F421817

General Info

Members Datasets Scaffolds Average Seq Length
360 252 720 170

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100562300|Ga0068856_1005623002
Length 192
Sequence LFNIQGELSYDGYMNTAPTSAEEAAPAAKPAEQTRWLTDDEQRIWRSYLHATTLLEDHLDRQLQRDAGMPHIYYGLLVGLAEAPLQRLRMTELAMKSKITRSRLSHAIARLEKNGWVRREDCPSDKRGQFAVLTEAGAEVLGRTAPGHVTAVRQAVFERLTPQQQETLGEIMQIVAEGLQPSDAGADLPWLR

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
67 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
68 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
69 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
70 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
71 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
75 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
76 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
77 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
78 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
79 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
80 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
81 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
82 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
83 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
84 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
85 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
192 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
193 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
196 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
197 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
198 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
199 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
200 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
201 2643221548 Streptomyces sp. Root55 Isolate Unclassified
202 2643221578 Streptomyces sp. Root63 Isolate Unclassified
203 2643221647 Streptomyces sp. Root369 Isolate Unclassified
204 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
205 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
206 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
207 2643221714 Streptomyces sp. Root264 Isolate Unclassified
208 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
209 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
210 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
211 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
212 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
213 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
214 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
215 2808606448 Streptomyces sp. 193411 Isolate Unclassified
216 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
217 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
218 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
219 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
220 2862574272 Streptomyces sp. AcE210 Isolate Nodule
221 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
222 2867428634 Streptomyces sp. RP5T Isolate Unclassified
223 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
224 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
225 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
226 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
227 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
228 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
229 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
230 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
231 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
232 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
233 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
234 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
235 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
236 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
237 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
238 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
239 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
240 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
241 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
242 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
243 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
244 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
245 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
246 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
247 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
248 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
249 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
250 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
251 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
252 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.61
Metatranscriptomes 0.28
Isolates 16.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.94
Nodule 1.11
Rhizoplane 1.94
Rhizosphere 75.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100562300 3300005614 Bacteria 1162
2 JGI24739J22299_10004205 3300001989 Bacteria 5509
3 JGI24737J22298_10009073 3300001990 Bacteria 3315
4 rootH1_10003215 3300003316 Bacteria 4528
5 rootH1_10015984 3300003316 Bacteria 1598
6 rootH2_10051182 3300003320 Bacteria 4901
7 rootL2_10055153 3300003322 Bacteria 4445
8 rootL2_10088180 3300003322 Bacteria 1074
9 rootH1_10027833 3300003323 Bacteria 7473
10 rootH1_10039491 3300003323 Bacteria 3278
11 rootH1_10039492 3300003323 Bacteria 3243
12 JGI25160J50197_1022600 3300003354 Bacteria 1839
13 Ga0006562J51391_1065940 3300003578 Bacteria 6792
14 Ga0070670_100329950 3300005331 Bacteria 1338
15 Ga0070663_100457198 3300005455 Bacteria 1053
16 Ga0068853_100022405 3300005539 Bacteria 5276
17 Ga0081455_10029751 3300005937 Bacteria 4974
18 Ga0075365_10041879 3300006038 Bacteria 2993
19 Ga0075365_10547743 3300006038 Bacteria 818
20 Ga0075368_10006104 3300006042 Bacteria 4188
21 Ga0075363_100006154 3300006048 Bacteria 5423
22 Ga0075367_10014387 3300006178 Bacteria 4283
23 Ga0075367_10551058 3300006178 Bacteria 732
24 Ga0075370_10059297 3300006353 Bacteria 2178
25 Ga0075370_10187593 3300006353 Bacteria 1218
26 Ga0099826_10064064 3300006948 Bacteria 2371
27 Ga0105251_10004016 3300009011 Bacteria 10383
28 Ga0105251_10098235 3300009011 Bacteria 1340
29 Ga0105244_10137727 3300009036 Bacteria 1175
30 Ga0105250_10119258 3300009092 Bacteria 1083
31 Ga0105245_10430720 3300009098 Bacteria 1324
32 Ga0105247_10191224 3300009101 Bacteria 1370
33 Ga0105243_11789143 3300009148 Bacteria 645
34 Ga0105248_10312081 3300009177 Bacteria 1771
35 Ga0105238_10350522 3300009551 Bacteria 1465
36 Ga0105249_10483055 3300009553 Bacteria 1282
37 Ga0105239_10134901 3300010375 Bacteria 2748
38 Ga0105239_10692699 3300010375 Bacteria 1165
39 Ga0105246_10004492 3300011119 Bacteria 8484
40 Ga0105246_10134523 3300011119 Bacteria 1851
41 Ga0105246_11004235 3300011119 Bacteria 756
42 Ga0157369_10582788 3300013105 Bacteria 1155
43 Ga0163162_11774922 3300013306 Bacteria 705
44 Ga0157372_10077839 3300013307 Bacteria 3747
45 Ga0182008_10000456 3300014497 Bacteria 31212
46 Ga0182006_1036404 3300015261 Bacteria 1957
47 Ga0182007_10003402 3300015262 Bacteria 7498
48 Ga0182005_1006184 3300015265 Bacteria 3679
49 Ga0183367_1005 3300015688 Bacteria 652063
50 Ga0209758_1004940 3300025297 Bacteria 10705
51 Ga0207426_1002456 3300025302 Bacteria 11801
52 Ga0207426_1003457 3300025302 Bacteria 8551
53 Ga0207426_1013176 3300025302 Bacteria 3074
54 Ga0207696_1095709 3300025711 Bacteria 812
55 Ga0207713_1092471 3300025735 Bacteria 1060
56 Ga0207647_10003562 3300025904 Bacteria 11685
57 Ga0207694_10272057 3300025924 Bacteria 1390
58 Ga0207650_10403329 3300025925 Bacteria 1132
59 Ga0207687_10162484 3300025927 Bacteria 1715
60 Ga0207709_10281913 3300025935 Bacteria 1228
61 Ga0207639_10639133 3300026041 Bacteria 984
62 Ga0209371_1033478 3300027312 Bacteria 1096
63 Ga0209813_10007360 3300027866 Bacteria 2740
64 Ga0307515_10175996 3300028794 Bacteria 2110
65 Ga0268256_1038111 3300030500 Bacteria 1096
66 Ga0307511_10006909 3300030521 Bacteria 11434
67 Ga0307511_10090842 3300030521 Bacteria 2071
68 Ga0307512_10042740 3300030522 Bacteria 3748
69 Ga0307513_10001072 3300031456 Bacteria 39827
70 Ga0307513_10022441 3300031456 Bacteria 7420
71 Ga0307513_10042732 3300031456 Bacteria 4987
72 Ga0307509_10098008 3300031507 Bacteria 2978
73 Ga0307514_10002256 3300031649 Bacteria 20496
74 Ga0307514_10366941 3300031649 Bacteria 756
75 Ga0307516_10001402 3300031730 Bacteria 33337
76 Ga0307516_10019976 3300031730 Bacteria 6925
77 Ga0307516_10606628 3300031730 Bacteria 749
78 Ga0307518_10213558 3300031838 Bacteria 1267
79 Ga0307409_100821900 3300031995 Bacteria 938
80 Ga0307416_101124626 3300032002 Bacteria 890
81 Ga0307510_10035767 3300033180 Bacteria 5538
82 Ga0395900_0449333 3300037418 Bacteria 1245
83 Ga0395898_0001842 3300037466 Bacteria 27261
84 Ga0395898_0011572 3300037466 Bacteria 9161
85 Ga0395898_0781212 3300037466 Bacteria 896
86 Ga0395901_0246635 3300038443 Bacteria 1861
87 Ga0439436_0006026 3300041404 Bacteria 3714
88 Ga0439436_0006483 3300041404 Bacteria 3592
89 Ga0439439_0013273 3300041406 Bacteria 1996
90 Ga0451797_1048600 3300041453 Bacteria 1112
91 Ga0451802_0136688 3300041460 Bacteria 2264
92 Ga0451802_1100271 3300041460 Bacteria 750
93 Ga0451807_2288342 3300041486 Bacteria 889
94 Ga0451837_1399963 3300041494 Bacteria 4111
95 Ga0451841_1215148 3300041498 Bacteria 1085
96 Ga0451853_0721026 3300041512 Bacteria 6288
97 Ga0451853_1176982 3300041512 Bacteria 2299
98 Ga0451853_2831343 3300041512 Bacteria 1138
99 Ga0439442_015561 3300042002 Bacteria 1567
100 Ga0439448_0003611 3300042005 Bacteria 4305
101 Ga0439449_0002399 3300042007 Bacteria 7330
102 Ga0439449_0027359 3300042007 Bacteria 2128
103 Ga0439449_0035543 3300042007 Bacteria 1855
104 Ga0439449_0294482 3300042007 Bacteria 612
105 Ga0439455_0001019 3300042012 Bacteria 4413
106 Ga0439457_000284 3300042014 Bacteria 14024
107 Ga0439457_002513 3300042014 Bacteria 5222
108 Ga0439462_0026308 3300042015 Bacteria 1533
109 Ga0439462_0117886 3300042015 Bacteria 737
110 Ga0450894_000275 3300042131 Bacteria 9228
111 Ga0450895_012577 3300042132 Bacteria 738
112 Ga0450903_000175 3300042138 Bacteria 14130
113 Ga0450906_010561 3300042145 Bacteria 1744
114 Ga0439458_0002847 3300042157 Bacteria 4163
115 Ga0450908_082340 3300042184 Bacteria 578
116 Ga0466972_0002367 3300044658 Bacteria 9298
117 Ga0466972_0011266 3300044658 Bacteria 4487
118 Ga0466972_0018110 3300044658 Bacteria 3523
119 Ga0466965_0000433 3300044683 Bacteria 14524
120 Ga0466966_0000541 3300044684 Bacteria 24070
121 Ga0466966_0019809 3300044684 Bacteria 4425
122 Ga0466966_0500106 3300044684 Bacteria 731
123 Ga0466961_0006317 3300044693 Bacteria 7523
124 Ga0466961_0009187 3300044693 Bacteria 6295
125 Ga0466963_0000453 3300044694 Bacteria 19007
126 Ga0466963_0036056 3300044694 Bacteria 3224
127 Ga0466964_0008217 3300044706 Bacteria 3915
128 Ga0466964_0162504 3300044706 Bacteria 1045
129 Ga0466971_0001302 3300044719 Bacteria 10423
130 Ga0466968_0039260 3300044735 Bacteria 1992
131 Ga0466970_0017103 3300044765 Bacteria 3744
132 Ga0466957_0007477 3300044842 Bacteria 6171
133 Ga0466960_0005146 3300044901 Bacteria 5170
134 Ga0466959_0023723 3300045049 Bacteria 4540
135 Ga0466959_0510719 3300045049 Bacteria 812
136 Ga0466958_0004428 3300045836 Bacteria 7417
137 Ga0466958_0867853 3300045836 Bacteria 589
138 Ga0466967_0202321 3300045976 Bacteria 1881
139 Ga0495603_0007890 3300046455 Bacteria 6420
140 Ga0495603_0017290 3300046455 Bacteria 4366
141 Ga0495629_0013088 3300046459 Bacteria 5994
142 Ga0495629_0013433 3300046459 Bacteria 5906
143 Ga0495629_0109663 3300046459 Bacteria 1924
144 Ga0495629_0374317 3300046459 Bacteria 970
145 Ga0495629_0419118 3300046459 Bacteria 909
146 Ga0495651_0026186 3300046462 Bacteria 4542
147 Ga0495580_0068563 3300046472 Bacteria 2480
148 Ga0495605_0014895 3300046474 Bacteria 4242
149 Ga0495662_0022277 3300046476 Bacteria 3060
150 Ga0495664_0638203 3300046477 Bacteria 631
151 Ga0495585_0076016 3300046492 Bacteria 1825
152 Ga0495585_0088272 3300046492 Bacteria 1672
153 Ga0495585_0124522 3300046492 Bacteria 1361
154 Ga0495594_0000823 3300046499 Bacteria 16005
155 Ga0495594_0072444 3300046499 Bacteria 1916
156 Ga0495594_0332461 3300046499 Bacteria 865
157 Ga0495596_0092251 3300046500 Bacteria 1176
158 Ga0495607_0009181 3300046501 Bacteria 6720
159 Ga0495583_0116894 3300046506 Bacteria 1125
160 Ga0495606_0042087 3300046507 Bacteria 3058
161 Ga0495608_0159779 3300046511 Bacteria 1433
162 Ga0495610_0024412 3300046512 Bacteria 3263
163 Ga0495618_0579250 3300046514 Bacteria 669
164 Ga0495630_0843584 3300046517 Bacteria 699
165 Ga0495631_0013988 3300046518 Bacteria 3880
166 Ga0495643_0003031 3300046522 Bacteria 12631
167 Ga0495644_0013466 3300046523 Bacteria 3137
168 Ga0495648_0016567 3300046524 Bacteria 5308
169 Ga0495648_0084068 3300046524 Bacteria 1802
170 Ga0495642_0254421 3300046528 Bacteria 768
171 Ga0495652_0196763 3300046529 Bacteria 1533
172 Ga0495654_0016810 3300046530 Bacteria 3855
173 Ga0495640_0031934 3300046533 Bacteria 3754
174 Ga0495622_0012173 3300046557 Bacteria 3979
175 Ga0495622_0025203 3300046557 Bacteria 2777
176 Ga0495633_0022864 3300046558 Bacteria 3102
177 Ga0495633_0134098 3300046558 Bacteria 1146
178 Ga0495667_0334062 3300046559 Bacteria 958
179 Ga0495668_0025448 3300046616 Bacteria 3362
180 Ga0495668_0298651 3300046616 Bacteria 883
181 Ga0495668_0579524 3300046616 Bacteria 619
182 Ga0495634_0103022 3300046642 Bacteria 1842
183 Ga0495611_0014047 3300046648 Bacteria 3416
184 Ga0495611_0062492 3300046648 Bacteria 1694
185 Ga0495625_0088232 3300046660 Bacteria 2149
186 Ga0495625_0093318 3300046660 Bacteria 2078
187 Ga0495635_0178109 3300046663 Bacteria 1445
188 Ga0495661_0157826 3300046665 Bacteria 1220
189 Ga0495588_0001468 3300046674 Bacteria 10118
190 Ga0495588_0484672 3300046674 Bacteria 648
191 Ga0495599_0037309 3300046678 Bacteria 3053
192 Ga0495623_0567752 3300046679 Bacteria 592
193 Ga0495613_0032190 3300046689 Bacteria 3894
194 Ga0495613_0076057 3300046689 Bacteria 2443
195 Ga0495624_0059481 3300046690 Bacteria 2397
196 Ga0495670_0073579 3300046691 Bacteria 1732
197 Ga0495670_0537101 3300046691 Bacteria 636
198 Ga0495671_0097237 3300046692 Bacteria 1440
199 Ga0495649_0022440 3300046694 Bacteria 3532
200 Ga0495649_0090719 3300046694 Bacteria 1629
201 Ga0495589_0007368 3300046794 Bacteria 5760
202 Ga0495589_0035449 3300046794 Bacteria 2501
203 Ga0495589_0036832 3300046794 Bacteria 2452
204 Ga0495589_0273989 3300046794 Bacteria 785
205 Ga0495660_0112469 3300046810 Bacteria 1387
206 Ga0495581_0044453 3300047315 Bacteria 2568
207 Ga0495581_0062976 3300047315 Bacteria 2143
208 Ga0495604_0028521 3300047317 Bacteria 4441
209 Ga0495636_0002162 3300047318 Bacteria 7539
210 Ga0495636_0047917 3300047318 Bacteria 1785
211 Ga0495636_0118759 3300047318 Bacteria 1168
212 Ga0495672_0283888 3300047320 Bacteria 790
213 Ga0495676_0002496 3300047321 Bacteria 16373
214 Ga0495676_0013060 3300047321 Bacteria 7472
215 Ga0495676_0023875 3300047321 Bacteria 5298
216 Ga0495676_0043001 3300047321 Bacteria 3701
217 Ga0495676_0332532 3300047321 Bacteria 1018
218 Ga0495676_0761837 3300047321 Bacteria 624
219 Ga0495680_0074121 3300047322 Bacteria 2585
220 Ga0495683_0071758 3300047323 Bacteria 1699
221 Ga0495687_006754 3300047443 Bacteria 6939
222 Ga0495687_007292 3300047443 Bacteria 6550
223 Ga0495687_027090 3300047443 Bacteria 2686
224 Ga0495687_068277 3300047443 Bacteria 1435
225 Ga0495687_172169 3300047443 Bacteria 716
226 Ga0495687_180928 3300047443 Bacteria 688
227 Ga0495687_226092 3300047443 Bacteria 575
228 Ga0495685_008409 3300047447 Bacteria 3427
229 Ga0495685_025646 3300047447 Bacteria 2027
230 Ga0495685_049520 3300047447 Bacteria 1427
231 Ga0495681_0027898 3300047470 Bacteria 2915
232 Ga0495684_0256524 3300047471 Bacteria 1270
233 Ga0495686_0029291 3300047472 Bacteria 3582
234 Ga0495593_0199907 3300047673 Bacteria 1004
235 Ga0495602_0156606 3300048088 Bacteria 1783
236 Ga0495614_0000629 3300048089 Bacteria 14764
237 Ga0495626_0032973 3300048091 Bacteria 2483
238 Ga0496106_0406171 3300048909 Bacteria 1095
239 Ga0496109_0235954 3300048912 Bacteria 1721
240 Ga0496113_1561882 3300048916 Bacteria 508
241 Ga0496124_0400666 3300048927 Bacteria 953
242 Ga0495678_013508 3300049459 Bacteria 3832
243 Ga0495682_0041213 3300049460 Bacteria 1693
244 Ga0501032_0132085 3300049569 Bacteria 1647
245 Ga0501032_0220777 3300049569 Bacteria 1233
246 Ga0501033_0006034 3300049570 Bacteria 9500
247 Ga0501033_0008132 3300049570 Bacteria 8121
248 Ga0501033_0031031 3300049570 Bacteria 4017
249 Ga0501034_0047519 3300049571 Bacteria 4333
250 Ga0501034_0085073 3300049571 Bacteria 3164
251 Ga0501034_0208817 3300049571 Bacteria 1908
252 Ga0501036_0000345 3300049572 Bacteria 32636
253 Ga0501036_0004088 3300049572 Bacteria 11744
254 Ga0501036_0018259 3300049572 Bacteria 5874
255 Ga0501037_0017686 3300049573 Bacteria 5247
256 Ga0501037_0103353 3300049573 Bacteria 2055
257 Ga0501038_0000447 3300049574 Bacteria 35997
258 Ga0501038_0055538 3300049574 Bacteria 3401
259 Ga0501038_0067044 3300049574 Bacteria 3054
260 Ga0501038_0393681 3300049574 Bacteria 1073
261 Ga0501039_0112136 3300049575 Bacteria 2132
262 Ga0501041_0021505 3300049577 Bacteria 3864
263 Ga0501043_0003523 3300049579 Bacteria 12872
264 Ga0501043_0007930 3300049579 Bacteria 8391
265 Ga0501043_0105802 3300049579 Bacteria 2210
266 Ga0501043_0226673 3300049579 Bacteria 1444
267 Ga0501046_0396396 3300049580 Bacteria 997
268 Ga0501047_0052964 3300049581 Bacteria 3923
269 Ga0501047_0055100 3300049581 Bacteria 3845
270 Ga0501047_0058266 3300049581 Bacteria 3731
271 Ga0501047_0227728 3300049581 Bacteria 1718
272 Ga0501068_0043884 3300049584 Bacteria 2691
273 Ga0501070_0000263 3300049586 Bacteria 49655
274 Ga0501070_0021945 3300049586 Bacteria 5349
275 Ga0501074_0010341 3300049590 Bacteria 6770
276 Ga0501074_0039236 3300049590 Bacteria 3429
277 Ga0501080_0405884 3300049742 Bacteria 1225
278 Ga0501035_0003454 3300049822 Bacteria 15119
279 Ga0501035_0016638 3300049822 Bacteria 6782
280 Ga0501035_0064596 3300049822 Bacteria 3252
281 Ga0501035_0253203 3300049822 Bacteria 1495
282 Ga0501044_0002582 3300049823 Bacteria 20610
283 Ga0501044_0027198 3300049823 Bacteria 6047
284 Ga0501044_0047454 3300049823 Bacteria 4441
285 Ga0501044_0059767 3300049823 Bacteria 3904
286 Ga0501044_0211130 3300049823 Bacteria 1895
287 Ga0501045_0160259 3300049824 Bacteria 1674
288 Ga0501045_0669559 3300049824 Bacteria 766
289 nmdc:mga03n38_274361_c1 3300050490 Bacteria 898
290 nmdc:mga03n38_468685_c1 3300050490 Bacteria 703
291 nmdc:mga0yw44_82597_c1 3300050492 Bacteria 2016
292 nmdc:mga06z11_2058_c1 3300050494 Bacteria 7634
293 nmdc:mga04h51_8558_c1 3300050495 Bacteria 2740
294 nmdc:mga07m45_38558_c1 3300050496 Bacteria 2666
295 Ga0500578_0518220 3300053086 Bacteria 668
296 Ga0500573_0201173 3300053140 Bacteria 1057
297 Ga0500600_0104745 3300053149 Bacteria 1486
298 Ga0500634_0059381 3300053161 Bacteria 2035
299 Ga0500634_0186017 3300053161 Bacteria 929
300 Ga0590074_037621 3300059423 Bacteria 866
301 Ga0466962_0000491 3300061719 Bacteria 17164
302 Ga0466962_0126515 3300061719 Bacteria 1234
303 2547408041 2547132111 Bacteria 8013147
304 2554257985 2554235005 Bacteria 6457341
305 2585302212 2582581312 Bacteria 7308206
306 2585308603 2582581313 Bacteria 10042643
307 2585318708 2582581314 Bacteria 11452267
308 2616695252 2616644814 Bacteria 11555299
309 2643765739 2643221548 Bacteria 8053412
310 2643898467 2643221578 Bacteria 9213798
311 2644264144 2643221647 Bacteria 10741251
312 2644406383 2643221673 Bacteria 9196637
313 2644437033 2643221678 Bacteria 9540101
314 2644459851 2643221682 Bacteria 6743283
315 2644628779 2643221714 Bacteria 9015452
316 2784588494 2784132148 Bacteria 8627943
317 2785343468 2784746763 Bacteria 9783172
318 2785369332 2784746768 Bacteria 10036182
319 2786670465 2786546132 Bacteria 10419719
320 2804847167 2802429296 Bacteria 7227771
321 2808841932 2808606359 Bacteria 9866990
322 2808920475 2808606375 Bacteria 9466072
323 2809232090 2808606448 Bacteria 8656184
324 2819697974 2818991463 Bacteria 7948711
325 2862285534 2862281513 Bacteria 9621493
326 2862386112 2862382967 Bacteria 10317375
327 2862515269 2862507626 Bacteria 9425308
328 2862579350 2862574272 Bacteria 10567477
329 2863404821 2863404153 Bacteria 9672205
330 2867434226 2867428634 Bacteria 9590268
331 2875394449 2875391855 Bacteria 7600475
332 2877681219 2877676314 Bacteria 9512378
333 2912720167 2912715099 Bacteria 9460473
334 2919469625 2919468124 Bacteria 9133025
335 2946050156 2946045630 Bacteria 8527308
336 2946075802 2946072368 Bacteria 8999607
337 2954007612 2954002825 Bacteria 9173742
338 2954386368 2954380949 Bacteria 10050426
339 2954676811 2954673503 Bacteria 9685905
340 2954687355 2954682443 Bacteria 9862841
341 2954697039 2954691527 Bacteria 10720516
342 2954705094 2954701450 Bacteria 10834262
343 2954716352 2954711539 Bacteria 10867210
344 2954726296 2954721474 Bacteria 10456478
345 2954735515 2954731030 Bacteria 10243860
346 2954745220 2954740390 Bacteria 10229294
347 2954754369 2954749733 Bacteria 10366972
348 2954764195 2954759201 Bacteria 9358192
349 2966602670 2966598605 Bacteria 7676064
350 2990062097 2990059506 Bacteria 9321252
351 2997458448 2997451912 Bacteria 8492419
352 3006398502 3006393351 Bacteria 6615579
353 3006496179 3006493962 Bacteria 8825450
354 8008567454 8008558824 Bacteria 10610750
355 8008578954 8008574985 Bacteria 7815457
356 8023631264 8023623736 Bacteria 8593882
357 8025414364 8025413630 Bacteria 7014048
358 8048410173 8048406513 Bacteria 8936924
359 8056671871 8056667051 Bacteria 6953971
360 8056831850 8056829672 Bacteria 9045328
361 Ga0068856_100562300
362 JGI24739J22299_10004205
363 JGI24737J22298_10009073
364 rootH1_10003215
365 rootH1_10015984
366 rootH2_10051182
367 rootL2_10055153
368 rootL2_10088180
369 rootH1_10027833
370 rootH1_10039491
371 rootH1_10039492
372 JGI25160J50197_1022600
373 Ga0006562J51391_1065940
374 Ga0070670_100329950
375 Ga0070663_100457198
376 Ga0068853_100022405
377 Ga0081455_10029751
378 Ga0075365_10041879
379 Ga0075365_10547743
380 Ga0075368_10006104
381 Ga0075363_100006154
382 Ga0075367_10014387
383 Ga0075367_10551058
384 Ga0075370_10059297
385 Ga0075370_10187593
386 Ga0099826_10064064
387 Ga0105251_10004016
388 Ga0105251_10098235
389 Ga0105244_10137727
390 Ga0105250_10119258
391 Ga0105245_10430720
392 Ga0105247_10191224
393 Ga0105243_11789143
394 Ga0105248_10312081
395 Ga0105238_10350522
396 Ga0105249_10483055
397 Ga0105239_10134901
398 Ga0105239_10692699
399 Ga0105246_10004492
400 Ga0105246_10134523
401 Ga0105246_11004235
402 Ga0157369_10582788
403 Ga0163162_11774922
404 Ga0157372_10077839
405 Ga0182008_10000456
406 Ga0182006_1036404
407 Ga0182007_10003402
408 Ga0182005_1006184
409 Ga0183367_1005
410 Ga0209758_1004940
411 Ga0207426_1002456
412 Ga0207426_1003457
413 Ga0207426_1013176
414 Ga0207696_1095709
415 Ga0207713_1092471
416 Ga0207647_10003562
417 Ga0207694_10272057
418 Ga0207650_10403329
419 Ga0207687_10162484
420 Ga0207709_10281913
421 Ga0207639_10639133
422 Ga0209371_1033478
423 Ga0209813_10007360
424 Ga0307515_10175996
425 Ga0268256_1038111
426 Ga0307511_10006909
427 Ga0307511_10090842
428 Ga0307512_10042740
429 Ga0307513_10001072
430 Ga0307513_10022441
431 Ga0307513_10042732
432 Ga0307509_10098008
433 Ga0307514_10002256
434 Ga0307514_10366941
435 Ga0307516_10001402
436 Ga0307516_10019976
437 Ga0307516_10606628
438 Ga0307518_10213558
439 Ga0307409_100821900
440 Ga0307416_101124626
441 Ga0307510_10035767
442 Ga0395900_0449333
443 Ga0395898_0001842
444 Ga0395898_0011572
445 Ga0395898_0781212
446 Ga0395901_0246635
447 Ga0439436_0006026
448 Ga0439436_0006483
449 Ga0439439_0013273
450 Ga0451797_1048600
451 Ga0451802_0136688
452 Ga0451802_1100271
453 Ga0451807_2288342
454 Ga0451837_1399963
455 Ga0451841_1215148
456 Ga0451853_0721026
457 Ga0451853_1176982
458 Ga0451853_2831343
459 Ga0439442_015561
460 Ga0439448_0003611
461 Ga0439449_0002399
462 Ga0439449_0027359
463 Ga0439449_0035543
464 Ga0439449_0294482
465 Ga0439455_0001019
466 Ga0439457_000284
467 Ga0439457_002513
468 Ga0439462_0026308
469 Ga0439462_0117886
470 Ga0450894_000275
471 Ga0450895_012577
472 Ga0450903_000175
473 Ga0450906_010561
474 Ga0439458_0002847
475 Ga0450908_082340
476 Ga0466972_0002367
477 Ga0466972_0011266
478 Ga0466972_0018110
479 Ga0466965_0000433
480 Ga0466966_0000541
481 Ga0466966_0019809
482 Ga0466966_0500106
483 Ga0466961_0006317
484 Ga0466961_0009187
485 Ga0466963_0000453
486 Ga0466963_0036056
487 Ga0466964_0008217
488 Ga0466964_0162504
489 Ga0466971_0001302
490 Ga0466968_0039260
491 Ga0466970_0017103
492 Ga0466957_0007477
493 Ga0466960_0005146
494 Ga0466959_0023723
495 Ga0466959_0510719
496 Ga0466958_0004428
497 Ga0466958_0867853
498 Ga0466967_0202321
499 Ga0495603_0007890
500 Ga0495603_0017290
501 Ga0495629_0013088
502 Ga0495629_0013433
503 Ga0495629_0109663
504 Ga0495629_0374317
505 Ga0495629_0419118
506 Ga0495651_0026186
507 Ga0495580_0068563
508 Ga0495605_0014895
509 Ga0495662_0022277
510 Ga0495664_0638203
511 Ga0495585_0076016
512 Ga0495585_0088272
513 Ga0495585_0124522
514 Ga0495594_0000823
515 Ga0495594_0072444
516 Ga0495594_0332461
517 Ga0495596_0092251
518 Ga0495607_0009181
519 Ga0495583_0116894
520 Ga0495606_0042087
521 Ga0495608_0159779
522 Ga0495610_0024412
523 Ga0495618_0579250
524 Ga0495630_0843584
525 Ga0495631_0013988
526 Ga0495643_0003031
527 Ga0495644_0013466
528 Ga0495648_0016567
529 Ga0495648_0084068
530 Ga0495642_0254421
531 Ga0495652_0196763
532 Ga0495654_0016810
533 Ga0495640_0031934
534 Ga0495622_0012173
535 Ga0495622_0025203
536 Ga0495633_0022864
537 Ga0495633_0134098
538 Ga0495667_0334062
539 Ga0495668_0025448
540 Ga0495668_0298651
541 Ga0495668_0579524
542 Ga0495634_0103022
543 Ga0495611_0014047
544 Ga0495611_0062492
545 Ga0495625_0088232
546 Ga0495625_0093318
547 Ga0495635_0178109
548 Ga0495661_0157826
549 Ga0495588_0001468
550 Ga0495588_0484672
551 Ga0495599_0037309
552 Ga0495623_0567752
553 Ga0495613_0032190
554 Ga0495613_0076057
555 Ga0495624_0059481
556 Ga0495670_0073579
557 Ga0495670_0537101
558 Ga0495671_0097237
559 Ga0495649_0022440
560 Ga0495649_0090719
561 Ga0495589_0007368
562 Ga0495589_0035449
563 Ga0495589_0036832
564 Ga0495589_0273989
565 Ga0495660_0112469
566 Ga0495581_0044453
567 Ga0495581_0062976
568 Ga0495604_0028521
569 Ga0495636_0002162
570 Ga0495636_0047917
571 Ga0495636_0118759
572 Ga0495672_0283888
573 Ga0495676_0002496
574 Ga0495676_0013060
575 Ga0495676_0023875
576 Ga0495676_0043001
577 Ga0495676_0332532
578 Ga0495676_0761837
579 Ga0495680_0074121
580 Ga0495683_0071758
581 Ga0495687_006754
582 Ga0495687_007292
583 Ga0495687_027090
584 Ga0495687_068277
585 Ga0495687_172169
586 Ga0495687_180928
587 Ga0495687_226092
588 Ga0495685_008409
589 Ga0495685_025646
590 Ga0495685_049520
591 Ga0495681_0027898
592 Ga0495684_0256524
593 Ga0495686_0029291
594 Ga0495593_0199907
595 Ga0495602_0156606
596 Ga0495614_0000629
597 Ga0495626_0032973
598 Ga0496106_0406171
599 Ga0496109_0235954
600 Ga0496113_1561882
601 Ga0496124_0400666
602 Ga0495678_013508
603 Ga0495682_0041213
604 Ga0501032_0132085
605 Ga0501032_0220777
606 Ga0501033_0006034
607 Ga0501033_0008132
608 Ga0501033_0031031
609 Ga0501034_0047519
610 Ga0501034_0085073
611 Ga0501034_0208817
612 Ga0501036_0000345
613 Ga0501036_0004088
614 Ga0501036_0018259
615 Ga0501037_0017686
616 Ga0501037_0103353
617 Ga0501038_0000447
618 Ga0501038_0055538
619 Ga0501038_0067044
620 Ga0501038_0393681
621 Ga0501039_0112136
622 Ga0501041_0021505
623 Ga0501043_0003523
624 Ga0501043_0007930
625 Ga0501043_0105802
626 Ga0501043_0226673
627 Ga0501046_0396396
628 Ga0501047_0052964
629 Ga0501047_0055100
630 Ga0501047_0058266
631 Ga0501047_0227728
632 Ga0501068_0043884
633 Ga0501070_0000263
634 Ga0501070_0021945
635 Ga0501074_0010341
636 Ga0501074_0039236
637 Ga0501080_0405884
638 Ga0501035_0003454
639 Ga0501035_0016638
640 Ga0501035_0064596
641 Ga0501035_0253203
642 Ga0501044_0002582
643 Ga0501044_0027198
644 Ga0501044_0047454
645 Ga0501044_0059767
646 Ga0501044_0211130
647 Ga0501045_0160259
648 Ga0501045_0669559
649 nmdc:mga03n38_274361_c1
650 nmdc:mga03n38_468685_c1
651 nmdc:mga0yw44_82597_c1
652 nmdc:mga06z11_2058_c1
653 nmdc:mga04h51_8558_c1
654 nmdc:mga07m45_38558_c1
655 Ga0500578_0518220
656 Ga0500573_0201173
657 Ga0500600_0104745
658 Ga0500634_0059381
659 Ga0500634_0186017
660 Ga0590074_037621
661 Ga0466962_0000491
662 Ga0466962_0126515
663 2547408041
664 2554257985
665 2585302212
666 2585308603
667 2585318708
668 2616695252
669 2643765739
670 2643898467
671 2644264144
672 2644406383
673 2644437033
674 2644459851
675 2644628779
676 2784588494
677 2785343468
678 2785369332
679 2786670465
680 2804847167
681 2808841932
682 2808920475
683 2809232090
684 2819697974
685 2862285534
686 2862386112
687 2862515269
688 2862579350
689 2863404821
690 2867434226
691 2875394449
692 2877681219
693 2912720167
694 2919469625
695 2946050156
696 2946075802
697 2954007612
698 2954386368
699 2954676811
700 2954687355
701 2954697039
702 2954705094
703 2954716352
704 2954726296
705 2954735515
706 2954745220
707 2954754369
708 2954764195
709 2966602670
710 2990062097
711 2997458448
712 3006398502
713 3006496179
714 8008567454
715 8008578954
716 8023631264
717 8025414364
718 8048410173
719 8056671871
720 8056831850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

67

128

0.97

PF01047

MarR

MarR family

76

128

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zpl-assembly2.cif.gz_F crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9774 23 179
3zpl-assembly1.cif.gz_B crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9763 21 179
3zpl-assembly2.cif.gz_F crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9712 23 179
3zpl-assembly1.cif.gz_B crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9703 21 179
5w1e-assembly1.cif.gz_A pobr in complex with phb 0.968 59 121
ID Description Score Start End Superfamily
3zplA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9718 21 179 1.10.10.10
3zplA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9658 21 179 1.10.10.10
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9469 21 166 1.10.10.10
af_P71977_12_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9279 59 109 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.924 56 133 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0DUB7-F1-model_v4 MarR family transcriptional regulator 0.9814 20 179 GO:0003700
GO:0006950
AF-A0A6G9F6K0-F1-model_v4 deleted 0.9784 32 179
AF-A0A4R9ERZ2-F1-model_v4 MarR family transcriptional regulator 0.9763 18 179 GO:0003700
GO:0006950
AF-A0A1M5HNA4-F1-model_v4 Transcriptional regulator, MarR family 0.9761 21 166 GO:0003700
GO:0006950
AF-A0A7W0DUB7-F1-model_v4 MarR family transcriptional regulator 0.9754 20 179 GO:0003700
GO:0006950

Map