F421671

General Info

Members Datasets Scaffolds Average Seq Length
359 271 702 328

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0033595|Ga0501038_0033595_1562_2644
Length 360
Sequence MTLQAKIENPKSKIVTPNVGSGGQSDSMIFCASKVIAIVVALATVAGCATLAQGQESSKIPRLGYVRSFGSGVGRQYTAFQQGLRDLGYIERKNILTEFRSPQGNIRGEVFELVRQLVQLKVDLIVAVDPTAIRAATQATKTIPIVMITNQDPIAAGLVQSLARPGGNITGITRLTRELSGKRFELLKEMLPSVSRVGVLWVQPTALGTGTAFKNYQAAAEALKVQLVSLQVSRPNPDLVGAFQTATKDRVGAVIAVSHAVLMPHRDTITALASRNRMPLMCESRQFVDIGCLMSYNTDDDESDRRAAVYVDKILKGASPAELPIEQPIKFELTVNLKTAKQIGLTIPPNTLARAARVIR

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
209 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
232 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
233 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
234 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
235 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
236 2922368715
237 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
238 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
239 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
240 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
241 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
242 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
243 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
244 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
245 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
246 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
247 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
248 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
249 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
250 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
251 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
252 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
253 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
254 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
255 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
256 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
257 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
258 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
259 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
260 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
261 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
262 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
263 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
264 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
265 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
266 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
267 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
268 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
269 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
270 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
271 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.83
Metatranscriptomes 0
Isolates 11.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 10.58
Rhizoplane 6.96
Rhizosphere 77.72
Stem 0
Stem Tuber 0
Unclassified 14.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0033595 3300049574 Unclassified 4518
2 Ga0065715_10101551 3300005293 Bacteria 3190
3 Ga0070676_10003687 3300005328 Bacteria 8022
4 Ga0070683_100202005 3300005329 Unclassified 1887
5 Ga0070690_100151571 3300005330 Bacteria 1582
6 Ga0070670_100016770 3300005331 Bacteria 6285
7 Ga0070677_10027241 3300005333 Bacteria 2150
8 Ga0070682_100115483 3300005337 Bacteria 1795
9 Ga0070660_100293596 3300005339 Bacteria 1331
10 Ga0070689_100440082 3300005340 Bacteria 1108
11 Ga0070687_100040831 3300005343 Bacteria 2340
12 Ga0070661_100228478 3300005344 Bacteria 1429
13 Ga0070668_100021778 3300005347 Bacteria 4843
14 Ga0070668_100090097 3300005347 Bacteria 2416
15 Ga0070671_100280791 3300005355 Unclassified 1416
16 Ga0070674_100203478 3300005356 Bacteria 1530
17 Ga0070659_100206397 3300005366 Bacteria 1618
18 Ga0070714_100201882 3300005435 Bacteria 1819
19 Ga0070713_100545822 3300005436 Bacteria 1097
20 Ga0070663_100303616 3300005455 Bacteria 1278
21 Ga0070678_100464981 3300005456 Unclassified 1110
22 Ga0070681_10030021 3300005458 Bacteria 5455
23 Ga0068867_100183281 3300005459 Bacteria 1666
24 Ga0070706_100168872 3300005467 Bacteria 2043
25 Ga0070698_100237643 3300005471 Bacteria 1755
26 Ga0070699_100126177 3300005518 Unclassified 2253
27 Ga0070699_100201688 3300005518 Unclassified 1769
28 Ga0070684_100073905 3300005535 Bacteria 3005
29 Ga0068853_100245885 3300005539 Bacteria 1641
30 Ga0070693_100144140 3300005547 Unclassified 1503
31 Ga0070664_100055253 3300005564 Bacteria 3370
32 Ga0070664_100203711 3300005564 Unclassified 1766
33 Ga0068857_100050415 3300005577 Bacteria 3693
34 Ga0068856_100058005 3300005614 Bacteria 3823
35 Ga0068852_100562822 3300005616 Bacteria 1141
36 Ga0068859_100453254 3300005617 Bacteria 1379
37 Ga0068864_100146486 3300005618 Bacteria 2135
38 Ga0068866_10062159 3300005718 Bacteria 1942
39 Ga0068861_100202542 3300005719 Bacteria 1667
40 Ga0068863_100126299 3300005841 Bacteria 2440
41 Ga0068858_100015065 3300005842 Bacteria 7274
42 Ga0068858_100096888 3300005842 Bacteria 2749
43 Ga0068862_100431580 3300005844 Bacteria 1238
44 Ga0081455_10104103 3300005937 Unclassified 2271
45 Ga0075365_10018573 3300006038 Bacteria 4277
46 Ga0075363_100122021 3300006048 Bacteria 1456
47 Ga0075362_10023504 3300006177 Bacteria 2607
48 Ga0075370_10007785 3300006353 Bacteria 5475
49 Ga0068871_100259163 3300006358 Bacteria 1516
50 Ga0068871_100271688 3300006358 Bacteria 1481
51 Ga0075428_100320768 3300006844 Unclassified 1665
52 Ga0075430_100063724 3300006846 Bacteria 3096
53 Ga0075430_100121422 3300006846 Unclassified 2178
54 Ga0075431_100262681 3300006847 Bacteria 1751
55 Ga0075433_10023787 3300006852 Bacteria 5160
56 Ga0075433_10141319 3300006852 Unclassified 2140
57 Ga0075434_100153994 3300006871 Bacteria 2319
58 Ga0097620_100453331 3300006931 Bacteria 1379
59 Ga0075435_100088828 3300007076 Unclassified 2548
60 Ga0111539_10019532 3300009094 Bacteria 8360
61 Ga0111539_10042293 3300009094 Bacteria 5474
62 Ga0111539_10499246 3300009094 Bacteria 1417
63 Ga0111539_10604046 3300009094 Bacteria 1278
64 Ga0111539_10714377 3300009094 Unclassified 1167
65 Ga0105245_10359452 3300009098 Unclassified 1445
66 Ga0105247_10039679 3300009101 Bacteria 2876
67 Ga0114129_10141303 3300009147 Unclassified 3300
68 Ga0114129_10192281 3300009147 Bacteria 2770
69 Ga0114129_10242308 3300009147 Bacteria 2423
70 Ga0114129_10627115 3300009147 Bacteria 1390
71 Ga0114129_10671069 3300009147 Unclassified 1336
72 Ga0105243_10075080 3300009148 Bacteria 2743
73 Ga0105241_10047859 3300009174 Bacteria 3253
74 Ga0105242_10325410 3300009176 Bacteria 1411
75 Ga0105237_10121291 3300009545 Bacteria 2609
76 Ga0105237_10350877 3300009545 Bacteria 1480
77 Ga0105238_10093037 3300009551 Bacteria 3003
78 Ga0105239_10026107 3300010375 Bacteria 6430
79 Ga0105239_10189232 3300010375 Unclassified 2304
80 Ga0105246_10037787 3300011119 Bacteria 3242
81 Ga0157373_10274396 3300013100 Bacteria 1194
82 Ga0157378_10377908 3300013297 Bacteria 1391
83 Ga0163162_10112531 3300013306 Bacteria 2820
84 Ga0163162_10506985 3300013306 Bacteria 1337
85 Ga0163162_10628814 3300013306 Bacteria 1198
86 Ga0157372_10040763 3300013307 Bacteria 5131
87 Ga0157375_10023463 3300013308 Bacteria 5693
88 Ga0163163_10172547 3300014325 Bacteria 2209
89 Ga0157380_10057482 3300014326 Bacteria 3098
90 Ga0157380_10091644 3300014326 Bacteria 2510
91 Ga0157376_10348267 3300014969 Bacteria 1417
92 Ga0207697_10073732 3300025315 Bacteria 1433
93 Ga0207642_10023452 3300025899 Bacteria 2465
94 Ga0207642_10091605 3300025899 Bacteria 1503
95 Ga0207710_10105753 3300025900 Bacteria 1332
96 Ga0207688_10036974 3300025901 Bacteria 2707
97 Ga0207643_10056847 3300025908 Bacteria 2226
98 Ga0207684_10394683 3300025910 Bacteria 1189
99 Ga0207654_10158150 3300025911 Bacteria 1461
100 Ga0207707_10048350 3300025912 Bacteria 3705
101 Ga0207671_10195074 3300025914 Bacteria 1580
102 Ga0207663_10302852 3300025916 Unclassified 1195
103 Ga0207662_10039305 3300025918 Bacteria 2775
104 Ga0207657_10005848 3300025919 Bacteria 12818
105 Ga0207657_10138871 3300025919 Unclassified 1986
106 Ga0207657_10155057 3300025919 Bacteria 1863
107 Ga0207649_10083792 3300025920 Bacteria 2070
108 Ga0207646_10465788 3300025922 Bacteria 1140
109 Ga0207694_10171776 3300025924 Bacteria 1755
110 Ga0207694_10176693 3300025924 Bacteria 1730
111 Ga0207650_10013958 3300025925 Bacteria 5575
112 Ga0207687_10445433 3300025927 Bacteria 1073
113 Ga0207700_10452424 3300025928 Bacteria 1132
114 Ga0207644_10114599 3300025931 Bacteria 2043
115 Ga0207690_10191936 3300025932 Bacteria 1545
116 Ga0207669_10058238 3300025937 Bacteria 2356
117 Ga0207669_10062238 3300025937 Bacteria 2297
118 Ga0207704_10068658 3300025938 Bacteria 2235
119 Ga0207704_10319978 3300025938 Bacteria 1196
120 Ga0207711_10088130 3300025941 Bacteria 2724
121 Ga0207661_10074030 3300025944 Bacteria 2791
122 Ga0207679_10014619 3300025945 Bacteria 5164
123 Ga0207679_10064388 3300025945 Unclassified 2740
124 Ga0207667_10040035 3300025949 Bacteria 4990
125 Ga0207658_10057775 3300025986 Bacteria 2884
126 Ga0207658_10082236 3300025986 Bacteria 2472
127 Ga0207677_10299836 3300026023 Bacteria 1327
128 Ga0207639_10376616 3300026041 Bacteria 1274
129 Ga0207702_10226788 3300026078 Bacteria 1744
130 Ga0207641_10155792 3300026088 Bacteria 2072
131 Ga0207648_10191113 3300026089 Bacteria 1814
132 Ga0207674_10059874 3300026116 Bacteria 3853
133 Ga0207674_10080096 3300026116 Bacteria 3270
134 Ga0268264_10114862 3300028381 Bacteria 2364
135 Ga0268264_10526024 3300028381 Bacteria 1157
136 Ga0307509_10321380 3300031507 Bacteria 1284
137 Ga0307408_100175118 3300031548 Bacteria 1716
138 Ga0307413_10034600 3300031824 Bacteria 2889
139 Ga0307410_10081518 3300031852 Unclassified 2273
140 Ga0307410_10082552 3300031852 Bacteria 2261
141 Ga0307407_10062560 3300031903 Bacteria 2180
142 Ga0307412_10093576 3300031911 Bacteria 2108
143 Ga0307412_10151215 3300031911 Bacteria 1713
144 Ga0307409_100091948 3300031995 Bacteria 2488
145 Ga0307416_100010352 3300032002 Bacteria 6155
146 Ga0307416_100247858 3300032002 Bacteria 1731
147 Ga0307414_10107746 3300032004 Bacteria 2112
148 Ga0307411_10158923 3300032005 Bacteria 1690
149 Ga0373938_0008102 3300034957 Bacteria 1869
150 Ga0373944_0006183 3300035089 Bacteria 3174
151 Ga0373923_0055973 3300035111 Bacteria 1664
152 Ga0373932_0015054 3300035112 Bacteria 1956
153 Ga0373936_0032559 3300035113 Bacteria 2063
154 Ga0373945_0019443 3300035116 Bacteria 2319
155 Ga0373943_0023025 3300035170 Bacteria 2893
156 Ga0373943_0062473 3300035170 Bacteria 1864
157 Ga0373946_0014395 3300035171 Bacteria 2983
158 Ga0373942_0026993 3300035207 Unclassified 1491
159 Ga0373962_0012463 3300035242 Bacteria 2144
160 Ga0373931_0111227 3300035691 Bacteria 1554
161 Ga0373935_0042450 3300035692 Bacteria 2860
162 Ga0373927_0068804 3300035695 Unclassified 2291
163 Ga0373927_0098021 3300035695 Bacteria 1905
164 Ga0373947_0010795 3300035725 Bacteria 5240
165 Ga0373947_0081858 3300035725 Bacteria 2000
166 Ga0373937_0197627 3300036401 Unclassified 1890
167 Ga0373925_0085464 3300037068 Bacteria 2405
168 Ga0373925_0180505 3300037068 Bacteria 1670
169 Ga0436361_0786412 3300039447 Bacteria 3331
170 Ga0439436_0010650 3300041404 Bacteria 2802
171 Ga0439442_046126 3300042002 Bacteria 918
172 Ga0439432_009284 3300042006 Bacteria 3434
173 Ga0439449_0002727 3300042007 Bacteria 6874
174 Ga0439454_002584 3300042011 Bacteria 1929
175 Ga0439462_0005315 3300042015 Bacteria 3172
176 Ga0450906_018719 3300042145 Bacteria 1241
177 Ga0439464_0061135 3300042439 Bacteria 1103
178 Ga0466969_0020121 3300044656 Bacteria 3460
179 Ga0495629_0001640 3300046459 Bacteria 17572
180 Ga0495629_0023482 3300046459 Bacteria 4394
181 Ga0495653_0036299 3300046463 Bacteria 3883
182 Ga0495580_0013836 3300046472 Bacteria 6142
183 Ga0495582_0006604 3300046473 Bacteria 6442
184 Ga0495582_0158475 3300046473 Bacteria 1287
185 Ga0495664_0071870 3300046477 Bacteria 2066
186 Ga0495628_0288171 3300046516 Bacteria 1218
187 Ga0495630_0051380 3300046517 Bacteria 3085
188 Ga0495643_0029768 3300046522 Bacteria 3053
189 Ga0495652_0010637 3300046529 Bacteria 8336
190 Ga0495665_0025245 3300046531 Bacteria 3192
191 Ga0495665_0092028 3300046531 Bacteria 1594
192 Ga0495640_0006902 3300046533 Bacteria 8942
193 Ga0495598_0032894 3300046537 Bacteria 1468
194 Ga0495609_0014632 3300046538 Bacteria 3685
195 Ga0495621_0099415 3300046539 Bacteria 1105
196 Ga0495645_0006517 3300046543 Bacteria 8106
197 Ga0495622_0039229 3300046557 Bacteria 2205
198 Ga0495667_0195048 3300046559 Unclassified 1297
199 Ga0495668_0025152 3300046616 Bacteria 3385
200 Ga0495647_0028440 3300046681 Bacteria 2061
201 Ga0495658_0005044 3300046683 Bacteria 6487
202 Ga0495613_0099125 3300046689 Bacteria 2105
203 Ga0495624_0019787 3300046690 Bacteria 4486
204 Ga0495670_0117919 3300046691 Bacteria 1377
205 Ga0495671_0111534 3300046692 Bacteria 1336
206 Ga0495581_0006571 3300047315 Bacteria 6737
207 Ga0495636_0110067 3300047318 Bacteria 1211
208 Ga0495676_0223853 3300047321 Bacteria 1295
209 Ga0495673_0027022 3300047469 Bacteria 2735
210 Ga0495684_0187965 3300047471 Bacteria 1528
211 Ga0495593_0006972 3300047673 Bacteria 6623
212 Ga0495614_0078684 3300048089 Unclassified 1427
213 Ga0495614_0139133 3300048089 Unclassified 1078
214 Ga0496101_0058167 3300048904 Bacteria 2798
215 Ga0496101_0357339 3300048904 Bacteria 1148
216 Ga0496102_0023873 3300048905 Bacteria 5435
217 Ga0496102_0030563 3300048905 Bacteria 4822
218 Ga0496102_0343405 3300048905 Bacteria 1406
219 Ga0496103_0094655 3300048906 Bacteria 1887
220 Ga0496103_0226902 3300048906 Bacteria 1201
221 Ga0496104_0029582 3300048907 Bacteria 5082
222 Ga0496104_0096086 3300048907 Bacteria 2835
223 Ga0496105_0039225 3300048908 Bacteria 3903
224 Ga0496106_0242716 3300048909 Bacteria 1439
225 Ga0496107_0020191 3300048910 Bacteria 4704
226 Ga0496107_0316706 3300048910 Unclassified 1161
227 Ga0496108_0056414 3300048911 Bacteria 3300
228 Ga0496109_0349629 3300048912 Bacteria 1396
229 Ga0496110_0118918 3300048913 Bacteria 2379
230 Ga0496111_0307272 3300048914 Bacteria 1175
231 Ga0496112_0015602 3300048915 Bacteria 7095
232 Ga0496112_0053812 3300048915 Unclassified 3954
233 Ga0496112_0114102 3300048915 Bacteria 2673
234 Ga0496112_0447559 3300048915 Bacteria 1229
235 Ga0496113_0239296 3300048916 Bacteria 1448
236 Ga0496114_0231271 3300048917 Bacteria 1624
237 Ga0496115_0027848 3300048918 Bacteria 4424
238 Ga0496115_0068104 3300048918 Bacteria 2881
239 Ga0496116_0011162 3300048919 Bacteria 7467
240 Ga0496118_0159071 3300048921 Bacteria 1400
241 Ga0496120_0123153 3300048923 Bacteria 1338
242 Ga0496124_0186276 3300048927 Bacteria 1593
243 Ga0501298_006915 3300049521 Unclassified 1870
244 Ga0501299_005002 3300049522 Unclassified 2015
245 Ga0501036_0021414 3300049572 Bacteria 5435
246 Ga0501036_0048523 3300049572 Bacteria 3595
247 Ga0501037_0039303 3300049573 Bacteria 3484
248 Ga0501038_0350143 3300049574 Unclassified 1150
249 Ga0501039_0022802 3300049575 Unclassified 4802
250 Ga0501039_0287616 3300049575 Unclassified 1292
251 Ga0501040_0029549 3300049576 Bacteria 3701
252 Ga0501041_0015237 3300049577 Bacteria 4565
253 Ga0501041_0041852 3300049577 Bacteria 2783
254 Ga0501041_0086343 3300049577 Unclassified 1935
255 Ga0501042_0013135 3300049578 Bacteria 5635
256 Ga0501042_0228710 3300049578 Unclassified 1341
257 Ga0501043_0097596 3300049579 Unclassified 2310
258 Ga0501046_0032591 3300049580 Unclassified 4219
259 Ga0501068_0059226 3300049584 Unclassified 2325
260 Ga0501068_0233061 3300049584 Unclassified 1171
261 Ga0501071_0030964 3300049587 Bacteria 3788
262 Ga0501071_0096887 3300049587 Unclassified 2171
263 Ga0501072_0008817 3300049588 Bacteria 7660
264 Ga0501072_0009506 3300049588 Bacteria 7394
265 Ga0501074_0081861 3300049590 Unclassified 2315
266 Ga0501074_0117372 3300049590 Unclassified 1904
267 Ga0501075_0003051 3300049591 Bacteria 11191
268 Ga0501075_0003612 3300049591 Bacteria 10371
269 Ga0501075_0014940 3300049591 Bacteria 5569
270 Ga0501076_0010398 3300049592 Bacteria 6904
271 Ga0501076_0036949 3300049592 Bacteria 3829
272 Ga0501076_0318317 3300049592 Bacteria 1276
273 Ga0501209_052124 3300049656 Unclassified 1119
274 Ga0501230_020326 3300049667 Bacteria 1153
275 Ga0501079_0145388 3300049741 Unclassified 1847
276 Ga0501079_0424418 3300049741 Bacteria 1044
277 Ga0501081_0023951 3300049743 Unclassified 4095
278 Ga0501081_0041924 3300049743 Bacteria 3136
279 Ga0501035_0026867 3300049822 Bacteria 5264
280 Ga0501045_0132595 3300049824 Unclassified 1852
281 nmdc:mga03683_99645_c1 3300050489 Bacteria 1276
282 nmdc:mga03n38_96445_c1 3300050490 Bacteria 1418
283 nmdc:mga0k408_57537_c1 3300050493 Bacteria 2257
284 nmdc:mga06z11_76376_c1 3300050494 Bacteria 1786
285 nmdc:mga05p37_122563_c1 3300050507 Bacteria 3193
286 nmdc:mga05p37_47991_c1 3300050507 Bacteria 5252
287 nmdc:mga05p37_502275_c1 3300050507 Unclassified 1391
288 nmdc:mga05p37_524253_c1 3300050507 Bacteria 1354
289 nmdc:mga05p37_72241_c1 3300050507 Bacteria 4245
290 nmdc:mga09592_133983_c1 3300050508 Unclassified 2133
291 nmdc:mga09592_305344_c1 3300050508 Unclassified 1379
292 nmdc:mga09592_592195_c1 3300050508 Bacteria 950
293 nmdc:mga0qj67_5923_c1 3300050509 Bacteria 8958
294 nmdc:mga06r32_95680_c1 3300050510 Bacteria 2907
295 nmdc:mga08y16_12800_c1 3300050511 Bacteria 8825
296 nmdc:mga08y16_411031_c1 3300050511 Bacteria 1384
297 nmdc:mga08y16_438162_c1 3300050511 Bacteria 1334
298 nmdc:mga08y16_495400_c1 3300050511 Bacteria 1242
299 nmdc:mga0rr50_49181_c1 3300050513 Bacteria 3120
300 nmdc:mga0a205_198067_c1 3300050515 Bacteria 1900
301 nmdc:mga0a205_52494_c1 3300050515 Bacteria 3934
302 Ga0495612_0008160 3300053078 Bacteria 4257
303 Ga0495619_0000821 3300053085 Bacteria 20348
304 Ga0495619_0167988 3300053085 Bacteria 1516
305 Ga0500595_025232 3300053119 Bacteria 2063
306 Ga0501084_0008164 3300054114 Bacteria 8633
307 Ga0501084_0053413 3300054114 Bacteria 3380
308 Ga0501082_0351722 3300060353 Unclassified 1285
309 Ga0530510_0003963 3300061734 Bacteria 10212
310 Ga0530510_0009338 3300061734 Bacteria 6878
311 2513891384 2513237141 Bacteria 8496279
312 2528851859 2528768022 Bacteria 10457665
313 2824668598 2824661429 Bacteria 9877870
314 2824682276 2824679649 Bacteria 8248951
315 2879104988 2879099564 Bacteria 10442239
316 2922374631
317 2922396868 2922393267 Bacteria 8285685
318 2932790583 2932784394 Bacteria 9704911
319 2932811004 2932809354 Bacteria 9135765
320 2932827864 2932818245 Bacteria 9955613
321 2932830214 2932828146 Bacteria 9745859
322 2935622560 2935616580 Bacteria 9032984
323 2935642165 2935638405 Bacteria 10015038
324 2935672451 2935665750 Bacteria 9571747
325 2935676088 2935675223 Bacteria 9928132
326 2935686075 2935684952 Bacteria 9590419
327 2935701301 2935694250 Bacteria 9291695
328 2935705916 2935703347 Bacteria 10242284
329 2935714627 2935713505 Bacteria 9608509
330 2935725246 2935722832 Bacteria 9608746
331 2935732394 2935732158 Bacteria 9706831
332 2935741773 2935741537 Bacteria 9707219
333 2935752040 2935750917 Bacteria 9590372
334 2935802914 2935801545 Bacteria 9301974
335 2935813255 2935810662 Bacteria 9401221
336 2935830332 2935827899 Bacteria 10038562
337 2935838229 2935837841 Bacteria 9454360
338 2935860809 2935855204 Bacteria 9035059
339 2935872218 2935864058 Bacteria 9784707
340 2935878727 2935873716 Bacteria 9632195
341 2935994877 2935992306 Bacteria 9802711
342 2936003520 2936002035 Bacteria 9362176
343 2936042204 2936037263 Bacteria 9446081
344 2940557157 2940556831 Bacteria 9590747
345 2941539103 2941538514 Bacteria 9402094
346 8016522095 8016511872 Bacteria 9921665
347 8017063573 8017057580 Bacteria 10023680
348 8019582892 8019576017 Bacteria 10049540
349 8019590687 8019586578 Bacteria 10212056
350 8019600662 8019597564 Bacteria 10041141
351 8019617884 8019608314 Bacteria 10042931
352 Ga0501038_0033595
353 Ga0065715_10101551
354 Ga0070676_10003687
355 Ga0070683_100202005
356 Ga0070690_100151571
357 Ga0070670_100016770
358 Ga0070677_10027241
359 Ga0070682_100115483
360 Ga0070660_100293596
361 Ga0070689_100440082
362 Ga0070687_100040831
363 Ga0070661_100228478
364 Ga0070668_100021778
365 Ga0070668_100090097
366 Ga0070671_100280791
367 Ga0070674_100203478
368 Ga0070659_100206397
369 Ga0070714_100201882
370 Ga0070713_100545822
371 Ga0070663_100303616
372 Ga0070678_100464981
373 Ga0070681_10030021
374 Ga0068867_100183281
375 Ga0070706_100168872
376 Ga0070698_100237643
377 Ga0070699_100126177
378 Ga0070699_100201688
379 Ga0070684_100073905
380 Ga0068853_100245885
381 Ga0070693_100144140
382 Ga0070664_100055253
383 Ga0070664_100203711
384 Ga0068857_100050415
385 Ga0068856_100058005
386 Ga0068852_100562822
387 Ga0068859_100453254
388 Ga0068864_100146486
389 Ga0068866_10062159
390 Ga0068861_100202542
391 Ga0068863_100126299
392 Ga0068858_100015065
393 Ga0068858_100096888
394 Ga0068862_100431580
395 Ga0081455_10104103
396 Ga0075365_10018573
397 Ga0075363_100122021
398 Ga0075362_10023504
399 Ga0075370_10007785
400 Ga0068871_100259163
401 Ga0068871_100271688
402 Ga0075428_100320768
403 Ga0075430_100063724
404 Ga0075430_100121422
405 Ga0075431_100262681
406 Ga0075433_10023787
407 Ga0075433_10141319
408 Ga0075434_100153994
409 Ga0097620_100453331
410 Ga0075435_100088828
411 Ga0111539_10019532
412 Ga0111539_10042293
413 Ga0111539_10499246
414 Ga0111539_10604046
415 Ga0111539_10714377
416 Ga0105245_10359452
417 Ga0105247_10039679
418 Ga0114129_10141303
419 Ga0114129_10192281
420 Ga0114129_10242308
421 Ga0114129_10627115
422 Ga0114129_10671069
423 Ga0105243_10075080
424 Ga0105241_10047859
425 Ga0105242_10325410
426 Ga0105237_10121291
427 Ga0105237_10350877
428 Ga0105238_10093037
429 Ga0105239_10026107
430 Ga0105239_10189232
431 Ga0105246_10037787
432 Ga0157373_10274396
433 Ga0157378_10377908
434 Ga0163162_10112531
435 Ga0163162_10506985
436 Ga0163162_10628814
437 Ga0157372_10040763
438 Ga0157375_10023463
439 Ga0163163_10172547
440 Ga0157380_10057482
441 Ga0157380_10091644
442 Ga0157376_10348267
443 Ga0207697_10073732
444 Ga0207642_10023452
445 Ga0207642_10091605
446 Ga0207710_10105753
447 Ga0207688_10036974
448 Ga0207643_10056847
449 Ga0207684_10394683
450 Ga0207654_10158150
451 Ga0207707_10048350
452 Ga0207671_10195074
453 Ga0207663_10302852
454 Ga0207662_10039305
455 Ga0207657_10005848
456 Ga0207657_10138871
457 Ga0207657_10155057
458 Ga0207649_10083792
459 Ga0207646_10465788
460 Ga0207694_10171776
461 Ga0207694_10176693
462 Ga0207650_10013958
463 Ga0207687_10445433
464 Ga0207700_10452424
465 Ga0207644_10114599
466 Ga0207690_10191936
467 Ga0207669_10058238
468 Ga0207669_10062238
469 Ga0207704_10068658
470 Ga0207704_10319978
471 Ga0207711_10088130
472 Ga0207661_10074030
473 Ga0207679_10014619
474 Ga0207679_10064388
475 Ga0207667_10040035
476 Ga0207658_10057775
477 Ga0207658_10082236
478 Ga0207677_10299836
479 Ga0207639_10376616
480 Ga0207702_10226788
481 Ga0207641_10155792
482 Ga0207648_10191113
483 Ga0207674_10059874
484 Ga0207674_10080096
485 Ga0268264_10114862
486 Ga0268264_10526024
487 Ga0307509_10321380
488 Ga0307408_100175118
489 Ga0307413_10034600
490 Ga0307410_10081518
491 Ga0307410_10082552
492 Ga0307407_10062560
493 Ga0307412_10093576
494 Ga0307412_10151215
495 Ga0307409_100091948
496 Ga0307416_100010352
497 Ga0307416_100247858
498 Ga0307414_10107746
499 Ga0307411_10158923
500 Ga0373938_0008102
501 Ga0373944_0006183
502 Ga0373923_0055973
503 Ga0373932_0015054
504 Ga0373936_0032559
505 Ga0373945_0019443
506 Ga0373943_0023025
507 Ga0373943_0062473
508 Ga0373946_0014395
509 Ga0373942_0026993
510 Ga0373962_0012463
511 Ga0373931_0111227
512 Ga0373935_0042450
513 Ga0373927_0068804
514 Ga0373927_0098021
515 Ga0373947_0010795
516 Ga0373947_0081858
517 Ga0373937_0197627
518 Ga0373925_0085464
519 Ga0373925_0180505
520 Ga0436361_0786412
521 Ga0439436_0010650
522 Ga0439442_046126
523 Ga0439432_009284
524 Ga0439449_0002727
525 Ga0439454_002584
526 Ga0439462_0005315
527 Ga0450906_018719
528 Ga0439464_0061135
529 Ga0466969_0020121
530 Ga0495629_0001640
531 Ga0495629_0023482
532 Ga0495653_0036299
533 Ga0495580_0013836
534 Ga0495582_0006604
535 Ga0495582_0158475
536 Ga0495664_0071870
537 Ga0495628_0288171
538 Ga0495630_0051380
539 Ga0495643_0029768
540 Ga0495652_0010637
541 Ga0495665_0025245
542 Ga0495665_0092028
543 Ga0495640_0006902
544 Ga0495598_0032894
545 Ga0495609_0014632
546 Ga0495621_0099415
547 Ga0495645_0006517
548 Ga0495622_0039229
549 Ga0495667_0195048
550 Ga0495668_0025152
551 Ga0495647_0028440
552 Ga0495658_0005044
553 Ga0495613_0099125
554 Ga0495624_0019787
555 Ga0495670_0117919
556 Ga0495671_0111534
557 Ga0495581_0006571
558 Ga0495636_0110067
559 Ga0495676_0223853
560 Ga0495673_0027022
561 Ga0495684_0187965
562 Ga0495593_0006972
563 Ga0495614_0078684
564 Ga0495614_0139133
565 Ga0496101_0058167
566 Ga0496101_0357339
567 Ga0496102_0023873
568 Ga0496102_0030563
569 Ga0496102_0343405
570 Ga0496103_0094655
571 Ga0496103_0226902
572 Ga0496104_0029582
573 Ga0496104_0096086
574 Ga0496105_0039225
575 Ga0496106_0242716
576 Ga0496107_0020191
577 Ga0496107_0316706
578 Ga0496108_0056414
579 Ga0496109_0349629
580 Ga0496110_0118918
581 Ga0496111_0307272
582 Ga0496112_0015602
583 Ga0496112_0053812
584 Ga0496112_0114102
585 Ga0496112_0447559
586 Ga0496113_0239296
587 Ga0496114_0231271
588 Ga0496115_0027848
589 Ga0496115_0068104
590 Ga0496116_0011162
591 Ga0496118_0159071
592 Ga0496120_0123153
593 Ga0496124_0186276
594 Ga0501298_006915
595 Ga0501299_005002
596 Ga0501036_0021414
597 Ga0501036_0048523
598 Ga0501037_0039303
599 Ga0501038_0350143
600 Ga0501039_0022802
601 Ga0501039_0287616
602 Ga0501040_0029549
603 Ga0501041_0015237
604 Ga0501041_0041852
605 Ga0501041_0086343
606 Ga0501042_0013135
607 Ga0501042_0228710
608 Ga0501043_0097596
609 Ga0501046_0032591
610 Ga0501068_0059226
611 Ga0501068_0233061
612 Ga0501071_0030964
613 Ga0501071_0096887
614 Ga0501072_0008817
615 Ga0501072_0009506
616 Ga0501074_0081861
617 Ga0501074_0117372
618 Ga0501075_0003051
619 Ga0501075_0003612
620 Ga0501075_0014940
621 Ga0501076_0010398
622 Ga0501076_0036949
623 Ga0501076_0318317
624 Ga0501209_052124
625 Ga0501230_020326
626 Ga0501079_0145388
627 Ga0501079_0424418
628 Ga0501081_0023951
629 Ga0501081_0041924
630 Ga0501035_0026867
631 Ga0501045_0132595
632 nmdc:mga03683_99645_c1
633 nmdc:mga03n38_96445_c1
634 nmdc:mga0k408_57537_c1
635 nmdc:mga06z11_76376_c1
636 nmdc:mga05p37_122563_c1
637 nmdc:mga05p37_47991_c1
638 nmdc:mga05p37_502275_c1
639 nmdc:mga05p37_524253_c1
640 nmdc:mga05p37_72241_c1
641 nmdc:mga09592_133983_c1
642 nmdc:mga09592_305344_c1
643 nmdc:mga09592_592195_c1
644 nmdc:mga0qj67_5923_c1
645 nmdc:mga06r32_95680_c1
646 nmdc:mga08y16_12800_c1
647 nmdc:mga08y16_411031_c1
648 nmdc:mga08y16_438162_c1
649 nmdc:mga08y16_495400_c1
650 nmdc:mga0rr50_49181_c1
651 nmdc:mga0a205_198067_c1
652 nmdc:mga0a205_52494_c1
653 Ga0495612_0008160
654 Ga0495619_0000821
655 Ga0495619_0167988
656 Ga0500595_025232
657 Ga0501084_0008164
658 Ga0501084_0053413
659 Ga0501082_0351722
660 Ga0530510_0003963
661 Ga0530510_0009338
662 2513891384
663 2528851859
664 2824668598
665 2824682276
666 2879104988
667 2922374631
668 2922396868
669 2932790583
670 2932811004
671 2932827864
672 2932830214
673 2935622560
674 2935642165
675 2935672451
676 2935676088
677 2935686075
678 2935701301
679 2935705916
680 2935714627
681 2935725246
682 2935732394
683 2935741773
684 2935752040
685 2935802914
686 2935813255
687 2935830332
688 2935838229
689 2935860809
690 2935872218
691 2935878727
692 2935994877
693 2936003520
694 2936042204
695 2940557157
696 2941539103
697 8016522095
698 8017063573
699 8019582892
700 8019590687
701 8019600662
702 8019617884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

70

359

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.939 46 339
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9319 46 340
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9298 46 339
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9289 46 340
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9249 50 340
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8926 164 339 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8886 164 340 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8714 164 340 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8694 164 339 3.40.50.2300
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8115 180 253 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9883 228 341
AF-A0A7C3JHV3-F1-model_v4 ABC transporter substrate-binding protein 0.9877 44 341
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9819 235 341
AF-A0A536TI46-F1-model_v4 ABC transporter substrate-binding protein 0.9817 71 341 GO:0016020
AF-A0A7C3JLF2-F1-model_v4 ABC transporter substrate-binding protein 0.9804 195 341

Map