F421583

General Info

Members Datasets Scaffolds Average Seq Length
359 245 350 273

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100344284|Ga0307415_1003442842
Length 273
Sequence MPHIAIFQARTGIDPERNAADLVAAVRTAKAGGAVMLFTPEMSGLLDSNRERAAAAVKAEADDEVLRAVRAAAADDGIWVHLGSLALKGSAGRLVNRGFVIDAGGEVRARYDKIHLFDVDLPTGESWRESAVYQGGRDAVVVRDTPVGTLGPTICYDLRFPALFERLSEAGADVISVPAAFTVPTGRAHWEVLLRARAIEAGLFVVAAAQGGEHEDGRHTYGHSLVVDPWGEVLLDAGEEGGVHFTEIDLDRIAEVRSRVPALKHRRPIAAID

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
5 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
6 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
7 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
8 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
9 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
243 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 0
Isolates 2.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 26.18
Nodule 0
Rhizoplane 2.79
Rhizosphere 61.28
Stem 0
Stem Tuber 0
Unclassified 9.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000184 3300001976 Bacteria 8630
2 JGI24740J21852_10002639 3300001979 Bacteria 8074
3 JGI24737J22298_10072266 3300001990 Bacteria 1029
4 JGI25150J39212_1000570 3300002774 Bacteria 14707
5 JGI25165J46597_1000012 3300003214 Bacteria 421074
6 JGI25153J46596_10000016 3300003215 Bacteria 285917
7 JGI25153J46596_10000029 3300003215 Bacteria 201658
8 JGI25153J46596_10005701 3300003215 Bacteria 6493
9 rootL2_10085829 3300003322 Bacteria 4022
10 Ga0055525_1000090 3300003759 Bacteria 141071
11 Ga0055542_1000037 3300003762 Bacteria 225640
12 Ga0055529_1000042 3300003763 Bacteria 225663
13 Ga0055529_1000109 3300003763 Bacteria 121019
14 Ga0055526_1000846 3300003771 Bacteria 22828
15 Ga0055537_1001866 3300003773 Bacteria 7589
16 Ga0055537_1003656 3300003773 Bacteria 4663
17 Ga0055524_1000983 3300003775 Bacteria 17780
18 Ga0055536_1009610 3300003781 Bacteria 3967
19 Ga0055530_10005327 3300003791 Bacteria 6167
20 Ga0055530_10009798 3300003791 Bacteria 3623
21 Ga0055540_1000349 3300003792 Bacteria 39214
22 Ga0055531_10007069 3300003794 Bacteria 6205
23 Ga0065165_1003151 3300005262 Bacteria 12160
24 Ga0065165_1006091 3300005262 Bacteria 6464
25 Ga0065165_1007138 3300005262 Bacteria 5595
26 Ga0065165_1033345 3300005262 Bacteria 1603
27 Ga0065704_10086132 3300005289 Bacteria 3150
28 Ga0070658_10008914 3300005327 Bacteria 8062
29 Ga0070658_10074431 3300005327 Bacteria 2785
30 Ga0070683_100310643 3300005329 Bacteria 1500
31 Ga0070670_100000014 3300005331 Bacteria 234648
32 Ga0070682_100138341 3300005337 Bacteria 1657
33 Ga0068868_100446423 3300005338 Bacteria 1124
34 Ga0070660_100008166 3300005339 Bacteria 7316
35 Ga0070660_100010454 3300005339 Bacteria 6560
36 Ga0070661_100000001 3300005344 Bacteria 424830
37 Ga0070661_100126926 3300005344 Bacteria 1914
38 Ga0070668_100090660 3300005347 Bacteria 2408
39 Ga0070675_100097973 3300005354 Bacteria 2466
40 Ga0070675_100189393 3300005354 Bacteria 1782
41 Ga0070671_100013681 3300005355 Bacteria 6543
42 Ga0070674_100003402 3300005356 Bacteria 8919
43 Ga0070674_100010650 3300005356 Bacteria 5570
44 Ga0070673_100206039 3300005364 Bacteria 1696
45 Ga0070659_100013217 3300005366 Bacteria 6139
46 Ga0070667_100000609 3300005367 Bacteria 34877
47 Ga0070678_100002212 3300005456 Bacteria 10579
48 Ga0070681_10023551 3300005458 Bacteria 6193
49 Ga0068867_100094889 3300005459 Bacteria 2269
50 Ga0070679_100000003 3300005530 Bacteria 307836
51 Ga0068853_100242725 3300005539 Bacteria 1651
52 Ga0070672_100244793 3300005543 Bacteria 1509
53 Ga0070665_100000044 3300005548 Bacteria 276702
54 Ga0070664_100138605 3300005564 Bacteria 2140
55 Ga0070664_100204704 3300005564 Bacteria 1762
56 Ga0068857_100013310 3300005577 Bacteria 7164
57 Ga0068854_100044486 3300005578 Bacteria 3152
58 Ga0068856_100043121 3300005614 Bacteria 4439
59 Ga0068852_100000303 3300005616 Bacteria 33151
60 Ga0068859_100001760 3300005617 Bacteria 22059
61 Ga0068859_100022081 3300005617 Bacteria 6381
62 Ga0068864_100000021 3300005618 Bacteria 262378
63 Ga0068861_100000009 3300005719 Bacteria 84609
64 Ga0068863_100000009 3300005841 Bacteria 250538
65 Ga0068862_100000017 3300005844 Bacteria 247616
66 Ga0081540_1107758 3300005983 Bacteria 1185
67 Ga0075369_10070610 3300006186 Bacteria 1537
68 Ga0075370_10129508 3300006353 Bacteria 1472
69 Ga0068871_100284505 3300006358 Bacteria 1447
70 Ga0097620_100001760 3300006931 Bacteria 22059
71 Ga0097620_100022080 3300006931 Bacteria 6381
72 Ga0105251_10000079 3300009011 Bacteria 92478
73 Ga0105240_10056657 3300009093 Bacteria 4903
74 Ga0105245_10001634 3300009098 Bacteria 20406
75 Ga0105243_10000224 3300009148 Bacteria 65196
76 Ga0105241_10004163 3300009174 Bacteria 10683
77 Ga0105248_10000030 3300009177 Bacteria 206609
78 Ga0105248_10004165 3300009177 Bacteria 15992
79 Ga0105237_10010045 3300009545 Bacteria 10097
80 Ga0105249_10000625 3300009553 Bacteria 32214
81 Ga0105148_103006 3300009978 Bacteria 1190
82 Ga0105239_10004982 3300010375 Bacteria 15682
83 Ga0157314_1004544 3300012500 Bacteria 1025
84 Ga0157371_10001732 3300013102 Bacteria 22127
85 Ga0157370_10342711 3300013104 Bacteria 1377
86 Ga0157379_10035802 3300014968 Bacteria 4426
87 Ga0157379_10050503 3300014968 Bacteria 3713
88 Ga0163161_10072982 3300017792 Bacteria 2514
89 Ga0213873_10000025 3300021358 Bacteria 86171
90 Ga0213876_10000004 3300021384 Bacteria 943822
91 Ga0209563_100111 3300025230 Bacteria 141123
92 Ga0207425_1000041 3300025245 Bacteria 210441
93 Ga0207425_1006302 3300025245 Bacteria 3259
94 Ga0209148_1000026 3300025254 Bacteria 629213
95 Ga0209129_1001433 3300025258 Bacteria 13323
96 Ga0209233_1000058 3300025261 Bacteria 421872
97 Ga0209565_1000008 3300025263 Bacteria 774179
98 Ga0209565_1000107 3300025263 Bacteria 120938
99 Ga0209565_1000244 3300025263 Bacteria 58330
100 Ga0209455_1000005 3300025272 Bacteria 1416756
101 Ga0209673_1006891 3300025273 Bacteria 5382
102 Ga0209673_1009382 3300025273 Bacteria 4246
103 Ga0209676_1008859 3300025292 Bacteria 4424
104 Ga0209025_1000654 3300025294 Bacteria 60452
105 Ga0209564_1001160 3300025295 Bacteria 30665
106 Ga0209564_1024488 3300025295 Bacteria 2061
107 Ga0209758_1000004 3300025297 Bacteria 1375322
108 Ga0209758_1000035 3300025297 Bacteria 448190
109 Ga0209758_1009564 3300025297 Bacteria 5992
110 Ga0209758_1039171 3300025297 Bacteria 1806
111 Ga0209050_1000001 3300025298 Bacteria 3563507
112 Ga0209050_1000014 3300025298 Bacteria 774327
113 Ga0209050_1000889 3300025298 Bacteria 39832
114 Ga0209050_1025488 3300025298 Bacteria 2007
115 Ga0209050_1030086 3300025298 Bacteria 1720
116 Ga0209256_1000009 3300025299 Bacteria 922071
117 Ga0209256_1000010 3300025299 Bacteria 912110
118 Ga0209051_1000475 3300025303 Bacteria 52139
119 Ga0209257_1000019 3300025304 Bacteria 774261
120 Ga0209257_1001006 3300025304 Bacteria 38086
121 Ga0209257_1002852 3300025304 Bacteria 16172
122 Ga0209257_1005056 3300025304 Bacteria 9579
123 Ga0209257_1061144 3300025304 Bacteria 1023
124 Ga0207713_1011413 3300025735 Bacteria 4832
125 Ga0207688_10083109 3300025901 Bacteria 1831
126 Ga0207647_10038009 3300025904 Bacteria 3047
127 Ga0207647_10265349 3300025904 Bacteria 982
128 Ga0207705_10008018 3300025909 Bacteria 7743
129 Ga0207654_10000477 3300025911 Bacteria 22920
130 Ga0207707_10017829 3300025912 Bacteria 6193
131 Ga0207695_10011028 3300025913 Bacteria 10981
132 Ga0207695_10022051 3300025913 Bacteria 7245
133 Ga0207695_10053960 3300025913 Bacteria 4201
134 Ga0207671_10026601 3300025914 Bacteria 4333
135 Ga0207671_10038813 3300025914 Bacteria 3529
136 Ga0207671_10067699 3300025914 Bacteria 2660
137 Ga0207671_10111495 3300025914 Bacteria 2081
138 Ga0207660_10001239 3300025917 Bacteria 17089
139 Ga0207657_10006772 3300025919 Bacteria 11836
140 Ga0207657_10018007 3300025919 Bacteria 6759
141 Ga0207649_10000011 3300025920 Bacteria 266219
142 Ga0207649_10026039 3300025920 Bacteria 3417
143 Ga0207652_10000004 3300025921 Bacteria 436303
144 Ga0207650_10000095 3300025925 Bacteria 116052
145 Ga0207687_10000633 3300025927 Bacteria 23726
146 Ga0207644_10128352 3300025931 Bacteria 1938
147 Ga0207690_10003031 3300025932 Bacteria 10111
148 Ga0207690_10017494 3300025932 Bacteria 4378
149 Ga0207706_10033008 3300025933 Bacteria 4607
150 Ga0207709_10000360 3300025935 Bacteria 45984
151 Ga0207709_10223523 3300025935 Bacteria 1359
152 Ga0207669_10000343 3300025937 Bacteria 21217
153 Ga0207669_10006118 3300025937 Bacteria 5468
154 Ga0207711_10000029 3300025941 Bacteria 206826
155 Ga0207711_10009293 3300025941 Bacteria 8207
156 Ga0207689_10209114 3300025942 Bacteria 1612
157 Ga0207679_10192008 3300025945 Bacteria 1699
158 Ga0207667_10000010 3300025949 Bacteria 477432
159 Ga0207712_10000268 3300025961 Bacteria 50603
160 Ga0207668_10000489 3300025972 Bacteria 24856
161 Ga0207640_10003133 3300025981 Bacteria 8898
162 Ga0207640_10039164 3300025981 Bacteria 2998
163 Ga0207658_10001249 3300025986 Bacteria 20110
164 Ga0207677_10435777 3300026023 Bacteria 1120
165 Ga0207703_10000917 3300026035 Bacteria 28709
166 Ga0207639_10004240 3300026041 Bacteria 9662
167 Ga0207639_10328324 3300026041 Bacteria 1360
168 Ga0207678_10012467 3300026067 Bacteria 7465
169 Ga0207702_10010996 3300026078 Bacteria 7550
170 Ga0207702_10014867 3300026078 Bacteria 6458
171 Ga0207641_10000017 3300026088 Bacteria 299119
172 Ga0207676_10000037 3300026095 Bacteria 180826
173 Ga0207674_10012270 3300026116 Bacteria 9584
174 Ga0207674_10016839 3300026116 Bacteria 7988
175 Ga0207675_100000488 3300026118 Bacteria 38513
176 Ga0207675_100850193 3300026118 Bacteria 927
177 Ga0207683_10005772 3300026121 Bacteria 10609
178 Ga0207683_10115114 3300026121 Bacteria 2410
179 Ga0207698_10004700 3300026142 Bacteria 8353
180 Ga0268266_10000002 3300028379 Bacteria 3059047
181 Ga0268266_10058775 3300028379 Bacteria 3311
182 Ga0268265_10000025 3300028380 Bacteria 250207
183 Ga0307517_10033814 3300028786 Bacteria 5851
184 Ga0307408_100239649 3300031548 Bacteria 1490
185 Ga0307508_10000624 3300031616 Bacteria 42519
186 Ga0307407_10209288 3300031903 Bacteria 1312
187 Ga0307412_10000446 3300031911 Bacteria 25035
188 Ga0307412_10011206 3300031911 Bacteria 5187
189 Ga0307414_10016833 3300032004 Bacteria 4458
190 Ga0307414_10181633 3300032004 Bacteria 1693
191 Ga0307414_10364791 3300032004 Bacteria 1244
192 Ga0307411_10014497 3300032005 Bacteria 4389
193 Ga0307415_100344284 3300032126 Bacteria 1252
194 Ga0373932_0015818 3300035112 Bacteria 1918
195 Ga0373925_0338539 3300037068 Bacteria 1220
196 Ga0395900_0614004 3300037418 Bacteria 1027
197 Ga0395901_0030480 3300038443 Bacteria 5557
198 Ga0436365_0644123 3300039437 Bacteria 36806
199 Ga0436362_0100223 3300039453 Bacteria 27479
200 Ga0439436_0019264 3300041404 Bacteria 2037
201 Ga0439439_0002068 3300041406 Bacteria 4182
202 Ga0439461_0000045 3300041410 Bacteria 14698
203 Ga0439461_0001571 3300041410 Bacteria 3542
204 Ga0439465_0000282 3300041413 Bacteria 14277
205 Ga0439465_0019900 3300041413 Bacteria 2099
206 Ga0439431_0000591 3300041997 Bacteria 7679
207 Ga0439445_0011495 3300042004 Bacteria 2112
208 Ga0439448_0046468 3300042005 Bacteria 1414
209 Ga0439432_001706 3300042006 Bacteria 8218
210 Ga0439455_0010320 3300042012 Bacteria 2052
211 Ga0439457_004584 3300042014 Bacteria 3580
212 Ga0439462_0000137 3300042015 Bacteria 11722
213 Ga0439462_0002590 3300042015 Bacteria 4225
214 Ga0450920_013037 3300042122 Bacteria 1564
215 Ga0439434_0000299 3300042435 Bacteria 14222
216 Ga0466961_0013107 3300044693 Bacteria 5303
217 Ga0466964_0002066 3300044706 Bacteria 7064
218 Ga0466968_0079150 3300044735 Bacteria 1442
219 Ga0466959_0080308 3300045049 Bacteria 2351
220 Ga0466958_0035023 3300045836 Bacteria 2998
221 Ga0495617_025547 3300046452 Bacteria 1991
222 Ga0495627_060087 3300046453 Bacteria 1126
223 Ga0495638_0004588 3300046460 Bacteria 10456
224 Ga0495638_0016606 3300046460 Bacteria 4926
225 Ga0495650_0000058 3300046471 Bacteria 302308
226 Ga0495584_0008643 3300046491 Bacteria 5272
227 Ga0495584_0206198 3300046491 Bacteria 999
228 Ga0495585_0002905 3300046492 Bacteria 11870
229 Ga0495585_0103847 3300046492 Bacteria 1517
230 Ga0495596_0016326 3300046500 Bacteria 3086
231 Ga0495583_0001636 3300046506 Bacteria 21854
232 Ga0495583_0012510 3300046506 Bacteria 4793
233 Ga0495606_0000359 3300046507 Bacteria 77863
234 Ga0495631_0015474 3300046518 Bacteria 3653
235 Ga0495631_0069625 3300046518 Bacteria 1521
236 Ga0495637_0038998 3300046520 Bacteria 2054
237 Ga0495637_0052920 3300046520 Bacteria 1692
238 Ga0495643_0001215 3300046522 Bacteria 24923
239 Ga0495643_0004105 3300046522 Bacteria 10360
240 Ga0495643_0113080 3300046522 Bacteria 1378
241 Ga0495643_0116819 3300046522 Bacteria 1351
242 Ga0495643_0164903 3300046522 Bacteria 1087
243 Ga0495648_0000069 3300046524 Bacteria 136934
244 Ga0495648_0087852 3300046524 Bacteria 1749
245 Ga0495587_0022887 3300046536 Bacteria 3844
246 Ga0495597_0010225 3300046542 Bacteria 4595
247 Ga0495622_0001678 3300046557 Bacteria 10952
248 Ga0495633_0002461 3300046558 Bacteria 13068
249 Ga0495633_0010055 3300046558 Bacteria 5186
250 Ga0495633_0094046 3300046558 Bacteria 1393
251 Ga0495668_0000258 3300046616 Bacteria 75022
252 Ga0495668_0034457 3300046616 Bacteria 2840
253 Ga0495668_0087416 3300046616 Bacteria 1709
254 Ga0495611_0004123 3300046648 Bacteria 6330
255 Ga0495611_0027083 3300046648 Bacteria 2504
256 Ga0495625_0000112 3300046660 Bacteria 124365
257 Ga0495625_0000568 3300046660 Bacteria 54059
258 Ga0495625_0020349 3300046660 Bacteria 5126
259 Ga0495625_0026582 3300046660 Bacteria 4372
260 Ga0495625_0032629 3300046660 Bacteria 3859
261 Ga0495625_0092592 3300046660 Bacteria 2088
262 Ga0495625_0099983 3300046660 Bacteria 1994
263 Ga0495669_0000096 3300046684 Bacteria 56184
264 Ga0495669_0109921 3300046684 Bacteria 1286
265 Ga0495670_0000002 3300046691 Bacteria 601814
266 Ga0495670_0299902 3300046691 Bacteria 861
267 Ga0495660_0062337 3300046810 Bacteria 1999
268 Ga0495687_000378 3300047443 Bacteria 55453
269 Ga0495687_001985 3300047443 Bacteria 17414
270 Ga0495677_0024961 3300047445 Bacteria 2168
271 Ga0495677_0102544 3300047445 Bacteria 1084
272 Ga0495681_0016192 3300047470 Bacteria 4193
273 Ga0495686_0000254 3300047472 Bacteria 95907
274 Ga0495686_0001633 3300047472 Bacteria 23415
275 Ga0495686_0009528 3300047472 Bacteria 6987
276 Ga0495686_0029847 3300047472 Bacteria 3544
277 Ga0496102_0000281 3300048905 Bacteria 64939
278 Ga0496102_0136457 3300048905 Bacteria 2299
279 Ga0496103_0000207 3300048906 Bacteria 58942
280 Ga0496103_0218443 3300048906 Bacteria 1226
281 Ga0496104_0015330 3300048907 Bacteria 6940
282 Ga0496105_0028166 3300048908 Bacteria 4594
283 Ga0496110_0093988 3300048913 Bacteria 2684
284 Ga0496115_0000134 3300048918 Bacteria 67910
285 Ga0496115_0005681 3300048918 Bacteria 9079
286 Ga0496117_0002728 3300048920 Bacteria 21676
287 Ga0496117_0002971 3300048920 Bacteria 20458
288 Ga0496117_0003644 3300048920 Bacteria 17744
289 Ga0496118_0000082 3300048921 Bacteria 185820
290 Ga0496118_0000216 3300048921 Bacteria 100502
291 Ga0496118_0000525 3300048921 Bacteria 62968
292 Ga0496118_0067203 3300048921 Bacteria 2612
293 Ga0496119_0007352 3300048922 Bacteria 9954
294 Ga0496120_0032229 3300048923 Bacteria 3162
295 Ga0496120_0077201 3300048923 Bacteria 1813
296 Ga0496121_0000066 3300048924 Bacteria 267065
297 Ga0496121_0000655 3300048924 Bacteria 64922
298 Ga0496121_0001645 3300048924 Bacteria 36918
299 Ga0496121_0023519 3300048924 Bacteria 5930
300 Ga0496123_0054674 3300048926 Bacteria 2626
301 Ga0496123_0078869 3300048926 Bacteria 2015
302 Ga0496124_0000054 3300048927 Bacteria 252172
303 Ga0496124_0000068 3300048927 Bacteria 221819
304 Ga0496124_0004872 3300048927 Bacteria 15435
305 Ga0496124_0045899 3300048927 Bacteria 3744
306 Ga0496124_0352637 3300048927 Bacteria 1040
307 Ga0496125_0002717 3300048928 Bacteria 22476
308 Ga0496125_0041473 3300048928 Bacteria 3933
309 Ga0496126_0000634 3300048929 Bacteria 65566
310 Ga0496126_0054224 3300048929 Bacteria 3633
311 Ga0501080_0208282 3300049742 Bacteria 1793
312 Ga0501044_0037984 3300049823 Bacteria 5031
313 nmdc:mga07m45_165780_c1 3300050496 Bacteria 1283
314 nmdc:mga0qj67_38446_c1 3300050509 Bacteria 3754
315 Ga0500610_0000197 3300053079 Bacteria 18347
316 Ga0500643_000467 3300053087 Bacteria 29824
317 Ga0500647_0046681 3300053091 Bacteria 2082
318 Ga0500651_0006181 3300053093 Bacteria 6880
319 Ga0500566_0001151 3300053094 Bacteria 15363
320 Ga0500641_0003393 3300053096 Bacteria 5631
321 Ga0500556_0052031 3300053104 Bacteria 1485
322 Ga0500562_030640 3300053108 Bacteria 1418
323 Ga0500595_000520 3300053119 Bacteria 23212
324 Ga0500595_001363 3300053119 Bacteria 13145
325 Ga0500607_000042 3300053121 Bacteria 85000
326 Ga0500607_140283 3300053121 Bacteria 1138
327 Ga0500618_018604 3300053125 Bacteria 1717
328 Ga0500642_0004915 3300053130 Bacteria 4246
329 Ga0500642_0038391 3300053130 Bacteria 2053
330 Ga0500655_000024 3300053133 Bacteria 43300
331 Ga0500658_0001374 3300053134 Bacteria 9842
332 Ga0500658_0001428 3300053134 Bacteria 9614
333 Ga0500559_0000337 3300053136 Bacteria 35168
334 Ga0500568_0007680 3300053139 Bacteria 5267
335 Ga0500573_0000086 3300053140 Bacteria 42361
336 Ga0500588_0071468 3300053146 Bacteria 1139
337 Ga0500590_000258 3300053148 Bacteria 16515
338 Ga0500604_0028996 3300053151 Bacteria 1610
339 Ga0500616_0013045 3300053153 Bacteria 4840
340 Ga0500616_0091370 3300053153 Bacteria 1507
341 Ga0500619_000498 3300053154 Bacteria 6835
342 Ga0500622_0012631 3300053156 Bacteria 4571
343 Ga0500627_0107432 3300053158 Bacteria 1255
344 Ga0500639_063132 3300053163 Bacteria 1905
345 Ga0500636_0031554 3300053177 Bacteria 3136
346 Ga0500637_0010266 3300053178 Bacteria 4796
347 Ga0500570_000188 3300053724 Bacteria 19563
348 Ga0500645_000008 3300053730 Bacteria 212254
349 Ga0500645_001058 3300053730 Bacteria 15269
350 Ga0500596_000369 3300053735 Bacteria 8157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0015474 Ga0495631_0015474_31_792 243
2 3300046691 Ga0495670_0299902 Ga0495670_0299902_29_829 253
3 3300046660 Ga0495625_0000568 Ga0495625_0000568_45250_46083 256
4 3300047443 Ga0495687_001985 Ga0495687_001985_13879_14712 259
5 3300046491 Ga0495584_0008643 Ga0495584_0008643_2879_3712 260
6 3300046506 Ga0495583_0012510 Ga0495583_0012510_1569_2402 260
7 3300046518 Ga0495631_0069625 Ga0495631_0069625_270_1103 260
8 3300046524 Ga0495648_0000069 Ga0495648_0000069_121295_122128 260
9 3300046648 Ga0495611_0004123 Ga0495611_0004123_5091_5924 260
10 3300046660 Ga0495625_0020349 Ga0495625_0020349_1859_2692 260
11 3300046684 Ga0495669_0000096 Ga0495669_0000096_35612_36445 260
12 3300046810 Ga0495660_0062337 Ga0495660_0062337_375_1208 260
13 3300047443 Ga0495687_000378 Ga0495687_000378_19132_19965 260
14 3300053079 Ga0500610_0000197 Ga0500610_0000197_7982_8815 260
15 3300053730 Ga0500645_000008 Ga0500645_000008_172978_173811 260
16 3300053735 Ga0500596_000369 Ga0500596_000369_6336_7169 260
17 3300001979 JGI24740J21852_10002639 JGI24740J21852_100026399 261
18 3300003215 JGI25153J46596_10000016 JGI25153J46596_10000016274 261
19 3300013102 Ga0157371_10001732 Ga0157371_1000173211 261
20 3300013104 Ga0157370_10342711 Ga0157370_103427112 261
21 3300025297 Ga0209758_1000035 Ga0209758_1000035343 261
22 3300025911 Ga0207654_10000477 Ga0207654_1000047718 261
23 3300025913 Ga0207695_10053960 Ga0207695_100539606 261
24 3300025914 Ga0207671_10067699 Ga0207671_100676995 261
25 3300026067 Ga0207678_10012467 Ga0207678_100124679 261
26 3300026078 Ga0207702_10010996 Ga0207702_100109964 261
27 3300026116 Ga0207674_10012270 Ga0207674_100122706 261
28 3300028786 Ga0307517_10033814 Ga0307517_100338148 261
29 3300046452 Ga0495617_025547 Ga0495617_025547_956_1789 261
30 3300046471 Ga0495650_0000058 Ga0495650_0000058_259302_260135 261
31 3300046506 Ga0495583_0001636 Ga0495583_0001636_6522_7355 261
32 3300046536 Ga0495587_0022887 Ga0495587_0022887_589_1422 261
33 3300046557 Ga0495622_0001678 Ga0495622_0001678_647_1480 261
34 3300046558 Ga0495633_0010055 Ga0495633_0010055_1325_2158 261
35 3300053091 Ga0500647_0046681 Ga0500647_0046681_1106_1939 261
36 3300053119 Ga0500595_000520 Ga0500595_000520_22265_23098 261
37 3300053121 Ga0500607_140283 Ga0500607_140283_205_1038 261
38 3300053154 Ga0500619_000498 Ga0500619_000498_2628_3461 261
39 3300053177 Ga0500636_0031554 Ga0500636_0031554_1413_2246 261
40 3300005339 Ga0070660_100008166 Ga0070660_1000081667 262
41 3300005564 Ga0070664_100138605 Ga0070664_1001386054 262
42 3300009174 Ga0105241_10004163 Ga0105241_100041638 262
43 3300025904 Ga0207647_10038009 Ga0207647_100380093 262
44 3300025919 Ga0207657_10006772 Ga0207657_1000677210 262
45 3300025920 Ga0207649_10026039 Ga0207649_100260396 262
46 3300025932 Ga0207690_10003031 Ga0207690_100030314 262
47 3300025949 Ga0207667_10000010 Ga0207667_10000010395 262
48 3300025981 Ga0207640_10003133 Ga0207640_100031337 262
49 3300026041 Ga0207639_10004240 Ga0207639_1000424010 262
50 3300046491 Ga0495584_0206198 Ga0495584_0206198_96_929 262
51 3300046492 Ga0495585_0002905 Ga0495585_0002905_1320_2153 262
52 3300046522 Ga0495643_0004105 Ga0495643_0004105_2843_3676 262
53 3300047445 Ga0495677_0024961 Ga0495677_0024961_68_901 262
54 3300053121 Ga0500607_000042 Ga0500607_000042_2387_3178 262
55 3300053136 Ga0500559_0000337 Ga0500559_0000337_2400_3191 262
56 3300053178 Ga0500637_0010266 Ga0500637_0010266_1780_2571 262
57 3300046520 Ga0495637_0052920 Ga0495637_0052920_202_1035 263
58 3300046524 Ga0495648_0087852 Ga0495648_0087852_323_1156 263
59 3300046558 Ga0495633_0002461 Ga0495633_0002461_5288_6121 263
60 3300046660 Ga0495625_0032629 Ga0495625_0032629_55_888 263
61 3300005366 Ga0070659_100013217 Ga0070659_1000132174 264
62 3300025932 Ga0207690_10017494 Ga0207690_100174945 264
63 3300046492 Ga0495585_0103847 Ga0495585_0103847_230_1063 265
64 3300046522 Ga0495643_0001215 Ga0495643_0001215_18120_18953 265
65 3300005329 Ga0070683_100310643 Ga0070683_1003106433 266
66 3300025904 Ga0207647_10265349 Ga0207647_102653491 266
67 3300046691 Ga0495670_0000002 Ga0495670_0000002_556806_557606 266
68 3300047445 Ga0495677_0102544 Ga0495677_0102544_23_823 266
69 3300053104 Ga0500556_0052031 Ga0500556_0052031_134_934 266
70 3300053134 Ga0500658_0001374 Ga0500658_0001374_506_1306 266
71 3300053139 Ga0500568_0007680 Ga0500568_0007680_1178_1978 266
72 3300053151 Ga0500604_0028996 Ga0500604_0028996_766_1566 266
73 3300048906 Ga0496103_0218443 Ga0496103_0218443_409_1212 267
74 iso_pu_bacteria 2885429604 2885431342 269
75 iso_pu_bacteria 2599185359 2600225034 270
76 iso_pu_bacteria 2818991466 2819713308 270
77 iso_pu_bacteria 2928526807 2928527788 270
78 iso_pu_bacteria 2928968154 2928971584 270
79 iso_pu_bacteria 2990265787 2990269369 270
80 iso_pu_bacteria 2993693658 2993694376 270
81 3300031903 Ga0307407_10209288 Ga0307407_102092882 271
82 3300032126 Ga0307415_100344284 Ga0307415_1003442842 271
83 iso_pu_bacteria 2582581305 2585260451 271
84 iso_pu_bacteria 2643221605 2644037249 271
85 3300003214 JGI25165J46597_1000012 JGI25165J46597_1000012267 272
86 3300025261 Ga0209233_1000058 Ga0209233_1000058149 272
87 3300001990 JGI24737J22298_10072266 JGI24737J22298_100722662 273
88 3300003215 JGI25153J46596_10005701 JGI25153J46596_100057014 273
89 3300003759 Ga0055525_1000090 Ga0055525_100009097 273
90 3300003762 Ga0055542_1000037 Ga0055542_10000379 273
91 3300003763 Ga0055529_1000042 Ga0055529_10000429 273
92 3300003763 Ga0055529_1000109 Ga0055529_100010979 273
93 3300003773 Ga0055537_1001866 Ga0055537_10018665 273
94 3300003775 Ga0055524_1000983 Ga0055524_100098310 273
95 3300003791 Ga0055530_10005327 Ga0055530_100053276 273
96 3300003791 Ga0055530_10009798 Ga0055530_100097984 273
97 3300003794 Ga0055531_10007069 Ga0055531_100070696 273
98 3300005262 Ga0065165_1003151 Ga0065165_100315111 273
99 3300005262 Ga0065165_1006091 Ga0065165_10060918 273
100 3300005262 Ga0065165_1007138 Ga0065165_10071388 273
101 3300005262 Ga0065165_1033345 Ga0065165_10333452 273
102 3300005327 Ga0070658_10008914 Ga0070658_100089146 273
103 3300005338 Ga0068868_100446423 Ga0068868_1004464232 273
104 3300005347 Ga0070668_100090660 Ga0070668_1000906602 273
105 3300005354 Ga0070675_100097973 Ga0070675_1000979733 273
106 3300005354 Ga0070675_100189393 Ga0070675_1001893933 273
107 3300005356 Ga0070674_100003402 Ga0070674_10000340211 273
108 3300005356 Ga0070674_100010650 Ga0070674_1000106505 273
109 3300005364 Ga0070673_100206039 Ga0070673_1002060394 273
110 3300005456 Ga0070678_100002212 Ga0070678_10000221211 273
111 3300005459 Ga0068867_100094889 Ga0068867_1000948892 273
112 3300005543 Ga0070672_100244793 Ga0070672_1002447932 273
113 3300005548 Ga0070665_100000044 Ga0070665_10000004485 273
114 3300005617 Ga0068859_100001760 Ga0068859_10000176014 273
115 3300005719 Ga0068861_100000009 Ga0068861_10000000936 273
116 3300005983 Ga0081540_1107758 Ga0081540_11077582 273
117 3300006186 Ga0075369_10070610 Ga0075369_100706104 273
118 3300006353 Ga0075370_10129508 Ga0075370_101295082 273
119 3300006358 Ga0068871_100284505 Ga0068871_1002845052 273
120 3300006931 Ga0097620_100001760 Ga0097620_10000176014 273
121 3300009098 Ga0105245_10001634 Ga0105245_1000163415 273
122 3300009148 Ga0105243_10000224 Ga0105243_1000022461 273
123 3300009177 Ga0105248_10004165 Ga0105248_1000416512 273
124 3300014968 Ga0157379_10035802 Ga0157379_100358022 273
125 3300017792 Ga0163161_10072982 Ga0163161_100729823 273
126 3300025230 Ga0209563_100111 Ga0209563_10011161 273
127 3300025245 Ga0207425_1006302 Ga0207425_10063023 273
128 3300025254 Ga0209148_1000026 Ga0209148_1000026393 273
129 3300025263 Ga0209565_1000008 Ga0209565_1000008331 273
130 3300025272 Ga0209455_1000005 Ga0209455_10000051140 273
131 3300025273 Ga0209673_1009382 Ga0209673_10093824 273
132 3300025297 Ga0209758_1009564 Ga0209758_10095644 273
133 3300025298 Ga0209050_1000014 Ga0209050_1000014358 273
134 3300025298 Ga0209050_1025488 Ga0209050_10254883 273
135 3300025299 Ga0209256_1000009 Ga0209256_1000009540 273
136 3300025299 Ga0209256_1000010 Ga0209256_1000010464 273
137 3300025304 Ga0209257_1000019 Ga0209257_1000019334 273
138 3300025304 Ga0209257_1002852 Ga0209257_10028525 273
139 3300025901 Ga0207688_10083109 Ga0207688_100831093 273
140 3300025909 Ga0207705_10008018 Ga0207705_1000801810 273
141 3300025914 Ga0207671_10026601 Ga0207671_100266014 273
142 3300025927 Ga0207687_10000633 Ga0207687_1000063316 273
143 3300025933 Ga0207706_10033008 Ga0207706_100330085 273
144 3300025935 Ga0207709_10000360 Ga0207709_1000036023 273
145 3300025935 Ga0207709_10223523 Ga0207709_102235233 273
146 3300025937 Ga0207669_10000343 Ga0207669_1000034321 273
147 3300025937 Ga0207669_10006118 Ga0207669_100061185 273
148 3300025941 Ga0207711_10009293 Ga0207711_100092938 273
149 3300025942 Ga0207689_10209114 Ga0207689_102091143 273
150 3300026023 Ga0207677_10435777 Ga0207677_104357771 273
151 3300026118 Ga0207675_100000488 Ga0207675_10000048838 273
152 3300026121 Ga0207683_10005772 Ga0207683_100057726 273
153 3300026121 Ga0207683_10115114 Ga0207683_101151142 273
154 3300028379 Ga0268266_10000002 Ga0268266_100000021976 273
155 3300028379 Ga0268266_10058775 Ga0268266_100587756 273
156 3300031616 Ga0307508_10000624 Ga0307508_1000062435 273
157 3300031911 Ga0307412_10000446 Ga0307412_1000044630 273
158 3300041404 Ga0439436_0019264 Ga0439436_0019264_306_1127 273
159 3300041406 Ga0439439_0002068 Ga0439439_0002068_1897_2718 273
160 3300041410 Ga0439461_0000045 Ga0439461_0000045_9748_10569 273
161 3300041410 Ga0439461_0001571 Ga0439461_0001571_607_1428 273
162 3300041413 Ga0439465_0000282 Ga0439465_0000282_1382_2203 273
163 3300041413 Ga0439465_0019900 Ga0439465_0019900_455_1276 273
164 3300041997 Ga0439431_0000591 Ga0439431_0000591_4243_5064 273
165 3300042004 Ga0439445_0011495 Ga0439445_0011495_718_1539 273
166 3300042006 Ga0439432_001706 Ga0439432_001706_709_1530 273
167 3300042014 Ga0439457_004584 Ga0439457_004584_2627_3448 273
168 3300042015 Ga0439462_0000137 Ga0439462_0000137_9997_10818 273
169 3300042015 Ga0439462_0002590 Ga0439462_0002590_448_1269 273
170 3300042122 Ga0450920_013037 Ga0450920_013037_665_1486 273
171 3300042435 Ga0439434_0000299 Ga0439434_0000299_4546_5367 273
172 3300046453 Ga0495627_060087 Ga0495627_060087_124_945 273
173 3300046500 Ga0495596_0016326 Ga0495596_0016326_314_1147 273
174 3300046507 Ga0495606_0000359 Ga0495606_0000359_19497_20330 273
175 3300046522 Ga0495643_0113080 Ga0495643_0113080_55_888 273
176 3300046522 Ga0495643_0164903 Ga0495643_0164903_150_983 273
177 3300046616 Ga0495668_0000258 Ga0495668_0000258_30150_30983 273
178 3300046648 Ga0495611_0027083 Ga0495611_0027083_1312_2145 273
179 3300046660 Ga0495625_0092592 Ga0495625_0092592_687_1520 273
180 3300047470 Ga0495681_0016192 Ga0495681_0016192_1322_2155 273
181 3300047472 Ga0495686_0001633 Ga0495686_0001633_21115_21936 273
182 3300048905 Ga0496102_0000281 Ga0496102_0000281_37322_38155 273
183 3300048906 Ga0496103_0000207 Ga0496103_0000207_43867_44700 273
184 3300048907 Ga0496104_0015330 Ga0496104_0015330_2951_3784 273
185 3300048908 Ga0496105_0028166 Ga0496105_0028166_2869_3702 273
186 3300048913 Ga0496110_0093988 Ga0496110_0093988_522_1355 273
187 3300048918 Ga0496115_0000134 Ga0496115_0000134_55321_56154 273
188 3300048920 Ga0496117_0002971 Ga0496117_0002971_16740_17573 273
189 3300048921 Ga0496118_0000082 Ga0496118_0000082_813_1646 273
190 3300048922 Ga0496119_0007352 Ga0496119_0007352_7365_8198 273
191 3300048923 Ga0496120_0032229 Ga0496120_0032229_931_1764 273
192 3300048923 Ga0496120_0077201 Ga0496120_0077201_109_933 273
193 3300048924 Ga0496121_0000655 Ga0496121_0000655_26899_27732 273
194 3300048926 Ga0496123_0054674 Ga0496123_0054674_855_1688 273
195 3300048926 Ga0496123_0078869 Ga0496123_0078869_468_1292 273
196 3300048927 Ga0496124_0000054 Ga0496124_0000054_11378_12202 273
197 3300048927 Ga0496124_0000068 Ga0496124_0000068_183676_184509 273
198 3300048927 Ga0496124_0004872 Ga0496124_0004872_6216_7040 273
199 3300048927 Ga0496124_0045899 Ga0496124_0045899_40_864 273
200 3300048927 Ga0496124_0352637 Ga0496124_0352637_148_972 273
201 3300048928 Ga0496125_0002717 Ga0496125_0002717_5019_5852 273
202 3300048929 Ga0496126_0000634 Ga0496126_0000634_27551_28384 273
203 3300048929 Ga0496126_0054224 Ga0496126_0054224_2034_2858 273
204 3300049742 Ga0501080_0208282 Ga0501080_0208282_678_1499 273
205 3300050496 nmdc:mga07m45_165780_c1 nmdc:mga07m45_165780_c1_19_843 273
206 3300053094 Ga0500566_0001151 Ga0500566_0001151_11446_12267 273
207 3300053096 Ga0500641_0003393 Ga0500641_0003393_3505_4329 273
208 3300053108 Ga0500562_030640 Ga0500562_030640_430_1254 273
209 3300053119 Ga0500595_001363 Ga0500595_001363_8914_9738 273
210 3300053130 Ga0500642_0004915 Ga0500642_0004915_2792_3625 273
211 3300053140 Ga0500573_0000086 Ga0500573_0000086_15902_16723 273
212 3300053146 Ga0500588_0071468 Ga0500588_0071468_211_1035 273
213 3300053158 Ga0500627_0107432 Ga0500627_0107432_215_1039 273
214 3300053730 Ga0500645_001058 Ga0500645_001058_13976_14797 273
215 3300002774 JGI25150J39212_1000570 JGI25150J39212_10005707 274
216 3300003215 JGI25153J46596_10000029 JGI25153J46596_1000002932 274
217 3300003771 Ga0055526_1000846 Ga0055526_100084615 274
218 3300003773 Ga0055537_1003656 Ga0055537_10036562 274
219 3300003781 Ga0055536_1009610 Ga0055536_10096102 274
220 3300003792 Ga0055540_1000349 Ga0055540_10003499 274
221 3300005327 Ga0070658_10074431 Ga0070658_100744313 274
222 3300005337 Ga0070682_100138341 Ga0070682_1001383413 274
223 3300005339 Ga0070660_100010454 Ga0070660_1000104546 274
224 3300005344 Ga0070661_100000001 Ga0070661_100000001264 274
225 3300005458 Ga0070681_10023551 Ga0070681_1002355110 274
226 3300005530 Ga0070679_100000003 Ga0070679_10000000358 274
227 3300012500 Ga0157314_1004544 Ga0157314_10045442 274
228 3300021358 Ga0213873_10000025 Ga0213873_1000002514 274
229 3300021384 Ga0213876_10000004 Ga0213876_1000000484 274
230 3300025245 Ga0207425_1000041 Ga0207425_1000041156 274
231 3300025258 Ga0209129_1001433 Ga0209129_10014336 274
232 3300025263 Ga0209565_1000107 Ga0209565_1000107114 274
233 3300025263 Ga0209565_1000244 Ga0209565_10002443 274
234 3300025273 Ga0209673_1006891 Ga0209673_10068912 274
235 3300025292 Ga0209676_1008859 Ga0209676_10088594 274
236 3300025294 Ga0209025_1000654 Ga0209025_100065421 274
237 3300025295 Ga0209564_1001160 Ga0209564_100116013 274
238 3300025295 Ga0209564_1024488 Ga0209564_10244882 274
239 3300025297 Ga0209758_1000004 Ga0209758_1000004224 274
240 3300025297 Ga0209758_1039171 Ga0209758_10391712 274
241 3300025298 Ga0209050_1000001 Ga0209050_10000012177 274
242 3300025298 Ga0209050_1000889 Ga0209050_100088918 274
243 3300025298 Ga0209050_1030086 Ga0209050_10300862 274
244 3300025303 Ga0209051_1000475 Ga0209051_100047538 274
245 3300025304 Ga0209257_1001006 Ga0209257_100100631 274
246 3300025304 Ga0209257_1005056 Ga0209257_10050568 274
247 3300025912 Ga0207707_10017829 Ga0207707_100178292 274
248 3300025917 Ga0207660_10001239 Ga0207660_100012399 274
249 3300025919 Ga0207657_10018007 Ga0207657_100180075 274
250 3300025920 Ga0207649_10000011 Ga0207649_10000011231 274
251 3300025921 Ga0207652_10000004 Ga0207652_1000000458 274
252 3300026035 Ga0207703_10000917 Ga0207703_1000091718 274
253 3300032004 Ga0307414_10181633 Ga0307414_101816332 274
254 3300035112 Ga0373932_0015818 Ga0373932_0015818_748_1572 274
255 3300037418 Ga0395900_0614004 Ga0395900_0614004_78_902 274
256 3300038443 Ga0395901_0030480 Ga0395901_0030480_461_1285 274
257 3300039437 Ga0436365_0644123 Ga0436365_0644123_9701_10531 274
258 3300039453 Ga0436362_0100223 Ga0436362_0100223_16949_17779 274
259 3300046460 Ga0495638_0004588 Ga0495638_0004588_4398_5222 274
260 3300046660 Ga0495625_0000112 Ga0495625_0000112_47432_48256 274
261 3300046660 Ga0495625_0099983 Ga0495625_0099983_589_1413 274
262 3300047472 Ga0495686_0029847 Ga0495686_0029847_2698_3522 274
263 3300048918 Ga0496115_0005681 Ga0496115_0005681_7868_8692 274
264 3300048924 Ga0496121_0023519 Ga0496121_0023519_422_1246 274
265 3300050509 nmdc:mga0qj67_38446_c1 nmdc:mga0qj67_38446_c1_1988_2812 274
266 3300053134 Ga0500658_0001428 Ga0500658_0001428_7641_8465 274
267 3300053153 Ga0500616_0013045 Ga0500616_0013045_1442_2266 274
268 3300053153 Ga0500616_0091370 Ga0500616_0091370_133_957 274
269 3300005539 Ga0068853_100242725 Ga0068853_1002427252 275
270 3300005578 Ga0068854_100044486 Ga0068854_1000444863 275
271 3300009093 Ga0105240_10056657 Ga0105240_100566576 275
272 3300009545 Ga0105237_10010045 Ga0105237_1001004510 275
273 3300010375 Ga0105239_10004982 Ga0105239_100049824 275
274 3300025304 Ga0209257_1061144 Ga0209257_10611441 275
275 3300025913 Ga0207695_10011028 Ga0207695_1001102813 275
276 3300025913 Ga0207695_10022051 Ga0207695_100220516 275
277 3300025914 Ga0207671_10038813 Ga0207671_100388135 275
278 3300025981 Ga0207640_10039164 Ga0207640_100391643 275
279 3300026041 Ga0207639_10328324 Ga0207639_103283243 275
280 3300026118 Ga0207675_100850193 Ga0207675_1008501931 275
281 3300031548 Ga0307408_100239649 Ga0307408_1002396492 275
282 3300031911 Ga0307412_10011206 Ga0307412_100112067 275
283 3300032004 Ga0307414_10016833 Ga0307414_100168335 275
284 3300032004 Ga0307414_10364791 Ga0307414_103647912 275
285 3300032005 Ga0307411_10014497 Ga0307411_100144973 275
286 3300037068 Ga0373925_0338539 Ga0373925_0338539_141_968 275
287 3300046460 Ga0495638_0016606 Ga0495638_0016606_3398_4225 275
288 3300046520 Ga0495637_0038998 Ga0495637_0038998_1144_1971 275
289 3300046522 Ga0495643_0116819 Ga0495643_0116819_142_969 275
290 3300046542 Ga0495597_0010225 Ga0495597_0010225_335_1162 275
291 3300046558 Ga0495633_0094046 Ga0495633_0094046_440_1267 275
292 3300046616 Ga0495668_0034457 Ga0495668_0034457_1689_2516 275
293 3300046616 Ga0495668_0087416 Ga0495668_0087416_655_1482 275
294 3300046660 Ga0495625_0026582 Ga0495625_0026582_1225_2052 275
295 3300046684 Ga0495669_0109921 Ga0495669_0109921_444_1271 275
296 3300047472 Ga0495686_0009528 Ga0495686_0009528_5093_5920 275
297 3300048921 Ga0496118_0067203 Ga0496118_0067203_752_1579 275
298 3300048924 Ga0496121_0000066 Ga0496121_0000066_255169_255996 275
299 3300048924 Ga0496121_0001645 Ga0496121_0001645_12570_13397 275
300 3300048928 Ga0496125_0041473 Ga0496125_0041473_3042_3869 275
301 3300053093 Ga0500651_0006181 Ga0500651_0006181_670_1497 275
302 3300053125 Ga0500618_018604 Ga0500618_018604_349_1176 275
303 3300053130 Ga0500642_0038391 Ga0500642_0038391_601_1428 275
304 3300053133 Ga0500655_000024 Ga0500655_000024_6875_7702 275
305 3300053148 Ga0500590_000258 Ga0500590_000258_1486_2313 275
306 3300053156 Ga0500622_0012631 Ga0500622_0012631_3218_4045 275
307 3300053163 Ga0500639_063132 Ga0500639_063132_213_1040 275
308 3300053724 Ga0500570_000188 Ga0500570_000188_6606_7433 275
309 3300001976 JGI24752J21851_1000184 JGI24752J21851_10001846 276
310 3300003322 rootL2_10085829 rootL2_100858292 276
311 3300005289 Ga0065704_10086132 Ga0065704_100861323 276
312 3300005331 Ga0070670_100000014 Ga0070670_100000014162 276
313 3300005344 Ga0070661_100126926 Ga0070661_1001269262 276
314 3300005355 Ga0070671_100013681 Ga0070671_10001368110 276
315 3300005367 Ga0070667_100000609 Ga0070667_10000060923 276
316 3300005564 Ga0070664_100204704 Ga0070664_1002047042 276
317 3300005577 Ga0068857_100013310 Ga0068857_1000133104 276
318 3300005614 Ga0068856_100043121 Ga0068856_1000431214 276
319 3300005616 Ga0068852_100000303 Ga0068852_1000003037 276
320 3300005617 Ga0068859_100022081 Ga0068859_1000220813 276
321 3300005618 Ga0068864_100000021 Ga0068864_100000021173 276
322 3300005841 Ga0068863_100000009 Ga0068863_100000009180 276
323 3300005844 Ga0068862_100000017 Ga0068862_100000017176 276
324 3300006931 Ga0097620_100022080 Ga0097620_1000220803 276
325 3300009011 Ga0105251_10000079 Ga0105251_1000007963 276
326 3300009177 Ga0105248_10000030 Ga0105248_1000003035 276
327 3300009553 Ga0105249_10000625 Ga0105249_1000062513 276
328 3300009978 Ga0105148_103006 Ga0105148_1030062 276
329 3300014968 Ga0157379_10050503 Ga0157379_100505032 276
330 3300025735 Ga0207713_1011413 Ga0207713_10114133 276
331 3300025914 Ga0207671_10111495 Ga0207671_101114953 276
332 3300025925 Ga0207650_10000095 Ga0207650_1000009560 276
333 3300025931 Ga0207644_10128352 Ga0207644_101283522 276
334 3300025941 Ga0207711_10000029 Ga0207711_1000002935 276
335 3300025945 Ga0207679_10192008 Ga0207679_101920083 276
336 3300025961 Ga0207712_10000268 Ga0207712_1000026829 276
337 3300025972 Ga0207668_10000489 Ga0207668_1000048921 276
338 3300025986 Ga0207658_10001249 Ga0207658_1000124914 276
339 3300026078 Ga0207702_10014867 Ga0207702_100148678 276
340 3300026088 Ga0207641_10000017 Ga0207641_10000017200 276
341 3300026095 Ga0207676_10000037 Ga0207676_1000003786 276
342 3300026116 Ga0207674_10016839 Ga0207674_100168395 276
343 3300026142 Ga0207698_10004700 Ga0207698_100047007 276
344 3300028380 Ga0268265_10000025 Ga0268265_1000002563 276
345 3300042005 Ga0439448_0046468 Ga0439448_0046468_565_1395 276
346 3300042012 Ga0439455_0010320 Ga0439455_0010320_626_1456 276
347 3300044693 Ga0466961_0013107 Ga0466961_0013107_3346_4176 276
348 3300044706 Ga0466964_0002066 Ga0466964_0002066_5225_6055 276
349 3300044735 Ga0466968_0079150 Ga0466968_0079150_23_853 276
350 3300045049 Ga0466959_0080308 Ga0466959_0080308_1108_1938 276
351 3300045836 Ga0466958_0035023 Ga0466958_0035023_1396_2226 276
352 3300047472 Ga0495686_0000254 Ga0495686_0000254_40401_41231 276
353 3300048905 Ga0496102_0136457 Ga0496102_0136457_755_1585 276
354 3300048920 Ga0496117_0002728 Ga0496117_0002728_8153_8983 276
355 3300048920 Ga0496117_0003644 Ga0496117_0003644_9169_9999 276
356 3300048921 Ga0496118_0000216 Ga0496118_0000216_60329_61159 276
357 3300048921 Ga0496118_0000525 Ga0496118_0000525_41872_42702 276
358 3300049823 Ga0501044_0037984 Ga0501044_0037984_3622_4452 276
359 3300053087 Ga0500643_000467 Ga0500643_000467_3019_3849 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

3

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.9291 2 267
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.9253 2 267
4hg3-assembly2.cif.gz_D structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate 0.9178 2 267
4hg5-assembly1.cif.gz_C structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate 0.9164 2 267
1j31-assembly2.cif.gz_D crystal structure of hypothetical protein ph0642 from pyrococcus horikoshii 0.9137 1 254
ID Description Score Start End Superfamily
af_O76463_1_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9492 2 267 3.60.110.10
af_Q8VDK1_45_315_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9492 4 268 3.60.110.10
af_O94660_4_273_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9486 4 261 3.60.110.10
af_Q557J5_4_291_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9413 2 267 3.60.110.10
af_Q94JV5_26_305_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9356 1 269 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A2A4NUG4-F1-model_v4 CN hydrolase domain-containing protein 0.9763 1 272 GO:0016811
AF-A0A2A4P708-F1-model_v4 Nitrilase 0.9735 1 272 GO:0016811
AF-A0A440UTZ5-F1-model_v4 Carbon-nitrogen hydrolase family protein 0.9702 3 138 GO:0016787
AF-A0A381XDH0-F1-model_v4 CN hydrolase domain-containing protein 0.9699 6 149
AF-V4P7T0-F1-model_v4 Amidohydrolase 0.9689 1 272 GO:0016811

Feature Viewer

pLDDT pTM Quality
92.99 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map