F421429

General Info

Members Datasets Scaffolds Average Seq Length
359 162 718 178

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100008802|Ga0070689_1000088022
Length 184
Sequence MEQAKLTIALIISILLQWTLRNVAEPFAYVDFPLIIIVYAALQQKNSIRAVLFGAVGGLAMDALSGGLLGANGFSKVLIAYIVSEVTRRVYVDNLLLRIPIIAGACLFDDFIYYGLHRIFGQIPSVNVVTTFAYTLIGTTIAGTIIFLLLEKLKSDGVRGRKREFFPQKQKRQTRRRNPIRLGK

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
139 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
145 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
146 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
147 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
148 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
149 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
154 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
155 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
156 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
157 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
158 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
161 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0.56
Rhizosphere 98.33
Stem 0
Stem Tuber 0
Unclassified 30.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100008802 3300005340 Bacteria 7127
2 Ga0065704_10080969 3300005289 Unclassified 3847
3 Ga0065704_10158382 3300005289 Unclassified 1373
4 Ga0065712_10076422 3300005290 Unclassified 3663
5 Ga0065707_10097130 3300005295 Bacteria 3202
6 Ga0070676_10578141 3300005328 Bacteria 807
7 Ga0070683_100792327 3300005329 Unclassified 908
8 Ga0070683_101032340 3300005329 Bacteria 789
9 Ga0070690_100503110 3300005330 Bacteria 907
10 Ga0070670_100001471 3300005331 Bacteria 18963
11 Ga0070670_100532195 3300005331 Bacteria 1047
12 Ga0070670_100625095 3300005331 Unclassified 965
13 Ga0070677_10061425 3300005333 Bacteria 1551
14 Ga0068869_100284173 3300005334 Bacteria 1331
15 Ga0068869_100659609 3300005334 Bacteria 889
16 Ga0070680_100027229 3300005336 Unclassified 4578
17 Ga0070689_100975112 3300005340 Unclassified 753
18 Ga0070661_100031432 3300005344 Bacteria 3840
19 Ga0070661_100114391 3300005344 Unclassified 2017
20 Ga0070668_100192167 3300005347 Bacteria 1672
21 Ga0070668_100538474 3300005347 Bacteria 1015
22 Ga0070675_100014653 3300005354 Bacteria 6182
23 Ga0070675_100089714 3300005354 Unclassified 2574
24 Ga0070675_100146097 3300005354 Bacteria 2025
25 Ga0070675_100158700 3300005354 Bacteria 1944
26 Ga0070675_100497806 3300005354 Unclassified 1098
27 Ga0070671_100296242 3300005355 Bacteria 1377
28 Ga0070671_100299942 3300005355 Bacteria 1368
29 Ga0070671_100715037 3300005355 Unclassified 869
30 Ga0070671_100771158 3300005355 Unclassified 836
31 Ga0070674_100002611 3300005356 Bacteria 9968
32 Ga0070674_100055782 3300005356 Bacteria 2738
33 Ga0070674_100342403 3300005356 Bacteria 1205
34 Ga0070674_100444804 3300005356 Unclassified 1068
35 Ga0070673_100081118 3300005364 Bacteria 2630
36 Ga0070673_100198257 3300005364 Bacteria 1728
37 Ga0070688_100287894 3300005365 Bacteria 1183
38 Ga0070688_100986141 3300005365 Unclassified 669
39 Ga0070659_100004902 3300005366 Bacteria 9568
40 Ga0070667_100075293 3300005367 Bacteria 2881
41 Ga0070667_100392488 3300005367 Bacteria 1262
42 Ga0070700_101179927 3300005441 Unclassified 638
43 Ga0070663_100309478 3300005455 Bacteria 1267
44 Ga0070678_100065093 3300005456 Bacteria 2705
45 Ga0070678_100169640 3300005456 Unclassified 1776
46 Ga0070662_100031806 3300005457 Bacteria 3706
47 Ga0070662_100640135 3300005457 Bacteria 896
48 Ga0070681_10042937 3300005458 Bacteria 4530
49 Ga0070681_10132210 3300005458 Unclassified 2427
50 Ga0070681_10214094 3300005458 Unclassified 1843
51 Ga0068867_100081594 3300005459 Bacteria 2438
52 Ga0068867_100135742 3300005459 Bacteria 1917
53 Ga0068867_100668100 3300005459 Unclassified 913
54 Ga0070685_10934025 3300005466 Bacteria 647
55 Ga0070679_100154952 3300005530 Bacteria 2266
56 Ga0070684_100249273 3300005535 Bacteria 1623
57 Ga0070684_100813735 3300005535 Bacteria 874
58 Ga0068853_100010647 3300005539 Bacteria 7440
59 Ga0068853_100021927 3300005539 Bacteria 5327
60 Ga0068853_100025154 3300005539 Bacteria 4995
61 Ga0070672_100039090 3300005543 Bacteria 3632
62 Ga0070672_100282014 3300005543 Bacteria 1405
63 Ga0070672_100444592 3300005543 Unclassified 1116
64 Ga0070672_100847564 3300005543 Unclassified 806
65 Ga0070686_100438374 3300005544 Bacteria 1002
66 Ga0070695_100075778 3300005545 Unclassified 2214
67 Ga0070696_100423355 3300005546 Bacteria 1046
68 Ga0068855_100133994 3300005563 Bacteria 2827
69 Ga0068855_100597821 3300005563 Bacteria 1190
70 Ga0068855_100599846 3300005563 Bacteria 1188
71 Ga0070664_100010297 3300005564 Bacteria 7588
72 Ga0070664_100010527 3300005564 Bacteria 7497
73 Ga0070664_100040657 3300005564 Unclassified 3921
74 Ga0070664_101111209 3300005564 Bacteria 745
75 Ga0070664_101620423 3300005564 Unclassified 613
76 Ga0068857_100059608 3300005577 Unclassified 3391
77 Ga0068857_100131467 3300005577 Bacteria 2258
78 Ga0068857_100163563 3300005577 Bacteria 2020
79 Ga0068854_100038669 3300005578 Bacteria 3357
80 Ga0068854_100064469 3300005578 Unclassified 2662
81 Ga0068854_100755439 3300005578 Unclassified 844
82 Ga0068854_100913992 3300005578 Unclassified 772
83 Ga0068854_101014775 3300005578 Bacteria 735
84 Ga0068856_100077196 3300005614 Bacteria 3300
85 Ga0068852_100078220 3300005616 Bacteria 2926
86 Ga0068852_100162446 3300005616 Bacteria 2087
87 Ga0068852_101172838 3300005616 Bacteria 789
88 Ga0068859_100028413 3300005617 Bacteria 5606
89 Ga0068859_100029510 3300005617 Bacteria 5503
90 Ga0068859_100057054 3300005617 Bacteria 3933
91 Ga0068859_100241175 3300005617 Bacteria 1897
92 Ga0068864_100040827 3300005618 Bacteria 3968
93 Ga0068864_100190544 3300005618 Unclassified 1879
94 Ga0068864_100236689 3300005618 Bacteria 1690
95 Ga0068864_100704079 3300005618 Unclassified 987
96 Ga0068864_101290515 3300005618 Bacteria 730
97 Ga0068861_100036629 3300005719 Bacteria 3643
98 Ga0068861_100298003 3300005719 Unclassified 1395
99 Ga0068861_100784741 3300005719 Unclassified 893
100 Ga0068861_100843339 3300005719 Bacteria 863
101 Ga0068870_10014713 3300005840 Bacteria 3701
102 Ga0068870_10418230 3300005840 Unclassified 876
103 Ga0068863_100010756 3300005841 Bacteria 8878
104 Ga0068863_100085113 3300005841 Bacteria 2996
105 Ga0068858_100036133 3300005842 Bacteria 4581
106 Ga0068858_100041222 3300005842 Bacteria 4282
107 Ga0068858_100257846 3300005842 Bacteria 1657
108 Ga0068860_100041435 3300005843 Bacteria 4398
109 Ga0068860_100067059 3300005843 Bacteria 3410
110 Ga0068862_100014616 3300005844 Bacteria 6519
111 Ga0068862_100445420 3300005844 Bacteria 1220
112 Ga0068862_100972015 3300005844 Unclassified 838
113 Ga0068871_100545529 3300006358 Bacteria 1049
114 Ga0068865_101220940 3300006881 Bacteria 666
115 Ga0097620_100028414 3300006931 Bacteria 5606
116 Ga0097620_100029510 3300006931 Bacteria 5503
117 Ga0097620_100057061 3300006931 Bacteria 3933
118 Ga0097620_100241179 3300006931 Bacteria 1897
119 Ga0105240_10063324 3300009093 Bacteria 4601
120 Ga0105240_10075104 3300009093 Unclassified 4170
121 Ga0105247_10025083 3300009101 Bacteria 3597
122 Ga0105247_10534709 3300009101 Unclassified 859
123 Ga0105241_10055877 3300009174 Unclassified 3025
124 Ga0105241_10582425 3300009174 Bacteria 1009
125 Ga0105242_10148562 3300009176 Bacteria 2041
126 Ga0105248_10065444 3300009177 Bacteria 4081
127 Ga0105248_10108164 3300009177 Bacteria 3135
128 Ga0105248_10186697 3300009177 Bacteria 2336
129 Ga0105248_10218700 3300009177 Bacteria 2145
130 Ga0105248_10681448 3300009177 Bacteria 1160
131 Ga0105248_11160782 3300009177 Unclassified 873
132 Ga0105237_10043771 3300009545 Bacteria 4509
133 Ga0105237_10061078 3300009545 Unclassified 3769
134 Ga0105237_10293580 3300009545 Bacteria 1628
135 Ga0105249_10013452 3300009553 Bacteria 7226
136 Ga0105249_10053933 3300009553 Bacteria 3675
137 Ga0105239_10033270 3300010375 Bacteria 5662
138 Ga0105239_10642629 3300010375 Bacteria 1212
139 Ga0157373_10027688 3300013100 Unclassified 4089
140 Ga0157373_10059771 3300013100 Bacteria 2701
141 Ga0157373_10125910 3300013100 Bacteria 1802
142 Ga0157373_10280975 3300013100 Unclassified 1180
143 Ga0157370_10063674 3300013104 Bacteria 3493
144 Ga0157370_10265304 3300013104 Bacteria 1587
145 Ga0157370_11161583 3300013104 Unclassified 697
146 Ga0157369_10029265 3300013105 Bacteria 6088
147 Ga0157369_10067146 3300013105 Unclassified 3857
148 Ga0157369_10069818 3300013105 Bacteria 3774
149 Ga0157374_11185119 3300013296 Unclassified 785
150 Ga0157378_10405474 3300013297 Unclassified 1344
151 Ga0157378_10785638 3300013297 Bacteria 977
152 Ga0163162_10020203 3300013306 Bacteria 6541
153 Ga0163162_10075825 3300013306 Bacteria 3424
154 Ga0163162_10081054 3300013306 Bacteria 3315
155 Ga0163162_10160991 3300013306 Unclassified 2366
156 Ga0163162_10992091 3300013306 Unclassified 949
157 Ga0157372_10027855 3300013307 Bacteria 6158
158 Ga0157372_10045616 3300013307 Bacteria 4864
159 Ga0157372_10144008 3300013307 Bacteria 2748
160 Ga0157372_10148261 3300013307 Bacteria 2706
161 Ga0157372_10188572 3300013307 Bacteria 2388
162 Ga0157372_10402715 3300013307 Bacteria 1594
163 Ga0157375_10044050 3300013308 Bacteria 4331
164 Ga0157375_10214893 3300013308 Bacteria 2081
165 Ga0157375_10302071 3300013308 Bacteria 1764
166 Ga0163163_10020360 3300014325 Bacteria 6246
167 Ga0163163_10340516 3300014325 Bacteria 1555
168 Ga0157380_10521504 3300014326 Unclassified 1159
169 Ga0157377_10300739 3300014745 Bacteria 1059
170 Ga0157379_10253477 3300014968 Bacteria 1598
171 Ga0157376_10293119 3300014969 Unclassified 1537
172 Ga0157376_10366319 3300014969 Bacteria 1384
173 Ga0157376_11042799 3300014969 Bacteria 842
174 Ga0163161_10002281 3300017792 Bacteria 13763
175 Ga0163161_10005469 3300017792 Bacteria 8819
176 Ga0163161_10240562 3300017792 Bacteria 1408
177 Ga0207682_10027717 3300025893 Unclassified 2257
178 Ga0207682_10162493 3300025893 Unclassified 1013
179 Ga0207710_10262047 3300025900 Unclassified 866
180 Ga0207645_10392772 3300025907 Bacteria 932
181 Ga0207643_10147659 3300025908 Bacteria 1408
182 Ga0207654_10062877 3300025911 Bacteria 2176
183 Ga0207654_10592187 3300025911 Bacteria 791
184 Ga0207707_10000653 3300025912 Bacteria 34288
185 Ga0207707_10169883 3300025912 Unclassified 1906
186 Ga0207695_10091343 3300025913 Bacteria 3059
187 Ga0207671_10110948 3300025914 Bacteria 2087
188 Ga0207671_10997292 3300025914 Unclassified 660
189 Ga0207660_10019119 3300025917 Unclassified 4576
190 Ga0207662_10464772 3300025918 Bacteria 867
191 Ga0207657_10052140 3300025919 Bacteria 3552
192 Ga0207649_10078619 3300025920 Bacteria 2129
193 Ga0207649_10603505 3300025920 Unclassified 844
194 Ga0207649_10700026 3300025920 Bacteria 786
195 Ga0207652_10040618 3300025921 Unclassified 3951
196 Ga0207650_10006142 3300025925 Bacteria 8185
197 Ga0207650_10020454 3300025925 Bacteria 4668
198 Ga0207650_10055509 3300025925 Bacteria 2940
199 Ga0207650_10386154 3300025925 Bacteria 1157
200 Ga0207650_10693814 3300025925 Unclassified 860
201 Ga0207659_10010534 3300025926 Bacteria 5812
202 Ga0207659_10613516 3300025926 Unclassified 928
203 Ga0207659_10776902 3300025926 Bacteria 822
204 Ga0207659_11145229 3300025926 Unclassified 669
205 Ga0207644_10024848 3300025931 Bacteria 4116
206 Ga0207644_10566968 3300025931 Unclassified 941
207 Ga0207690_10041945 3300025932 Bacteria 3002
208 Ga0207690_10696934 3300025932 Unclassified 835
209 Ga0207706_10014906 3300025933 Bacteria 7039
210 Ga0207706_10238057 3300025933 Bacteria 1591
211 Ga0207706_10573826 3300025933 Bacteria 970
212 Ga0207686_10290526 3300025934 Unclassified 1210
213 Ga0207670_10005948 3300025936 Bacteria 6735
214 Ga0207670_10872263 3300025936 Unclassified 753
215 Ga0207669_10002956 3300025937 Bacteria 7299
216 Ga0207669_10309109 3300025937 Unclassified 1205
217 Ga0207669_10320656 3300025937 Unclassified 1186
218 Ga0207669_11009536 3300025937 Unclassified 699
219 Ga0207691_10087125 3300025940 Bacteria 2801
220 Ga0207711_10278417 3300025941 Bacteria 1540
221 Ga0207711_10524994 3300025941 Bacteria 1104
222 Ga0207689_10109140 3300025942 Bacteria 2274
223 Ga0207689_10716827 3300025942 Unclassified 844
224 Ga0207679_10024582 3300025945 Bacteria 4131
225 Ga0207679_10137898 3300025945 Bacteria 1967
226 Ga0207667_10064770 3300025949 Bacteria 3814
227 Ga0207667_10214239 3300025949 Bacteria 1974
228 Ga0207651_10320559 3300025960 Bacteria 1295
229 Ga0207712_10030246 3300025961 Bacteria 3639
230 Ga0207712_10149474 3300025961 Unclassified 1803
231 Ga0207712_10200056 3300025961 Bacteria 1584
232 Ga0207640_10183273 3300025981 Unclassified 1572
233 Ga0207640_10309520 3300025981 Bacteria 1253
234 Ga0207640_10472723 3300025981 Bacteria 1038
235 Ga0207640_10483555 3300025981 Bacteria 1027
236 Ga0207658_10005233 3300025986 Bacteria 8924
237 Ga0207658_10060271 3300025986 Bacteria 2831
238 Ga0207703_10091341 3300026035 Bacteria 2561
239 Ga0207703_10745974 3300026035 Bacteria 933
240 Ga0207639_10015719 3300026041 Bacteria 5339
241 Ga0207639_10073650 3300026041 Bacteria 2678
242 Ga0207678_10099896 3300026067 Archaea 2479
243 Ga0207708_11279979 3300026075 Unclassified 642
244 Ga0207702_10232870 3300026078 Unclassified 1722
245 Ga0207648_10250812 3300026089 Bacteria 1578
246 Ga0207676_10026799 3300026095 Bacteria 4287
247 Ga0207676_10931859 3300026095 Bacteria 853
248 Ga0207676_10946796 3300026095 Bacteria 846
249 Ga0207674_10006787 3300026116 Bacteria 13431
250 Ga0207674_10533551 3300026116 Unclassified 1134
251 Ga0207674_10719993 3300026116 Unclassified 963
252 Ga0207675_100193052 3300026118 Bacteria 1954
253 Ga0207675_100281152 3300026118 Bacteria 1617
254 Ga0207675_100355099 3300026118 Bacteria 1437
255 Ga0207675_100665255 3300026118 Bacteria 1048
256 Ga0207683_10214570 3300026121 Bacteria 1752
257 Ga0207683_10583903 3300026121 Unclassified 1034
258 Ga0207698_10169886 3300026142 Bacteria 1918
259 Ga0207698_10330183 3300026142 Bacteria 1432
260 Ga0207698_10372877 3300026142 Bacteria 1355
261 Ga0209998_10089195 3300027717 Unclassified 754
262 Ga0209974_10021147 3300027876 Unclassified 2155
263 Ga0209974_10042497 3300027876 Bacteria 1513
264 Ga0268265_10007873 3300028380 Bacteria 7190
265 Ga0268265_10274965 3300028380 Unclassified 1504
266 Ga0268265_10349404 3300028380 Unclassified 1350
267 Ga0268265_10761164 3300028380 Bacteria 941
268 Ga0307408_100333340 3300031548 Bacteria 1282
269 Ga0307408_100343002 3300031548 Bacteria 1265
270 Ga0307408_101122614 3300031548 Unclassified 730
271 Ga0307405_10033951 3300031731 Unclassified 3031
272 Ga0307405_10582029 3300031731 Bacteria 911
273 Ga0307405_10775431 3300031731 Unclassified 801
274 Ga0307405_10778612 3300031731 Unclassified 799
275 Ga0307413_10000533 3300031824 Bacteria 12620
276 Ga0307413_10075186 3300031824 Bacteria 2143
277 Ga0307413_10267296 3300031824 Bacteria 1278
278 Ga0307413_10335930 3300031824 Unclassified 1160
279 Ga0307413_10977738 3300031824 Unclassified 724
280 Ga0307413_11326445 3300031824 Unclassified 630
281 Ga0307410_10003385 3300031852 Bacteria 7995
282 Ga0307410_10032166 3300031852 Bacteria 3373
283 Ga0307410_10133291 3300031852 Unclassified 1828
284 Ga0307410_10144952 3300031852 Bacteria 1761
285 Ga0307410_10276572 3300031852 Bacteria 1316
286 Ga0307410_10495460 3300031852 Bacteria 1004
287 Ga0307410_10588363 3300031852 Bacteria 927
288 Ga0307410_10664389 3300031852 Unclassified 875
289 Ga0307410_11387353 3300031852 Unclassified 616
290 Ga0307406_10064833 3300031901 Unclassified 2372
291 Ga0307406_10074126 3300031901 Unclassified 2240
292 Ga0307406_10183119 3300031901 Bacteria 1527
293 Ga0307406_10234381 3300031901 Bacteria 1373
294 Ga0307407_10000160 3300031903 Bacteria 20916
295 Ga0307407_10283901 3300031903 Unclassified 1148
296 Ga0307412_10030620 3300031911 Bacteria 3390
297 Ga0307412_10088730 3300031911 Bacteria 2158
298 Ga0307412_10322439 3300031911 Unclassified 1230
299 Ga0307412_10553311 3300031911 Unclassified 967
300 Ga0307412_10702974 3300031911 Unclassified 868
301 Ga0307409_100000081 3300031995 Bacteria 34429
302 Ga0307409_100006649 3300031995 Bacteria 6825
303 Ga0307409_100044032 3300031995 Bacteria 3358
304 Ga0307409_100308918 3300031995 Unclassified 1475
305 Ga0307409_100436733 3300031995 Bacteria 1260
306 Ga0307409_100630386 3300031995 Unclassified 1063
307 Ga0307416_100003269 3300032002 Bacteria 9488
308 Ga0307416_100022667 3300032002 Bacteria 4538
309 Ga0307416_100103979 3300032002 Bacteria 2481
310 Ga0307416_100568747 3300032002 Bacteria 1209
311 Ga0307416_100752365 3300032002 Unclassified 1067
312 Ga0307414_10000456 3300032004 Bacteria 21528
313 Ga0307414_10096233 3300032004 Bacteria 2215
314 Ga0307414_10246871 3300032004 Bacteria 1481
315 Ga0307414_11258037 3300032004 Bacteria 686
316 Ga0307411_10041015 3300032005 Bacteria 2942
317 Ga0307411_10159286 3300032005 Bacteria 1688
318 Ga0307411_10227468 3300032005 Bacteria 1451
319 Ga0307411_10625405 3300032005 Bacteria 929
320 Ga0307415_100025374 3300032126 Bacteria 3718
321 Ga0307415_100046609 3300032126 Bacteria 2913
322 Ga0307415_100070261 3300032126 Unclassified 2458
323 Ga0307415_100125181 3300032126 Bacteria 1935
324 Ga0307415_100422673 3300032126 Unclassified 1144
325 Ga0395905_0032025 3300037471 Bacteria 4946
326 Ga0395901_0396708 3300038443 Bacteria 1418
327 Ga0436365_0400945 3300039437 Bacteria 910
328 Ga0439466_0033929 3300041411 Bacteria 1732
329 Ga0439465_0070622 3300041413 Unclassified 1170
330 Ga0451791_0524224 3300041451 Bacteria 911
331 Ga0451807_1237517 3300041486 Bacteria 674
332 Ga0451837_1715864 3300041494 Bacteria 1097
333 Ga0439432_015670 3300042006 Bacteria 2556
334 Ga0450898_045428 3300042134 Unclassified 839
335 Ga0495668_0001103 3300046616 Bacteria 27930
336 Ga0495672_0163201 3300047320 Bacteria 1143
337 Ga0501072_0008906 3300049588 Bacteria 7626
338 Ga0501073_0504704 3300049589 Bacteria 836
339 Ga0501217_045143 3300049661 Unclassified 1134
340 Ga0501227_004679 3300049665 Bacteria 2937
341 Ga0501227_064321 3300049665 Unclassified 945
342 Ga0501236_022261 3300049670 Unclassified 946
343 Ga0501239_000722 3300049672 Bacteria 2658
344 Ga0501242_046663 3300049674 Bacteria 626
345 Ga0501247_019903 3300049677 Bacteria 866
346 Ga0501249_002666 3300049679 Bacteria 3593
347 Ga0501252_007063 3300049682 Unclassified 1263
348 Ga0501221_055299 3300049704 Unclassified 904
349 Ga0501245_042187 3300049708 Bacteria 788
350 Ga0501262_026459 3300049759 Unclassified 819
351 Ga0501263_000375 3300049760 Bacteria 3202
352 Ga0501267_001756 3300049764 Unclassified 1892
353 Ga0501268_001777 3300049765 Bacteria 2741
354 Ga0501272_007795 3300049769 Unclassified 1166
355 Ga0501272_046524 3300049769 Unclassified 592
356 Ga0500577_0000368 3300053142 Bacteria 11494
357 Ga0500588_0065751 3300053146 Bacteria 1175
358 Ga0590075_089661 3300059424 Bacteria 798
359 Ga0501082_0274047 3300060353 Bacteria 1469
360 Ga0070689_100008802
361 Ga0065704_10080969
362 Ga0065704_10158382
363 Ga0065712_10076422
364 Ga0065707_10097130
365 Ga0070676_10578141
366 Ga0070683_100792327
367 Ga0070683_101032340
368 Ga0070690_100503110
369 Ga0070670_100001471
370 Ga0070670_100532195
371 Ga0070670_100625095
372 Ga0070677_10061425
373 Ga0068869_100284173
374 Ga0068869_100659609
375 Ga0070680_100027229
376 Ga0070689_100975112
377 Ga0070661_100031432
378 Ga0070661_100114391
379 Ga0070668_100192167
380 Ga0070668_100538474
381 Ga0070675_100014653
382 Ga0070675_100089714
383 Ga0070675_100146097
384 Ga0070675_100158700
385 Ga0070675_100497806
386 Ga0070671_100296242
387 Ga0070671_100299942
388 Ga0070671_100715037
389 Ga0070671_100771158
390 Ga0070674_100002611
391 Ga0070674_100055782
392 Ga0070674_100342403
393 Ga0070674_100444804
394 Ga0070673_100081118
395 Ga0070673_100198257
396 Ga0070688_100287894
397 Ga0070688_100986141
398 Ga0070659_100004902
399 Ga0070667_100075293
400 Ga0070667_100392488
401 Ga0070700_101179927
402 Ga0070663_100309478
403 Ga0070678_100065093
404 Ga0070678_100169640
405 Ga0070662_100031806
406 Ga0070662_100640135
407 Ga0070681_10042937
408 Ga0070681_10132210
409 Ga0070681_10214094
410 Ga0068867_100081594
411 Ga0068867_100135742
412 Ga0068867_100668100
413 Ga0070685_10934025
414 Ga0070679_100154952
415 Ga0070684_100249273
416 Ga0070684_100813735
417 Ga0068853_100010647
418 Ga0068853_100021927
419 Ga0068853_100025154
420 Ga0070672_100039090
421 Ga0070672_100282014
422 Ga0070672_100444592
423 Ga0070672_100847564
424 Ga0070686_100438374
425 Ga0070695_100075778
426 Ga0070696_100423355
427 Ga0068855_100133994
428 Ga0068855_100597821
429 Ga0068855_100599846
430 Ga0070664_100010297
431 Ga0070664_100010527
432 Ga0070664_100040657
433 Ga0070664_101111209
434 Ga0070664_101620423
435 Ga0068857_100059608
436 Ga0068857_100131467
437 Ga0068857_100163563
438 Ga0068854_100038669
439 Ga0068854_100064469
440 Ga0068854_100755439
441 Ga0068854_100913992
442 Ga0068854_101014775
443 Ga0068856_100077196
444 Ga0068852_100078220
445 Ga0068852_100162446
446 Ga0068852_101172838
447 Ga0068859_100028413
448 Ga0068859_100029510
449 Ga0068859_100057054
450 Ga0068859_100241175
451 Ga0068864_100040827
452 Ga0068864_100190544
453 Ga0068864_100236689
454 Ga0068864_100704079
455 Ga0068864_101290515
456 Ga0068861_100036629
457 Ga0068861_100298003
458 Ga0068861_100784741
459 Ga0068861_100843339
460 Ga0068870_10014713
461 Ga0068870_10418230
462 Ga0068863_100010756
463 Ga0068863_100085113
464 Ga0068858_100036133
465 Ga0068858_100041222
466 Ga0068858_100257846
467 Ga0068860_100041435
468 Ga0068860_100067059
469 Ga0068862_100014616
470 Ga0068862_100445420
471 Ga0068862_100972015
472 Ga0068871_100545529
473 Ga0068865_101220940
474 Ga0097620_100028414
475 Ga0097620_100029510
476 Ga0097620_100057061
477 Ga0097620_100241179
478 Ga0105240_10063324
479 Ga0105240_10075104
480 Ga0105247_10025083
481 Ga0105247_10534709
482 Ga0105241_10055877
483 Ga0105241_10582425
484 Ga0105242_10148562
485 Ga0105248_10065444
486 Ga0105248_10108164
487 Ga0105248_10186697
488 Ga0105248_10218700
489 Ga0105248_10681448
490 Ga0105248_11160782
491 Ga0105237_10043771
492 Ga0105237_10061078
493 Ga0105237_10293580
494 Ga0105249_10013452
495 Ga0105249_10053933
496 Ga0105239_10033270
497 Ga0105239_10642629
498 Ga0157373_10027688
499 Ga0157373_10059771
500 Ga0157373_10125910
501 Ga0157373_10280975
502 Ga0157370_10063674
503 Ga0157370_10265304
504 Ga0157370_11161583
505 Ga0157369_10029265
506 Ga0157369_10067146
507 Ga0157369_10069818
508 Ga0157374_11185119
509 Ga0157378_10405474
510 Ga0157378_10785638
511 Ga0163162_10020203
512 Ga0163162_10075825
513 Ga0163162_10081054
514 Ga0163162_10160991
515 Ga0163162_10992091
516 Ga0157372_10027855
517 Ga0157372_10045616
518 Ga0157372_10144008
519 Ga0157372_10148261
520 Ga0157372_10188572
521 Ga0157372_10402715
522 Ga0157375_10044050
523 Ga0157375_10214893
524 Ga0157375_10302071
525 Ga0163163_10020360
526 Ga0163163_10340516
527 Ga0157380_10521504
528 Ga0157377_10300739
529 Ga0157379_10253477
530 Ga0157376_10293119
531 Ga0157376_10366319
532 Ga0157376_11042799
533 Ga0163161_10002281
534 Ga0163161_10005469
535 Ga0163161_10240562
536 Ga0207682_10027717
537 Ga0207682_10162493
538 Ga0207710_10262047
539 Ga0207645_10392772
540 Ga0207643_10147659
541 Ga0207654_10062877
542 Ga0207654_10592187
543 Ga0207707_10000653
544 Ga0207707_10169883
545 Ga0207695_10091343
546 Ga0207671_10110948
547 Ga0207671_10997292
548 Ga0207660_10019119
549 Ga0207662_10464772
550 Ga0207657_10052140
551 Ga0207649_10078619
552 Ga0207649_10603505
553 Ga0207649_10700026
554 Ga0207652_10040618
555 Ga0207650_10006142
556 Ga0207650_10020454
557 Ga0207650_10055509
558 Ga0207650_10386154
559 Ga0207650_10693814
560 Ga0207659_10010534
561 Ga0207659_10613516
562 Ga0207659_10776902
563 Ga0207659_11145229
564 Ga0207644_10024848
565 Ga0207644_10566968
566 Ga0207690_10041945
567 Ga0207690_10696934
568 Ga0207706_10014906
569 Ga0207706_10238057
570 Ga0207706_10573826
571 Ga0207686_10290526
572 Ga0207670_10005948
573 Ga0207670_10872263
574 Ga0207669_10002956
575 Ga0207669_10309109
576 Ga0207669_10320656
577 Ga0207669_11009536
578 Ga0207691_10087125
579 Ga0207711_10278417
580 Ga0207711_10524994
581 Ga0207689_10109140
582 Ga0207689_10716827
583 Ga0207679_10024582
584 Ga0207679_10137898
585 Ga0207667_10064770
586 Ga0207667_10214239
587 Ga0207651_10320559
588 Ga0207712_10030246
589 Ga0207712_10149474
590 Ga0207712_10200056
591 Ga0207640_10183273
592 Ga0207640_10309520
593 Ga0207640_10472723
594 Ga0207640_10483555
595 Ga0207658_10005233
596 Ga0207658_10060271
597 Ga0207703_10091341
598 Ga0207703_10745974
599 Ga0207639_10015719
600 Ga0207639_10073650
601 Ga0207678_10099896
602 Ga0207708_11279979
603 Ga0207702_10232870
604 Ga0207648_10250812
605 Ga0207676_10026799
606 Ga0207676_10931859
607 Ga0207676_10946796
608 Ga0207674_10006787
609 Ga0207674_10533551
610 Ga0207674_10719993
611 Ga0207675_100193052
612 Ga0207675_100281152
613 Ga0207675_100355099
614 Ga0207675_100665255
615 Ga0207683_10214570
616 Ga0207683_10583903
617 Ga0207698_10169886
618 Ga0207698_10330183
619 Ga0207698_10372877
620 Ga0209998_10089195
621 Ga0209974_10021147
622 Ga0209974_10042497
623 Ga0268265_10007873
624 Ga0268265_10274965
625 Ga0268265_10349404
626 Ga0268265_10761164
627 Ga0307408_100333340
628 Ga0307408_100343002
629 Ga0307408_101122614
630 Ga0307405_10033951
631 Ga0307405_10582029
632 Ga0307405_10775431
633 Ga0307405_10778612
634 Ga0307413_10000533
635 Ga0307413_10075186
636 Ga0307413_10267296
637 Ga0307413_10335930
638 Ga0307413_10977738
639 Ga0307413_11326445
640 Ga0307410_10003385
641 Ga0307410_10032166
642 Ga0307410_10133291
643 Ga0307410_10144952
644 Ga0307410_10276572
645 Ga0307410_10495460
646 Ga0307410_10588363
647 Ga0307410_10664389
648 Ga0307410_11387353
649 Ga0307406_10064833
650 Ga0307406_10074126
651 Ga0307406_10183119
652 Ga0307406_10234381
653 Ga0307407_10000160
654 Ga0307407_10283901
655 Ga0307412_10030620
656 Ga0307412_10088730
657 Ga0307412_10322439
658 Ga0307412_10553311
659 Ga0307412_10702974
660 Ga0307409_100000081
661 Ga0307409_100006649
662 Ga0307409_100044032
663 Ga0307409_100308918
664 Ga0307409_100436733
665 Ga0307409_100630386
666 Ga0307416_100003269
667 Ga0307416_100022667
668 Ga0307416_100103979
669 Ga0307416_100568747
670 Ga0307416_100752365
671 Ga0307414_10000456
672 Ga0307414_10096233
673 Ga0307414_10246871
674 Ga0307414_11258037
675 Ga0307411_10041015
676 Ga0307411_10159286
677 Ga0307411_10227468
678 Ga0307411_10625405
679 Ga0307415_100025374
680 Ga0307415_100046609
681 Ga0307415_100070261
682 Ga0307415_100125181
683 Ga0307415_100422673
684 Ga0395905_0032025
685 Ga0395901_0396708
686 Ga0436365_0400945
687 Ga0439466_0033929
688 Ga0439465_0070622
689 Ga0451791_0524224
690 Ga0451807_1237517
691 Ga0451837_1715864
692 Ga0439432_015670
693 Ga0450898_045428
694 Ga0495668_0001103
695 Ga0495672_0163201
696 Ga0501072_0008906
697 Ga0501073_0504704
698 Ga0501217_045143
699 Ga0501227_004679
700 Ga0501227_064321
701 Ga0501236_022261
702 Ga0501239_000722
703 Ga0501242_046663
704 Ga0501247_019903
705 Ga0501249_002666
706 Ga0501252_007063
707 Ga0501221_055299
708 Ga0501245_042187
709 Ga0501262_026459
710 Ga0501263_000375
711 Ga0501267_001756
712 Ga0501268_001777
713 Ga0501272_007795
714 Ga0501272_046524
715 Ga0500577_0000368
716 Ga0500588_0065751
717 Ga0590075_089661
718 Ga0501082_0274047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

3

155

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v7j-assembly2.cif.gz_Bt structure of rele nuclease bound to the 70s ribosome (precleavage state) 0.533 20 89
4v90-assembly1.cif.gz_AT thermus thermophilus ribosome 0.5225 25 94
6cap-assembly1.cif.gz_T crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with sisomicin 0.5076 19 94
5e81-assembly1.cif.gz_BI structure of t. thermophilus 70s ribosome complex with mrna and trnalys in the a-site with wobble pair 0.5052 19 94
1ibl-assembly1.cif.gz_T structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin 0.5039 19 94
ID Description Score Start End Superfamily
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7285 34 144 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6911 1 146 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6643 1 146 1.10.1760.20
af_Q2G061_16_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5832 6 143 1.10.1760.20
af_P0AD14_27_197_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5518 34 143 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A7W0GR59-F1-model_v4 Rod shape-determining protein MreD 0.8986 3 144 GO:0005886
GO:0008360
AF-A0A2V9K054-F1-model_v4 Rod shape-determining protein MreD 0.8638 6 144 GO:0005886
GO:0008360
AF-A0A7W0LCZ4-F1-model_v4 Rod shape-determining protein MreD 0.8505 1 138 GO:0005886
GO:0008360
AF-A0A7Z9T8I2-F1-model_v4 Rod shape-determining protein MreD 0.8496 1 146 GO:0005886
GO:0008360
AF-A0A2V8L5D4-F1-model_v4 Rod shape-determining protein MreD 0.8475 2 146 GO:0005886
GO:0008360

Map