282 Ga0373933_0266340 3300035724 Unclassified 1105
283 Ga0373947_0034151 3300035725 Bacteria 3008
284 Ga0373937_0102016 3300036401 Bacteria 2663
285 Ga0373937_0118347 3300036401 Bacteria 2468
286 Ga0373925_0019742 3300037068 Bacteria 4905
287 Ga0395898_0003345 3300037466 Bacteria 17992
288 Ga0395905_0302815 3300037471 Bacteria 1486
289 Ga0395905_0960395 3300037471 Bacteria 758
290 Ga0395901_0020303 3300038443 Bacteria 6800
291 Ga0395901_0101506 3300038443 Unclassified 3019
292 Ga0436365_0184732 3300039437 Bacteria 1728
293 Ga0436363_0204116 3300039450 Bacteria 737
294 Ga0439455_0019581 3300042012 Bacteria 1597
295 Ga0439458_0022566 3300042157 Bacteria 1463
296 Ga0466966_0006940 3300044684 Bacteria 7500
297 Ga0466966_0099496 3300044684 Unclassified 1799
298 Ga0466966_0120654 3300044684 Unclassified 1610
299 Ga0466961_0017055 3300044693 Bacteria 4664
300 Ga0466961_0063957 3300044693 Unclassified 2338
301 Ga0466964_0081705 3300044706 Bacteria 1388
302 Ga0466971_0091279 3300044719 Unclassified 1395
303 Ga0466970_0226157 3300044765 Bacteria 1045
304 Ga0466959_0064532 3300045049 Bacteria 2659
305 Ga0466959_0153520 3300045049 Unclassified 1621
306 Ga0466958_0603575 3300045836 Bacteria 714
307 Ga0466967_0032275 3300045976 Bacteria 4420
308 Ga0466967_0077088 3300045976 Bacteria 3000
309 Ga0495592_0122272 3300046454 Bacteria 1829
310 Ga0495639_0140802 3300046475 Bacteria 1160
311 Ga0495608_0211294 3300046511 Bacteria 1220
312 Ga0495628_0109306 3300046516 Bacteria 2127
313 Ga0495630_0027648 3300046517 Bacteria 4210
314 Ga0495630_0513580 3300046517 Unclassified 919
315 Ga0495630_0522537 3300046517 Bacteria 910
316 Ga0495586_0020825 3300046535 Bacteria 3493
317 Ga0495633_0175313 3300046558 Bacteria 988
318 Ga0495634_0080787 3300046642 Bacteria 2127
319 Ga0495599_0017879 3300046678 Bacteria 4413
320 Ga0495658_0146651 3300046683 Bacteria 1447
321 Ga0495669_0084024 3300046684 Bacteria 1464
322 Ga0495604_0099998 3300047317 Bacteria 2133
323 Ga0495674_0115364 3300047319 Bacteria 2273
324 Ga0495674_0139402 3300047319 Bacteria 2039
325 Ga0495680_0380466 3300047322 Bacteria 978
326 Ga0495675_0025275 3300047444 Bacteria 3787
327 Ga0495675_0114108 3300047444 Bacteria 1685
328 Ga0495684_0033864 3300047471 Bacteria 3919
329 Ga0496101_0049947 3300048904 Bacteria 3010
330 Ga0496102_0019141 3300048905 Bacteria 6028
331 Ga0496102_0338246 3300048905 Bacteria 1418
332 Ga0496103_0024181 3300048906 Bacteria 3665
333 Ga0496103_0109768 3300048906 Bacteria 1752
334 Ga0496103_0125967 3300048906 Bacteria 1634
335 Ga0496104_0131529 3300048907 Bacteria 2404
336 Ga0496104_0160543 3300048907 Bacteria 2156
337 Ga0496105_0052215 3300048908 Bacteria 3376
338 Ga0496106_0023733 3300048909 Bacteria 4558
339 Ga0496107_0111150 3300048910 Bacteria 2014
340 Ga0496108_0065570 3300048911 Bacteria 3061
341 Ga0496110_0041442 3300048913 Bacteria 4018
342 Ga0496111_0051484 3300048914 Bacteria 2973
343 Ga0496112_0064551 3300048915 Bacteria 3613
344 Ga0496112_0127997 3300048915 Bacteria 2510
345 Ga0496112_0155674 3300048915 Bacteria 2252
346 Ga0496114_0090383 3300048917 Bacteria 2599
347 Ga0496114_0107382 3300048917 Bacteria 2389
348 Ga0496115_0246540 3300048918 Bacteria 1471
349 Ga0496125_0000614 3300048928 Bacteria 60399
350 Ga0501067_0245610 3300049583 Bacteria 996
351 Ga0501044_0752987 3300049823 Bacteria 856
352 nmdc:mga05p37_365668_c1 3300050507 Bacteria 1694
353 nmdc:mga0n895_121565_c1 3300050512 Bacteria 2632
354 nmdc:mga0n895_139345_c1 3300050512 Bacteria 2453
355 nmdc:mga0n895_379519_c1 3300050512 Bacteria 1430
356 nmdc:mga0n895_851448_c1 3300050512 Bacteria 899
357 nmdc:mga0rr50_236666_c1 3300050513 Bacteria 1512
358 nmdc:mga0a205_734389_c1 3300050515 Bacteria 836
359 Ga0495601_0286706 3300053077 Bacteria 1073
360 Ga0466962_0065106 3300061719 Bacteria 1740
361 Ga0070712_100069370
362 JGI24035J26624_1004916
363 rootH2_10070950
364 rootH2_10184108
365 rootH1_10254908
366 Ga0055530_10026527
367 JGI25405J52794_10025340
368 Ga0065704_10009506
369 Ga0065712_10108408
370 Ga0065712_10259903
371 Ga0065715_10019845
372 Ga0065715_10028985
373 Ga0065707_10035841
374 Ga0070658_10001174
375 Ga0070658_10020306
376 Ga0070676_10076626
377 Ga0070683_100039583
378 Ga0070683_100151169
379 Ga0070690_100354940
380 Ga0070670_100063194
381 Ga0070670_100183216
382 Ga0068869_100315908
383 Ga0068869_100382564
384 Ga0070666_10015001
385 Ga0070666_10229444
386 Ga0070680_100082636
387 Ga0068868_100517253
388 Ga0070660_100205554
389 Ga0070689_100006218
390 Ga0070689_100024398
391 Ga0070689_100211067
392 Ga0070687_100178050
393 Ga0070661_100070887
394 Ga0070661_100794387
395 Ga0070668_100134587
396 Ga0070668_100204101
397 Ga0070669_100079198
398 Ga0070675_100003613
399 Ga0070675_100003972
400 Ga0070675_100133833
401 Ga0070675_100226879
402 Ga0070671_100170653
403 Ga0070671_100298253
404 Ga0070688_100008327
405 Ga0070688_100211569
406 Ga0070688_100560101
407 Ga0070659_100015510
408 Ga0070667_100057220
409 Ga0070667_100415723
410 Ga0070709_10104716
411 Ga0070709_10178204
412 Ga0070714_100127770
413 Ga0070711_100433291
414 Ga0070711_100858795
415 Ga0070705_100016385
416 Ga0070700_100032937
417 Ga0070694_100010036
418 Ga0070708_100056171
419 Ga0070708_100223796
420 Ga0070708_100371777
421 Ga0070708_100404477
422 Ga0070663_100091357
423 Ga0070662_100032627
424 Ga0070662_100078141
425 Ga0070662_100109485
426 Ga0070681_10009000
427 Ga0070681_10142538
428 Ga0068867_100248678
429 Ga0070685_10008215
430 Ga0070706_100011114
431 Ga0070706_100125112
432 Ga0070706_100130682
433 Ga0070707_100017609
434 Ga0070707_100186142
435 Ga0070698_100020341
436 Ga0070684_100003184
437 Ga0070684_100218774
438 Ga0070684_100276282
439 Ga0070697_100253147
440 Ga0068853_100066603
441 Ga0068853_100592849
442 Ga0070686_100150700
443 Ga0070665_100001482
444 Ga0070665_100032163
445 Ga0070665_100154843
446 Ga0070665_100165428
447 Ga0070665_100165964
448 Ga0070704_100010836
449 Ga0068855_100005044
450 Ga0068855_100069290
451 Ga0068855_100161873
452 Ga0068855_100960134
453 Ga0070664_100089164
454 Ga0070664_100222528
455 Ga0068854_100009719
456 Ga0068856_100480117
457 Ga0070702_100015394
458 Ga0068852_100105905
459 Ga0068852_100329598
460 Ga0068859_100043096
461 Ga0068861_100145809
462 Ga0068863_100005582
463 Ga0068863_100136650
464 Ga0068858_100001325
465 Ga0068858_100010371
466 Ga0068858_100086006
467 Ga0068860_100039062
468 Ga0068862_100071657
469 Ga0068862_100169231
470 Ga0081455_10003444
471 Ga0081455_10005689
472 Ga0081455_10009463
473 Ga0081455_10012503
474 Ga0081455_10015827
475 Ga0081455_10032288
476 Ga0081455_10063276
477 Ga0081455_10106577
478 Ga0081455_10160161
479 Ga0081540_1000380
480 Ga0081540_1121298
481 Ga0070717_10060497
482 Ga0070716_100035495
483 Ga0070712_100368505
484 Ga0097621_100078376
485 Ga0068871_100386638
486 Ga0068871_100457444
487 Ga0075428_100803049
488 Ga0075433_10073939
489 Ga0075434_100120025
490 Ga0068865_100028776
491 Ga0068865_100190072
492 Ga0097620_100043096
493 Ga0075435_100657893
494 Ga0099795_10104683
495 Ga0105240_10000309
496 Ga0105240_10009028
497 Ga0105240_10228544
498 Ga0111539_10500004
499 Ga0105245_10491850
500 Ga0105247_10071269
501 Ga0114129_10064534
502 Ga0105241_10190297
503 Ga0105237_10234724
504 Ga0105249_10007092
505 Ga0105249_10087483
506 Ga0105249_10810209
507 Ga0099796_10119211
508 Ga0105239_10028602
509 Ga0105239_10091552
510 Ga0105239_10129640
511 Ga0105239_10163957
512 Ga0105239_10222051
513 Ga0157371_10069516
514 Ga0157369_10180547
515 Ga0157374_10290896
516 Ga0157374_10700775
517 Ga0157378_10063627
518 Ga0157378_10103531
519 Ga0157378_10167142
520 Ga0157378_10193004
521 Ga0157378_10613393
522 Ga0163162_10021995
523 Ga0163162_10338786
524 Ga0163162_10450960
525 Ga0157372_10624946
526 Ga0157375_10004337
527 Ga0157375_10147239
528 Ga0157375_10491531
529 Ga0163163_10032399
530 Ga0163163_10051190
531 Ga0157379_10013410
532 Ga0157376_10006760
533 Ga0157376_10126516
534 Ga0207666_1000262
535 Ga0207673_1002726
536 Ga0207673_1009114
537 Ga0209050_1001647
538 Ga0207697_10000909
539 Ga0207697_10003385
540 Ga0207697_10004500
541 Ga0207697_10013094
542 Ga0207697_10043420
543 Ga0207656_10015702
544 Ga0207692_10158164
545 Ga0207680_10003078
546 Ga0207647_10002915
547 Ga0207647_10017234
548 Ga0207685_10076439
549 Ga0207699_10106850
550 Ga0207699_10267688
551 Ga0207645_10010003
552 Ga0207645_10193464
553 Ga0207705_10005635
554 Ga0207705_10045188
555 Ga0207684_10008809
556 Ga0207684_10238520
557 Ga0207654_10200922
558 Ga0207707_10192060
559 Ga0207695_10000635
560 Ga0207695_10005921
561 Ga0207695_10269743
562 Ga0207671_10113674
563 Ga0207671_10408507
564 Ga0207693_10083352
565 Ga0207693_10104530
566 Ga0207662_10001771
567 Ga0207662_10110254
568 Ga0207657_10333464
569 Ga0207649_10062338
570 Ga0207649_10100685
571 Ga0207652_10224378
572 Ga0207694_10059797
573 Ga0207659_10005069
574 Ga0207659_10038315
575 Ga0207659_10157617
576 Ga0207700_10002677
577 Ga0207700_10090171
578 Ga0207700_10156648
579 Ga0207664_10106658
580 Ga0207664_10474147
581 Ga0207644_10215437
582 Ga0207644_10307895
583 Ga0207690_10027491
584 Ga0207706_10001926
585 Ga0207706_10031716
586 Ga0207706_10091029
587 Ga0207670_10004308
588 Ga0207704_10002823
589 Ga0207704_10153773
590 Ga0207665_10019872
591 Ga0207665_10056609
592 Ga0207691_10216576
593 Ga0207661_10097207
594 Ga0207661_10352736
595 Ga0207679_10647515
596 Ga0207667_10004581
597 Ga0207667_10103156
598 Ga0207667_10125915
599 Ga0207667_10652276
600 Ga0207651_10038613
601 Ga0207651_10517047
602 Ga0207712_10000165
603 Ga0207712_10014146
604 Ga0207668_10183491
605 Ga0207658_10064495
606 Ga0207658_10087220
607 Ga0207658_10126739
608 Ga0207658_10400563
609 Ga0207677_10081146
610 Ga0207703_10000553
611 Ga0207703_10011087
612 Ga0207703_10032819
613 Ga0207639_10000217
614 Ga0207639_10064361
615 Ga0207678_10005262
616 Ga0207678_10012655
617 Ga0207708_10020294
618 Ga0207641_10019040
619 Ga0207641_10223325
620 Ga0207648_10083359
621 Ga0207648_10606681
622 Ga0207676_10083180
623 Ga0207675_100151250
624 Ga0207698_10258128
625 Ga0207698_10265253
626 Ga0268266_10000006
627 Ga0268266_10038912
628 Ga0268266_10320997
629 Ga0268266_10894557
630 Ga0268265_10106368
631 Ga0268265_10157952
632 Ga0268264_10546915
633 Ga0265334_10019221
634 Ga0265338_10012788
635 Ga0265338_10039659
636 Ga0265338_10086635
637 Ga0265320_10094888
638 Ga0265320_10154267
639 Ga0373957_0047421
640 Ga0373935_0001921
641 Ga0373935_0036790
642 Ga0373933_0266340
643 Ga0373947_0034151
644 Ga0373937_0102016
645 Ga0373937_0118347
646 Ga0373925_0019742
647 Ga0395898_0003345
648 Ga0395905_0302815
649 Ga0395905_0960395
650 Ga0395901_0020303
651 Ga0395901_0101506
652 Ga0436365_0184732
653 Ga0436363_0204116
654 Ga0439455_0019581
655 Ga0439458_0022566
656 Ga0466966_0006940
657 Ga0466966_0099496
658 Ga0466966_0120654
659 Ga0466961_0017055
660 Ga0466961_0063957
661 Ga0466964_0081705
662 Ga0466971_0091279
663 Ga0466970_0226157
664 Ga0466959_0064532
665 Ga0466959_0153520
666 Ga0466958_0603575
667 Ga0466967_0032275
668 Ga0466967_0077088
669 Ga0495592_0122272
670 Ga0495639_0140802
671 Ga0495608_0211294
672 Ga0495628_0109306
673 Ga0495630_0027648
674 Ga0495630_0513580
675 Ga0495630_0522537
676 Ga0495586_0020825
677 Ga0495633_0175313
678 Ga0495634_0080787
679 Ga0495599_0017879
680 Ga0495658_0146651
681 Ga0495669_0084024
682 Ga0495604_0099998
683 Ga0495674_0115364
684 Ga0495674_0139402
685 Ga0495680_0380466
686 Ga0495675_0025275
687 Ga0495675_0114108
688 Ga0495684_0033864
689 Ga0496101_0049947
690 Ga0496102_0019141
691 Ga0496102_0338246
692 Ga0496103_0024181
693 Ga0496103_0109768
694 Ga0496103_0125967
695 Ga0496104_0131529
696 Ga0496104_0160543
697 Ga0496105_0052215
698 Ga0496106_0023733
699 Ga0496107_0111150
700 Ga0496108_0065570
701 Ga0496110_0041442
702 Ga0496111_0051484
703 Ga0496112_0064551
704 Ga0496112_0127997
705 Ga0496112_0155674
706 Ga0496114_0090383
707 Ga0496114_0107382
708 Ga0496115_0246540
709 Ga0496125_0000614
710 Ga0501067_0245610
711 Ga0501044_0752987
712 nmdc:mga05p37_365668_c1
713 nmdc:mga0n895_121565_c1
714 nmdc:mga0n895_139345_c1
715 nmdc:mga0n895_379519_c1
716 nmdc:mga0n895_851448_c1
717 nmdc:mga0rr50_236666_c1
718 nmdc:mga0a205_734389_c1
719 Ga0495601_0286706
720 Ga0466962_0065106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

12

259

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ny7-assembly1.cif.gz_B bond length analysis of the pqqc y175f mutant structure shows evidence for bound pqq in the reduced form 0.9631 1 252
1otw-assembly1.cif.gz_A crystal structure of pqqc in complex with pqq and a putative h2o2 0.957 1 252
5vrd-assembly2.cif.gz_A crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9415 5 259
5vrd-assembly1.cif.gz_D crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9401 5 253
5vrd-assembly1.cif.gz_B crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9315 6 259
ID Description Score Start End Superfamily
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9395 1 252 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8831 11 247 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.871 11 247 1.20.910.10
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.848 1 252 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8097 6 252 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A2V5QPA0-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein C 0.9924 11 252 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A2V5R5A1-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9918 1 252 GO:0006790
GO:0018189
GO:0033732
GO:0048038
GO:0072527
GO:1901615
AF-A0A2V5Q334-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9914 1 252 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A367Q3F4-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9848 2 249 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A239CTY0-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9824 1 249 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615

Map