F421674

General Info

Members Datasets Scaffolds Average Seq Length
359 214 718 257

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0038664|Ga0501070_0038664_1327_2160
Length 277
Sequence VTEEKAVNEVLEQVLGDLTAEGDALEQAVLPLDEQGWRTPVPAEGWDIATTIVHLAWTDEAALAAGTDKEAWDALVMAAIGDPTGYVDSIAFEGAKAPATEILARWRAARPALVSMLRDFPQGQKLPWFGPPMSPTSMATARFMETWAHALDVYDALASTGEITGRPEPTDRIRHIAHLGVRTRNFAFGVHGLEPPTEEFRVELVAPSGALWTWGPEDAAQRVTGPAYDFCLRVTQRQHRDDLALVATGPDADRWLDIAQAFAGPSGAGREPVVRGG

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2643221561 Nocardioides sp. Root151 Isolate Unclassified
206 2643221576 Nocardioides sp. Root614 Isolate Unclassified
207 2643221617 Nocardioides sp. Root79 Isolate Unclassified
208 2643221620 Nocardioides sp. Root240 Isolate Unclassified
209 2643221696 Nocardioides sp. Root140 Isolate Unclassified
210 2738541305 Nocardioides sp. CF167 Isolate Unclassified
211 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
212 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
213 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
214 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0.28
Isolates 2.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.06
Nodule 0
Rhizoplane 6.96
Rhizosphere 65.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0038664 3300049586 Bacteria 3981
2 Ga0006562J51391_1105644 3300003578 Bacteria 1798
3 Ga0070658_10003579 3300005327 Bacteria 12742
4 Ga0070658_10030620 3300005327 Bacteria 4323
5 Ga0070683_100079449 3300005329 Bacteria 3070
6 Ga0070683_100091020 3300005329 Bacteria 2864
7 Ga0068869_100100174 3300005334 Bacteria 2190
8 Ga0068868_100275140 3300005338 Bacteria 1423
9 Ga0070660_100043611 3300005339 Bacteria 3428
10 Ga0070689_100448290 3300005340 Bacteria 1098
11 Ga0070661_100088674 3300005344 Bacteria 2290
12 Ga0070661_100117181 3300005344 Bacteria 1992
13 Ga0070692_10326997 3300005345 Bacteria 945
14 Ga0070668_100030182 3300005347 Bacteria 4121
15 Ga0070668_100519876 3300005347 Bacteria 1033
16 Ga0070675_100223181 3300005354 Bacteria 1641
17 Ga0070674_100063058 3300005356 Bacteria 2593
18 Ga0070688_100394852 3300005365 Bacteria 1022
19 Ga0070659_100008414 3300005366 Bacteria 7536
20 Ga0070659_100161994 3300005366 Bacteria 1829
21 Ga0070659_100264542 3300005366 Bacteria 1427
22 Ga0070659_100574383 3300005366 Bacteria 967
23 Ga0070667_100015914 3300005367 Bacteria 6223
24 Ga0070667_100037303 3300005367 Bacteria 4075
25 Ga0070667_100710049 3300005367 Bacteria 931
26 Ga0070714_100154002 3300005435 Bacteria 2074
27 Ga0070713_100033532 3300005436 Bacteria 4114
28 Ga0070710_10086887 3300005437 Bacteria 1837
29 Ga0070700_100095642 3300005441 Bacteria 1947
30 Ga0070700_100452945 3300005441 Bacteria 977
31 Ga0070663_100007317 3300005455 Bacteria 6712
32 Ga0070663_100160732 3300005455 Bacteria 1729
33 Ga0070678_100154106 3300005456 Bacteria 1854
34 Ga0070678_100181957 3300005456 Bacteria 1721
35 Ga0070662_100384725 3300005457 Bacteria 1155
36 Ga0068867_100154387 3300005459 Bacteria 1805
37 Ga0068853_100251089 3300005539 Bacteria 1623
38 Ga0068853_100669452 3300005539 Bacteria 989
39 Ga0070672_100115901 3300005543 Bacteria 2188
40 Ga0070693_100419971 3300005547 Bacteria 932
41 Ga0070665_100005014 3300005548 Bacteria 13733
42 Ga0070665_100165952 3300005548 Bacteria 2210
43 Ga0068855_100682209 3300005563 Bacteria 1101
44 Ga0070664_100006843 3300005564 Bacteria 9196
45 Ga0070664_100295214 3300005564 Bacteria 1463
46 Ga0068857_100056819 3300005577 Bacteria 3473
47 Ga0068854_100111327 3300005578 Bacteria 2065
48 Ga0068856_100082056 3300005614 Bacteria 3199
49 Ga0068856_100376056 3300005614 Bacteria 1439
50 Ga0070702_100063128 3300005615 Bacteria 2161
51 Ga0070702_100350547 3300005615 Bacteria 1039
52 Ga0068859_100558027 3300005617 Bacteria 1240
53 Ga0068864_100144036 3300005618 Bacteria 2152
54 Ga0068866_10181421 3300005718 Bacteria 1244
55 Ga0068861_100129657 3300005719 Bacteria 2045
56 Ga0068861_100344175 3300005719 Bacteria 1306
57 Ga0068861_100563461 3300005719 Bacteria 1040
58 Ga0068870_10047870 3300005840 Bacteria 2249
59 Ga0068870_10060294 3300005840 Bacteria 2036
60 Ga0068863_100002313 3300005841 Bacteria 18952
61 Ga0068858_100083269 3300005842 Bacteria 2974
62 Ga0068860_100503384 3300005843 Bacteria 1209
63 Ga0070717_10732910 3300006028 Bacteria 898
64 Ga0075365_10013217 3300006038 Bacteria 4926
65 Ga0075365_10020722 3300006038 Bacteria 4083
66 Ga0075365_10027169 3300006038 Bacteria 3638
67 Ga0075365_10041264 3300006038 Bacteria 3014
68 Ga0075365_10051174 3300006038 Bacteria 2727
69 Ga0075365_10051780 3300006038 Bacteria 2713
70 Ga0075365_10063744 3300006038 Bacteria 2468
71 Ga0075365_10227327 3300006038 Bacteria 1309
72 Ga0075365_10251980 3300006038 Bacteria 1241
73 Ga0075365_10264764 3300006038 Bacteria 1209
74 Ga0075365_10339476 3300006038 Bacteria 1058
75 Ga0075368_10001785 3300006042 Bacteria 6920
76 Ga0075368_10006323 3300006042 Bacteria 4132
77 Ga0075368_10072151 3300006042 Bacteria 1396
78 Ga0075363_100000624 3300006048 Bacteria 11710
79 Ga0075363_100000850 3300006048 Bacteria 10642
80 Ga0075363_100004891 3300006048 Bacteria 5920
81 Ga0075363_100005532 3300006048 Bacteria 5632
82 Ga0075363_100006472 3300006048 Bacteria 5322
83 Ga0075363_100080848 3300006048 Bacteria 1777
84 Ga0075363_100208792 3300006048 Bacteria 1117
85 Ga0075364_10028470 3300006051 Bacteria 3577
86 Ga0075364_10032747 3300006051 Bacteria 3342
87 Ga0075364_10047061 3300006051 Bacteria 2809
88 Ga0075364_10066346 3300006051 Bacteria 2371
89 Ga0075364_10078808 3300006051 Bacteria 2176
90 Ga0075364_10347528 3300006051 Bacteria 1011
91 Ga0070712_100589254 3300006175 Bacteria 940
92 Ga0075362_10009749 3300006177 Bacteria 3725
93 Ga0075367_10007000 3300006178 Bacteria 5744
94 Ga0075367_10017897 3300006178 Bacteria 3899
95 Ga0075367_10121162 3300006178 Bacteria 1612
96 Ga0075367_10168573 3300006178 Bacteria 1363
97 Ga0075369_10023552 3300006186 Bacteria 2546
98 Ga0075369_10054949 3300006186 Bacteria 1729
99 Ga0075369_10088928 3300006186 Bacteria 1376
100 Ga0075369_10183203 3300006186 Bacteria 964
101 Ga0075370_10016051 3300006353 Bacteria 4024
102 Ga0075370_10024616 3300006353 Bacteria 3327
103 Ga0075370_10028258 3300006353 Bacteria 3117
104 Ga0075370_10056569 3300006353 Bacteria 2229
105 Ga0075428_100043840 3300006844 Bacteria 4918
106 Ga0075428_100584827 3300006844 Bacteria 1193
107 Ga0075431_100057263 3300006847 Bacteria 4020
108 Ga0068865_100038413 3300006881 Bacteria 3240
109 Ga0068865_100188222 3300006881 Bacteria 1594
110 Ga0097620_100557975 3300006931 Bacteria 1240
111 Ga0111539_10518451 3300009094 Bacteria 1389
112 Ga0105245_10274238 3300009098 Bacteria 1646
113 Ga0105245_10568543 3300009098 Bacteria 1157
114 Ga0105243_10215291 3300009148 Bacteria 1694
115 Ga0105241_10125713 3300009174 Bacteria 2070
116 Ga0105242_10319418 3300009176 Bacteria 1424
117 Ga0105237_10244553 3300009545 Bacteria 1796
118 Ga0105239_10267423 3300010375 Bacteria 1922
119 Ga0105239_10280953 3300010375 Bacteria 1874
120 Ga0105239_10767755 3300010375 Bacteria 1104
121 Ga0105246_10153895 3300011119 Bacteria 1744
122 Ga0157369_10070176 3300013105 Bacteria 3764
123 Ga0157374_10219749 3300013296 Bacteria 1864
124 Ga0157378_10558466 3300013297 Bacteria 1151
125 Ga0157372_10707680 3300013307 Bacteria 1172
126 Ga0157375_10927881 3300013308 Bacteria 1013
127 Ga0157375_11006039 3300013308 Bacteria 973
128 Ga0163163_10007433 3300014325 Bacteria 9669
129 Ga0163163_10947451 3300014325 Bacteria 924
130 Ga0157380_10282792 3300014326 Bacteria 1519
131 Ga0157380_10397075 3300014326 Bacteria 1307
132 Ga0157376_10278714 3300014969 Bacteria 1574
133 Ga0213872_10126477 3300021361 Bacteria 1128
134 Ga0213876_10000327 3300021384 Bacteria 41631
135 Ga0213876_10008374 3300021384 Bacteria 5597
136 Ga0213876_10017000 3300021384 Bacteria 3842
137 Ga0213876_10022651 3300021384 Bacteria 3320
138 Ga0213876_10138326 3300021384 Bacteria 1295
139 Ga0213875_10012139 3300021388 Bacteria 4261
140 Ga0207656_10009872 3300025321 Bacteria 3554
141 Ga0207692_10005879 3300025898 Bacteria 4945
142 Ga0207688_10013722 3300025901 Bacteria 4405
143 Ga0207647_10193855 3300025904 Bacteria 1177
144 Ga0207643_10076708 3300025908 Bacteria 1931
145 Ga0207705_10004865 3300025909 Bacteria 10081
146 Ga0207705_10087999 3300025909 Bacteria 2272
147 Ga0207671_10111550 3300025914 Bacteria 2081
148 Ga0207693_10501195 3300025915 Bacteria 948
149 Ga0207662_10026205 3300025918 Bacteria 3361
150 Ga0207657_10011184 3300025919 Bacteria 8924
151 Ga0207657_10011887 3300025919 Bacteria 8617
152 Ga0207649_10161256 3300025920 Bacteria 1554
153 Ga0207694_10225742 3300025924 Bacteria 1528
154 Ga0207659_10104095 3300025926 Bacteria 2146
155 Ga0207700_10280764 3300025928 Bacteria 1432
156 Ga0207664_10027681 3300025929 Bacteria 4302
157 Ga0207664_10459052 3300025929 Bacteria 1138
158 Ga0207644_10003056 3300025931 Bacteria 10770
159 Ga0207690_10011401 3300025932 Bacteria 5316
160 Ga0207690_10115567 3300025932 Bacteria 1939
161 Ga0207670_10300550 3300025936 Bacteria 1256
162 Ga0207704_10018221 3300025938 Bacteria 3661
163 Ga0207691_10110448 3300025940 Bacteria 2446
164 Ga0207711_10395185 3300025941 Bacteria 1284
165 Ga0207689_10008164 3300025942 Bacteria 9128
166 Ga0207661_10079528 3300025944 Bacteria 2702
167 Ga0207661_10101793 3300025944 Bacteria 2414
168 Ga0207679_10012840 3300025945 Bacteria 5477
169 Ga0207712_10112979 3300025961 Bacteria 2041
170 Ga0207640_10020616 3300025981 Bacteria 3916
171 Ga0207640_10319225 3300025981 Bacteria 1236
172 Ga0207658_10123345 3300025986 Bacteria 2069
173 Ga0207658_10210704 3300025986 Bacteria 1628
174 Ga0207678_10013872 3300026067 Bacteria 7079
175 Ga0207678_10095279 3300026067 Bacteria 2544
176 Ga0207678_10112703 3300026067 Bacteria 2320
177 Ga0207708_10010033 3300026075 Bacteria 7034
178 Ga0207702_10330430 3300026078 Bacteria 1454
179 Ga0207641_10003529 3300026088 Bacteria 13845
180 Ga0207641_10856958 3300026088 Bacteria 901
181 Ga0207648_10020038 3300026089 Bacteria 6034
182 Ga0207674_10452487 3300026116 Bacteria 1241
183 Ga0207675_100129493 3300026118 Bacteria 2392
184 Ga0207683_10056791 3300026121 Bacteria 3435
185 Ga0207698_10083683 3300026142 Bacteria 2583
186 Ga0209813_10002281 3300027866 Bacteria 4383
187 Ga0268266_10021053 3300028379 Bacteria 5557
188 Ga0268266_10083618 3300028379 Bacteria 2786
189 Ga0268264_10661547 3300028381 Bacteria 1034
190 Ga0307412_10015713 3300031911 Bacteria 4493
191 Ga0373946_0190262 3300035171 Bacteria 978
192 Ga0395900_0030657 3300037418 Bacteria 5522
193 Ga0395898_0386750 3300037466 Bacteria 1334
194 Ga0436364_0267440 3300037853 Bacteria 7840
195 Ga0436364_1502501 3300037853 Bacteria 11651
196 Ga0395901_0069099 3300038443 Bacteria 3679
197 Ga0436365_0102037 3300039437 Bacteria 6388
198 Ga0436365_0653800 3300039437 Bacteria 25450
199 Ga0436365_0925620 3300039437 Bacteria 25118
200 Ga0436365_0980354 3300039437 Bacteria 20197
201 Ga0436365_1369988 3300039437 Bacteria 8419
202 Ga0436365_1607881 3300039437 Bacteria 3904
203 Ga0436360_0386894 3300039438 Bacteria 896
204 Ga0436361_0804556 3300039447 Bacteria 1494
205 Ga0436363_1212376 3300039450 Bacteria 1885
206 Ga0439431_0030257 3300041997 Bacteria 1340
207 Ga0466969_0122255 3300044656 Bacteria 1211
208 Ga0466972_0007665 3300044658 Bacteria 5420
209 Ga0466972_0022602 3300044658 Bacteria 3130
210 Ga0466965_0007540 3300044683 Bacteria 5003
211 Ga0466965_0065700 3300044683 Bacteria 1818
212 Ga0466966_0070979 3300044684 Bacteria 2183
213 Ga0466966_0139423 3300044684 Bacteria 1482
214 Ga0466966_0334596 3300044684 Bacteria 910
215 Ga0466963_0009251 3300044694 Bacteria 5932
216 Ga0466963_0027227 3300044694 Bacteria 3659
217 Ga0466970_0006851 3300044765 Bacteria 5704
218 Ga0466960_0000161 3300044901 Bacteria 22546
219 Ga0466960_0134822 3300044901 Bacteria 1307
220 Ga0466959_0025666 3300045049 Bacteria 4370
221 Ga0466958_0002217 3300045836 Bacteria 9683
222 Ga0466958_0060308 3300045836 Bacteria 2309
223 Ga0466967_0023956 3300045976 Bacteria 5011
224 Ga0466967_0404401 3300045976 Bacteria 1329
225 Ga0466967_0657748 3300045976 Bacteria 1036
226 Ga0466967_0817804 3300045976 Bacteria 925
227 Ga0495603_0044654 3300046455 Bacteria 2644
228 Ga0495629_0008082 3300046459 Bacteria 7744
229 Ga0495641_0018440 3300046461 Bacteria 3601
230 Ga0495634_0282602 3300046642 Bacteria 1008
231 Ga0495649_0067467 3300046694 Bacteria 1919
232 Ga0495674_0022351 3300047319 Bacteria 5834
233 Ga0495593_0034997 3300047673 Bacteria 2728
234 Ga0496101_0068074 3300048904 Bacteria 2602
235 Ga0496102_0037747 3300048905 Bacteria 4359
236 Ga0496102_0049279 3300048905 Bacteria 3831
237 Ga0496102_0109937 3300048905 Bacteria 2569
238 Ga0496102_0134289 3300048905 Bacteria 2318
239 Ga0496103_0160580 3300048906 Bacteria 1441
240 Ga0496104_0030359 3300048907 Bacteria 5022
241 Ga0496105_0016807 3300048908 Bacteria 5850
242 Ga0496106_0195720 3300048909 Bacteria 1608
243 Ga0496106_0292578 3300048909 Bacteria 1306
244 Ga0496106_0390251 3300048909 Bacteria 1119
245 Ga0496108_0026386 3300048911 Bacteria 4792
246 Ga0496108_0077228 3300048911 Bacteria 2816
247 Ga0496108_0435252 3300048911 Bacteria 1145
248 Ga0496109_0241789 3300048912 Bacteria 1699
249 Ga0496109_0529357 3300048912 Bacteria 1112
250 Ga0496110_0009651 3300048913 Bacteria 7814
251 Ga0496110_0012746 3300048913 Bacteria 6923
252 Ga0496110_0123348 3300048913 Bacteria 2336
253 Ga0496112_0003716 3300048915 Bacteria 12735
254 Ga0496112_0073663 3300048915 Bacteria 3376
255 Ga0496113_0177000 3300048916 Bacteria 1690
256 Ga0496114_0399874 3300048917 Bacteria 1216
257 Ga0496114_0504370 3300048917 Bacteria 1070
258 Ga0496115_0214831 3300048918 Bacteria 1588
259 Ga0496118_0019660 3300048921 Bacteria 6027
260 Ga0496120_0139747 3300048923 Bacteria 1231
261 Ga0496126_0094956 3300048929 Bacteria 2616
262 Ga0501031_0004310 3300049568 Bacteria 9203
263 Ga0501032_0002408 3300049569 Bacteria 14591
264 Ga0501032_0115741 3300049569 Bacteria 1773
265 Ga0501034_0004727 3300049571 Bacteria 15076
266 Ga0501034_0322773 3300049571 Bacteria 1477
267 Ga0501034_0434347 3300049571 Bacteria 1232
268 Ga0501036_0004572 3300049572 Bacteria 11176
269 Ga0501037_0033796 3300049573 Bacteria 3776
270 Ga0501038_0074782 3300049574 Bacteria 2865
271 Ga0501038_0356222 3300049574 Bacteria 1139
272 Ga0501039_0009766 3300049575 Bacteria 7310
273 Ga0501040_0006620 3300049576 Bacteria 7521
274 Ga0501040_0193868 3300049576 Bacteria 1442
275 Ga0501042_0011017 3300049578 Bacteria 6087
276 Ga0501046_0001160 3300049580 Bacteria 25618
277 Ga0501046_0135567 3300049580 Bacteria 1865
278 Ga0501046_0160337 3300049580 Bacteria 1692
279 Ga0501047_0001280 3300049581 Bacteria 24845
280 Ga0501047_0003043 3300049581 Bacteria 15908
281 Ga0501048_0002868 3300049582 Bacteria 13150
282 Ga0501048_0034187 3300049582 Bacteria 3670
283 Ga0501068_0071900 3300049584 Bacteria 2112
284 Ga0501068_0371270 3300049584 Bacteria 921
285 Ga0501069_0041935 3300049585 Bacteria 2531
286 Ga0501069_0046539 3300049585 Bacteria 2407
287 Ga0501070_0002411 3300049586 Bacteria 16398
288 Ga0501070_0073422 3300049586 Bacteria 2830
289 Ga0501070_0199256 3300049586 Bacteria 1645
290 Ga0501071_0002770 3300049587 Bacteria 10770
291 Ga0501072_0074558 3300049588 Bacteria 2683
292 Ga0501073_0134720 3300049589 Bacteria 1712
293 Ga0501073_0304628 3300049589 Bacteria 1099
294 Ga0501074_0139568 3300049590 Bacteria 1734
295 Ga0501075_0005256 3300049591 Bacteria 8852
296 Ga0501076_0038996 3300049592 Bacteria 3729
297 Ga0501076_0039611 3300049592 Bacteria 3700
298 Ga0501077_0107759 3300049593 Bacteria 1765
299 Ga0501079_0010187 3300049741 Bacteria 7137
300 Ga0501080_0033559 3300049742 Bacteria 4791
301 Ga0501080_0087342 3300049742 Bacteria 2897
302 Ga0501081_0036822 3300049743 Bacteria 3337
303 Ga0501035_0000406 3300049822 Bacteria 48825
304 Ga0501035_0000810 3300049822 Bacteria 33350
305 Ga0501035_0100465 3300049822 Bacteria 2540
306 Ga0501044_0025039 3300049823 Bacteria 6328
307 Ga0501045_0056525 3300049824 Bacteria 2870
308 Ga0501045_0096166 3300049824 Bacteria 2191
309 nmdc:mga03683_62540_c1 3300050489 Bacteria 1577
310 nmdc:mga03n38_17670_c1 3300050490 Bacteria 2798
311 nmdc:mga03n38_18364_c1 3300050490 Bacteria 2760
312 nmdc:mga03n38_207634_c1 3300050490 Bacteria 1016
313 nmdc:mga03n38_4010_c1 3300050490 Bacteria 4815
314 nmdc:mga00v17_10350_c1 3300050491 Bacteria 5088
315 nmdc:mga00v17_198184_c1 3300050491 Bacteria 1298
316 nmdc:mga00v17_39088_c1 3300050491 Bacteria 2839
317 nmdc:mga00v17_59733_c1 3300050491 Bacteria 2340
318 nmdc:mga0yw44_176061_c1 3300050492 Bacteria 1406
319 nmdc:mga0yw44_260738_c1 3300050492 Bacteria 1155
320 nmdc:mga0yw44_3076_c1 3300050492 Bacteria 7308
321 nmdc:mga0yw44_56515_c1 3300050492 Bacteria 2391
322 nmdc:mga0yw44_85577_c1 3300050492 Bacteria 1984
323 nmdc:mga06z11_230398_c1 3300050494 Bacteria 1085
324 nmdc:mga06z11_273042_c1 3300050494 Bacteria 1000
325 nmdc:mga06z11_57218_c1 3300050494 Bacteria 2019
326 nmdc:mga04h51_20477_c1 3300050495 Bacteria 1976
327 nmdc:mga04h51_31291_c1 3300050495 Bacteria 1680
328 nmdc:mga04h51_50262_c1 3300050495 Bacteria 1396
329 nmdc:mga07m45_16718_c2 3300050496 Bacteria 3410
330 nmdc:mga07m45_6058_c1 3300050496 Bacteria 6089
331 nmdc:mga07m45_61425_c1 3300050496 Bacteria 2128
332 nmdc:mga07m45_74246_c1 3300050496 Bacteria 1937
333 nmdc:mga06r32_321792_c1 3300050510 Bacteria 1532
334 nmdc:mga08y16_408213_c1 3300050511 Bacteria 1389
335 nmdc:mga08y16_658587_c1 3300050511 Bacteria 1050
336 nmdc:mga0sz30_31703_c1 3300050516 Bacteria 2188
337 nmdc:mga0sz30_5808_c1 3300050516 Bacteria 4547
338 Ga0500644_0000204 3300053088 Bacteria 35880
339 Ga0500651_0275556 3300053093 Bacteria 972
340 Ga0500554_036633 3300053102 Bacteria 1483
341 Ga0500642_0060067 3300053130 Bacteria 1704
342 Ga0500561_0068945 3300053137 Bacteria 1007
343 Ga0501084_0119155 3300054114 Bacteria 2219
344 Ga0501084_0211006 3300054114 Bacteria 1638
345 Ga0501082_0069973 3300060353 Bacteria 3022
346 Ga0501082_0125717 3300060353 Bacteria 2224
347 Ga0466962_0006722 3300061719 Bacteria 5513
348 Ga0530510_0213590 3300061734 Bacteria 1433
349 Ga0530510_0459921 3300061734 Bacteria 963
350 2643824957 2643221561 Bacteria 4984412
351 2643891176 2643221576 Bacteria 5214352
352 2644101060 2643221617 Bacteria 5139111
353 2644117941 2643221620 Bacteria 5134593
354 2644532493 2643221696 Bacteria 5431823
355 2738868658 2738541305 Bacteria 4910150
356 2744954493 2744054611 Bacteria 5611514
357 2795783865 2795385470 Bacteria 8317180
358 2812330105 2811994874 Bacteria 5367947
359 2855388639 2855386786 Bacteria 4752232
360 Ga0501070_0038664
361 Ga0006562J51391_1105644
362 Ga0070658_10003579
363 Ga0070658_10030620
364 Ga0070683_100079449
365 Ga0070683_100091020
366 Ga0068869_100100174
367 Ga0068868_100275140
368 Ga0070660_100043611
369 Ga0070689_100448290
370 Ga0070661_100088674
371 Ga0070661_100117181
372 Ga0070692_10326997
373 Ga0070668_100030182
374 Ga0070668_100519876
375 Ga0070675_100223181
376 Ga0070674_100063058
377 Ga0070688_100394852
378 Ga0070659_100008414
379 Ga0070659_100161994
380 Ga0070659_100264542
381 Ga0070659_100574383
382 Ga0070667_100015914
383 Ga0070667_100037303
384 Ga0070667_100710049
385 Ga0070714_100154002
386 Ga0070713_100033532
387 Ga0070710_10086887
388 Ga0070700_100095642
389 Ga0070700_100452945
390 Ga0070663_100007317
391 Ga0070663_100160732
392 Ga0070678_100154106
393 Ga0070678_100181957
394 Ga0070662_100384725
395 Ga0068867_100154387
396 Ga0068853_100251089
397 Ga0068853_100669452
398 Ga0070672_100115901
399 Ga0070693_100419971
400 Ga0070665_100005014
401 Ga0070665_100165952
402 Ga0068855_100682209
403 Ga0070664_100006843
404 Ga0070664_100295214
405 Ga0068857_100056819
406 Ga0068854_100111327
407 Ga0068856_100082056
408 Ga0068856_100376056
409 Ga0070702_100063128
410 Ga0070702_100350547
411 Ga0068859_100558027
412 Ga0068864_100144036
413 Ga0068866_10181421
414 Ga0068861_100129657
415 Ga0068861_100344175
416 Ga0068861_100563461
417 Ga0068870_10047870
418 Ga0068870_10060294
419 Ga0068863_100002313
420 Ga0068858_100083269
421 Ga0068860_100503384
422 Ga0070717_10732910
423 Ga0075365_10013217
424 Ga0075365_10020722
425 Ga0075365_10027169
426 Ga0075365_10041264
427 Ga0075365_10051174
428 Ga0075365_10051780
429 Ga0075365_10063744
430 Ga0075365_10227327
431 Ga0075365_10251980
432 Ga0075365_10264764
433 Ga0075365_10339476
434 Ga0075368_10001785
435 Ga0075368_10006323
436 Ga0075368_10072151
437 Ga0075363_100000624
438 Ga0075363_100000850
439 Ga0075363_100004891
440 Ga0075363_100005532
441 Ga0075363_100006472
442 Ga0075363_100080848
443 Ga0075363_100208792
444 Ga0075364_10028470
445 Ga0075364_10032747
446 Ga0075364_10047061
447 Ga0075364_10066346
448 Ga0075364_10078808
449 Ga0075364_10347528
450 Ga0070712_100589254
451 Ga0075362_10009749
452 Ga0075367_10007000
453 Ga0075367_10017897
454 Ga0075367_10121162
455 Ga0075367_10168573
456 Ga0075369_10023552
457 Ga0075369_10054949
458 Ga0075369_10088928
459 Ga0075369_10183203
460 Ga0075370_10016051
461 Ga0075370_10024616
462 Ga0075370_10028258
463 Ga0075370_10056569
464 Ga0075428_100043840
465 Ga0075428_100584827
466 Ga0075431_100057263
467 Ga0068865_100038413
468 Ga0068865_100188222
469 Ga0097620_100557975
470 Ga0111539_10518451
471 Ga0105245_10274238
472 Ga0105245_10568543
473 Ga0105243_10215291
474 Ga0105241_10125713
475 Ga0105242_10319418
476 Ga0105237_10244553
477 Ga0105239_10267423
478 Ga0105239_10280953
479 Ga0105239_10767755
480 Ga0105246_10153895
481 Ga0157369_10070176
482 Ga0157374_10219749
483 Ga0157378_10558466
484 Ga0157372_10707680
485 Ga0157375_10927881
486 Ga0157375_11006039
487 Ga0163163_10007433
488 Ga0163163_10947451
489 Ga0157380_10282792
490 Ga0157380_10397075
491 Ga0157376_10278714
492 Ga0213872_10126477
493 Ga0213876_10000327
494 Ga0213876_10008374
495 Ga0213876_10017000
496 Ga0213876_10022651
497 Ga0213876_10138326
498 Ga0213875_10012139
499 Ga0207656_10009872
500 Ga0207692_10005879
501 Ga0207688_10013722
502 Ga0207647_10193855
503 Ga0207643_10076708
504 Ga0207705_10004865
505 Ga0207705_10087999
506 Ga0207671_10111550
507 Ga0207693_10501195
508 Ga0207662_10026205
509 Ga0207657_10011184
510 Ga0207657_10011887
511 Ga0207649_10161256
512 Ga0207694_10225742
513 Ga0207659_10104095
514 Ga0207700_10280764
515 Ga0207664_10027681
516 Ga0207664_10459052
517 Ga0207644_10003056
518 Ga0207690_10011401
519 Ga0207690_10115567
520 Ga0207670_10300550
521 Ga0207704_10018221
522 Ga0207691_10110448
523 Ga0207711_10395185
524 Ga0207689_10008164
525 Ga0207661_10079528
526 Ga0207661_10101793
527 Ga0207679_10012840
528 Ga0207712_10112979
529 Ga0207640_10020616
530 Ga0207640_10319225
531 Ga0207658_10123345
532 Ga0207658_10210704
533 Ga0207678_10013872
534 Ga0207678_10095279
535 Ga0207678_10112703
536 Ga0207708_10010033
537 Ga0207702_10330430
538 Ga0207641_10003529
539 Ga0207641_10856958
540 Ga0207648_10020038
541 Ga0207674_10452487
542 Ga0207675_100129493
543 Ga0207683_10056791
544 Ga0207698_10083683
545 Ga0209813_10002281
546 Ga0268266_10021053
547 Ga0268266_10083618
548 Ga0268264_10661547
549 Ga0307412_10015713
550 Ga0373946_0190262
551 Ga0395900_0030657
552 Ga0395898_0386750
553 Ga0436364_0267440
554 Ga0436364_1502501
555 Ga0395901_0069099
556 Ga0436365_0102037
557 Ga0436365_0653800
558 Ga0436365_0925620
559 Ga0436365_0980354
560 Ga0436365_1369988
561 Ga0436365_1607881
562 Ga0436360_0386894
563 Ga0436361_0804556
564 Ga0436363_1212376
565 Ga0439431_0030257
566 Ga0466969_0122255
567 Ga0466972_0007665
568 Ga0466972_0022602
569 Ga0466965_0007540
570 Ga0466965_0065700
571 Ga0466966_0070979
572 Ga0466966_0139423
573 Ga0466966_0334596
574 Ga0466963_0009251
575 Ga0466963_0027227
576 Ga0466970_0006851
577 Ga0466960_0000161
578 Ga0466960_0134822
579 Ga0466959_0025666
580 Ga0466958_0002217
581 Ga0466958_0060308
582 Ga0466967_0023956
583 Ga0466967_0404401
584 Ga0466967_0657748
585 Ga0466967_0817804
586 Ga0495603_0044654
587 Ga0495629_0008082
588 Ga0495641_0018440
589 Ga0495634_0282602
590 Ga0495649_0067467
591 Ga0495674_0022351
592 Ga0495593_0034997
593 Ga0496101_0068074
594 Ga0496102_0037747
595 Ga0496102_0049279
596 Ga0496102_0109937
597 Ga0496102_0134289
598 Ga0496103_0160580
599 Ga0496104_0030359
600 Ga0496105_0016807
601 Ga0496106_0195720
602 Ga0496106_0292578
603 Ga0496106_0390251
604 Ga0496108_0026386
605 Ga0496108_0077228
606 Ga0496108_0435252
607 Ga0496109_0241789
608 Ga0496109_0529357
609 Ga0496110_0009651
610 Ga0496110_0012746
611 Ga0496110_0123348
612 Ga0496112_0003716
613 Ga0496112_0073663
614 Ga0496113_0177000
615 Ga0496114_0399874
616 Ga0496114_0504370
617 Ga0496115_0214831
618 Ga0496118_0019660
619 Ga0496120_0139747
620 Ga0496126_0094956
621 Ga0501031_0004310
622 Ga0501032_0002408
623 Ga0501032_0115741
624 Ga0501034_0004727
625 Ga0501034_0322773
626 Ga0501034_0434347
627 Ga0501036_0004572
628 Ga0501037_0033796
629 Ga0501038_0074782
630 Ga0501038_0356222
631 Ga0501039_0009766
632 Ga0501040_0006620
633 Ga0501040_0193868
634 Ga0501042_0011017
635 Ga0501046_0001160
636 Ga0501046_0135567
637 Ga0501046_0160337
638 Ga0501047_0001280
639 Ga0501047_0003043
640 Ga0501048_0002868
641 Ga0501048_0034187
642 Ga0501068_0071900
643 Ga0501068_0371270
644 Ga0501069_0041935
645 Ga0501069_0046539
646 Ga0501070_0002411
647 Ga0501070_0073422
648 Ga0501070_0199256
649 Ga0501071_0002770
650 Ga0501072_0074558
651 Ga0501073_0134720
652 Ga0501073_0304628
653 Ga0501074_0139568
654 Ga0501075_0005256
655 Ga0501076_0038996
656 Ga0501076_0039611
657 Ga0501077_0107759
658 Ga0501079_0010187
659 Ga0501080_0033559
660 Ga0501080_0087342
661 Ga0501081_0036822
662 Ga0501035_0000406
663 Ga0501035_0000810
664 Ga0501035_0100465
665 Ga0501044_0025039
666 Ga0501045_0056525
667 Ga0501045_0096166
668 nmdc:mga03683_62540_c1
669 nmdc:mga03n38_17670_c1
670 nmdc:mga03n38_18364_c1
671 nmdc:mga03n38_207634_c1
672 nmdc:mga03n38_4010_c1
673 nmdc:mga00v17_10350_c1
674 nmdc:mga00v17_198184_c1
675 nmdc:mga00v17_39088_c1
676 nmdc:mga00v17_59733_c1
677 nmdc:mga0yw44_176061_c1
678 nmdc:mga0yw44_260738_c1
679 nmdc:mga0yw44_3076_c1
680 nmdc:mga0yw44_56515_c1
681 nmdc:mga0yw44_85577_c1
682 nmdc:mga06z11_230398_c1
683 nmdc:mga06z11_273042_c1
684 nmdc:mga06z11_57218_c1
685 nmdc:mga04h51_20477_c1
686 nmdc:mga04h51_31291_c1
687 nmdc:mga04h51_50262_c1
688 nmdc:mga07m45_16718_c2
689 nmdc:mga07m45_6058_c1
690 nmdc:mga07m45_61425_c1
691 nmdc:mga07m45_74246_c1
692 nmdc:mga06r32_321792_c1
693 nmdc:mga08y16_408213_c1
694 nmdc:mga08y16_658587_c1
695 nmdc:mga0sz30_31703_c1
696 nmdc:mga0sz30_5808_c1
697 Ga0500644_0000204
698 Ga0500651_0275556
699 Ga0500554_036633
700 Ga0500642_0060067
701 Ga0500561_0068945
702 Ga0501084_0119155
703 Ga0501084_0211006
704 Ga0501082_0069973
705 Ga0501082_0125717
706 Ga0466962_0006722
707 Ga0530510_0213590
708 Ga0530510_0459921
709 2643824957
710 2643891176
711 2644101060
712 2644117941
713 2644532493
714 2738868658
715 2744954493
716 2795783865
717 2812330105
718 2855388639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

18

154

0.98

PF08608

Wyosine_form

Wyosine base formation

196

248

0.93

PF12867

DinB_2

DinB superfamily

17

153

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7308 1 160
4n6c-assembly2.cif.gz_B crystal structure of the b1rzq2 protein from streptococcus pneumoniae. northeast structural genomics consortium (nesg) target spr36. 0.7252 1 156
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7176 1 156
2f22-assembly1.cif.gz_A crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution 0.7164 1 158
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7089 1 156
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9688 8 154 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9491 8 154 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7718 1 155 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7628 1 155 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7407 10 154 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7K0ZYB9-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.994 144 265 GO:0016853
AF-A0A316THE4-F1-model_v4 Wyosine base formation domain-containing protein 0.993 1 265 GO:0046872
AF-A0A6J6QTR9-F1-model_v4 Unannotated protein 0.9922 158 265
AF-A0A316THE4-F1-model_v4 Wyosine base formation domain-containing protein 0.9893 1 265 GO:0046872
AF-A0A2S8LUI4-F1-model_v4 deleted 0.9881 160 236

Map