F421408

General Info

Members Datasets Scaffolds Average Seq Length
359 225 357 228

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10123865|Ga0070658_101238652
Length 231
Sequence MLVHVPQLLSQDQVAEIRGVLTGTDWVDGKVTAGAQSARAKNNLQVPEDSPAARALGDIILGALGTNPLFNAAALPLRVFPPLFNRYDTGMQFGPHIDNAIRFVKPSIASGAPIRVRTDLSATLFLTDPRDYDGGELVIEDTYGSHDVKLPAGDLLLYSATSRHHVTKVTRGSRWSSFFWVQSMIGDEAARTMLFELDTAIQGLRGRHGDEREIVVLTGLYHNLVRRWADA

Samples

Sample ID Description Type Environment
1 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
217 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
218 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 2.23
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1016293 3300001915 Bacteria 1215
2 JGI24749J21850_1000462 3300002076 Bacteria 5997
3 JGI25153J46596_10001840 3300003215 Bacteria 12587
4 Ga0055525_1000001 3300003759 Bacteria 1016948
5 Ga0065165_1006332 3300005262 Bacteria 6251
6 Ga0070658_10019575 3300005327 Bacteria 5419
7 Ga0070658_10087610 3300005327 Bacteria 2563
8 Ga0070658_10123865 3300005327 Bacteria 2150
9 Ga0070676_10055420 3300005328 Bacteria 2339
10 Ga0070676_10056920 3300005328 Bacteria 2312
11 Ga0070690_100007445 3300005330 Bacteria 6273
12 Ga0068869_100004447 3300005334 Bacteria 8716
13 Ga0068869_100083903 3300005334 Bacteria 2384
14 Ga0068869_100204765 3300005334 Bacteria 1558
15 Ga0070666_10019346 3300005335 Unclassified 4395
16 Ga0070666_10214074 3300005335 Bacteria 1358
17 Ga0070680_100033630 3300005336 Bacteria 4134
18 Ga0070682_100573054 3300005337 Bacteria 887
19 Ga0068868_100022602 3300005338 Bacteria 4749
20 Ga0070660_100014839 3300005339 Bacteria 5623
21 Ga0070689_100041851 3300005340 Bacteria 3516
22 Ga0070661_100008963 3300005344 Bacteria 6925
23 Ga0070669_100024664 3300005353 Bacteria 4314
24 Ga0070673_100012626 3300005364 Bacteria 5807
25 Ga0070673_100092027 3300005364 Bacteria 2480
26 Ga0070688_100188811 3300005365 Bacteria 1434
27 Ga0070659_100013679 3300005366 Bacteria 6047
28 Ga0070667_100048894 3300005367 Unclassified 3561
29 Ga0070710_10158329 3300005437 Bacteria 1402
30 Ga0070701_10032884 3300005438 Bacteria 2587
31 Ga0070711_100453965 3300005439 Bacteria 1050
32 Ga0070700_100003842 3300005441 Bacteria 7789
33 Ga0070678_100034259 3300005456 Unclassified 3534
34 Ga0070681_10089988 3300005458 Bacteria 3020
35 Ga0070681_10095937 3300005458 Bacteria 2914
36 Ga0068867_100012483 3300005459 Bacteria 6012
37 Ga0068867_100018876 3300005459 Bacteria 4906
38 Ga0070707_100592737 3300005468 Bacteria 1071
39 Ga0070679_100079302 3300005530 Bacteria 3273
40 Ga0068853_100057032 3300005539 Bacteria 3370
41 Ga0070672_100032007 3300005543 Bacteria 3965
42 Ga0070686_100011593 3300005544 Bacteria 5004
43 Ga0070665_100000366 3300005548 Bacteria 67633
44 Ga0070665_100015760 3300005548 Bacteria 7594
45 Ga0070665_100170565 3300005548 Bacteria 2177
46 Ga0068855_100052241 3300005563 Bacteria 4812
47 Ga0068855_100251589 3300005563 Bacteria 1971
48 Ga0068855_100285635 3300005563 Bacteria 1831
49 Ga0068857_100557385 3300005577 Bacteria 1080
50 Ga0068857_100752542 3300005577 Bacteria 928
51 Ga0068854_100424657 3300005578 Bacteria 1105
52 Ga0070702_100039593 3300005615 Bacteria 2631
53 Ga0068859_100159717 3300005617 Bacteria 2333
54 Ga0068864_100141316 3300005618 Bacteria 2172
55 Ga0068864_100160728 3300005618 Bacteria 2042
56 Ga0068866_10044982 3300005718 Bacteria 2212
57 Ga0068861_100007387 3300005719 Bacteria 7529
58 Ga0068870_10030758 3300005840 Bacteria 2716
59 Ga0068870_10068337 3300005840 Bacteria 1930
60 Ga0068863_100017603 3300005841 Bacteria 6846
61 Ga0068858_100006175 3300005842 Bacteria 11685
62 Ga0068860_100136609 3300005843 Bacteria 2355
63 Ga0068860_100188473 3300005843 Bacteria 1995
64 Ga0097621_100000026 3300006237 Bacteria 73891
65 Ga0097621_100027992 3300006237 Bacteria 4437
66 Ga0097621_100431316 3300006237 Bacteria 1184
67 Ga0068871_100003516 3300006358 Bacteria 10780
68 Ga0068871_100009444 3300006358 Bacteria 7068
69 Ga0068871_100214036 3300006358 Bacteria 1667
70 Ga0068871_100448837 3300006358 Bacteria 1155
71 Ga0075429_100301271 3300006880 Bacteria 1403
72 Ga0068865_100014791 3300006881 Bacteria 4966
73 Ga0068865_100037928 3300006881 Bacteria 3258
74 Ga0097620_100159715 3300006931 Bacteria 2333
75 Ga0105250_10112005 3300009092 Bacteria 1118
76 Ga0105240_10044700 3300009093 Bacteria 5625
77 Ga0105240_10102070 3300009093 Bacteria 3487
78 Ga0105245_10032799 3300009098 Bacteria 4599
79 Ga0105245_10175144 3300009098 Bacteria 2045
80 Ga0105245_10585662 3300009098 Unclassified 1141
81 Ga0105245_11246689 3300009098 Bacteria 792
82 Ga0105243_10003006 3300009148 Bacteria 13924
83 Ga0105243_10008985 3300009148 Bacteria 7637
84 Ga0105241_10017280 3300009174 Bacteria 5299
85 Ga0105241_10043771 3300009174 Bacteria 3391
86 Ga0105241_10066539 3300009174 Bacteria 2787
87 Ga0105241_10218859 3300009174 Unclassified 1599
88 Ga0105241_10238866 3300009174 Bacteria 1535
89 Ga0105241_10615172 3300009174 Bacteria 983
90 Ga0105242_10001073 3300009176 Bacteria 21467
91 Ga0105242_10077559 3300009176 Bacteria 2772
92 Ga0105242_10129679 3300009176 Bacteria 2175
93 Ga0105242_10142131 3300009176 Bacteria 2084
94 Ga0105248_10024980 3300009177 Bacteria 6640
95 Ga0105248_10380618 3300009177 Bacteria 1589
96 Ga0105248_10453583 3300009177 Bacteria 1445
97 Ga0105237_10018540 3300009545 Bacteria 7202
98 Ga0105237_10161483 3300009545 Bacteria 2239
99 Ga0105238_10116690 3300009551 Bacteria 2649
100 Ga0105238_10125421 3300009551 Bacteria 2547
101 Ga0105238_10145845 3300009551 Bacteria 2343
102 Ga0105238_10181359 3300009551 Bacteria 2082
103 Ga0105249_10101040 3300009553 Bacteria 2712
104 Ga0105239_10103138 3300010375 Bacteria 3157
105 Ga0105239_10275813 3300010375 Bacteria 1892
106 Ga0105246_10045818 3300011119 Bacteria 2980
107 Ga0105246_10292199 3300011119 Bacteria 1312
108 Ga0157373_10329968 3300013100 Bacteria 1086
109 Ga0157370_10016442 3300013104 Bacteria 7490
110 Ga0157370_10024392 3300013104 Bacteria 5990
111 Ga0157374_10072575 3300013296 Bacteria 3248
112 Ga0157374_10133239 3300013296 Unclassified 2406
113 Ga0157378_10033513 3300013297 Unclassified 4541
114 Ga0157372_10458117 3300013307 Bacteria 1486
115 Ga0157375_10154687 3300013308 Unclassified 2431
116 Ga0157375_10434853 3300013308 Bacteria 1478
117 Ga0157375_11020617 3300013308 Bacteria 966
118 Ga0157375_11148190 3300013308 Bacteria 910
119 Ga0163163_10129023 3300014325 Bacteria 2568
120 Ga0157380_10003533 3300014326 Bacteria 10746
121 Ga0157377_10012076 3300014745 Bacteria 4332
122 Ga0157379_10022148 3300014968 Bacteria 5633
123 Ga0157376_10317339 3300014969 Unclassified 1480
124 Ga0157376_10676882 3300014969 Bacteria 1035
125 Ga0163161_10040042 3300017792 Unclassified 3365
126 Ga0209148_1000938 3300025254 Bacteria 19201
127 Ga0209758_1000008 3300025297 Bacteria 1215263
128 Ga0207682_10234806 3300025893 Bacteria 851
129 Ga0207642_10057157 3300025899 Bacteria 1793
130 Ga0207680_10041245 3300025903 Unclassified 2691
131 Ga0207680_10134868 3300025903 Bacteria 1631
132 Ga0207645_10019407 3300025907 Bacteria 4457
133 Ga0207645_10042912 3300025907 Bacteria 2894
134 Ga0207643_10075729 3300025908 Bacteria 1943
135 Ga0207705_10002646 3300025909 Bacteria 13722
136 Ga0207705_10061362 3300025909 Bacteria 2716
137 Ga0207705_10145785 3300025909 Bacteria 1771
138 Ga0207654_10018628 3300025911 Bacteria 3647
139 Ga0207654_10230122 3300025911 Bacteria 1234
140 Ga0207654_10311128 3300025911 Bacteria 1074
141 Ga0207707_10071495 3300025912 Bacteria 3023
142 Ga0207695_10015013 3300025913 Bacteria 9138
143 Ga0207695_10043546 3300025913 Bacteria 4783
144 Ga0207671_10106333 3300025914 Bacteria 2130
145 Ga0207671_10119886 3300025914 Bacteria 2010
146 Ga0207662_10120463 3300025918 Bacteria 1645
147 Ga0207657_10005569 3300025919 Bacteria 13152
148 Ga0207657_10049921 3300025919 Bacteria 3643
149 Ga0207649_10000037 3300025920 Bacteria 131159
150 Ga0207652_10067379 3300025921 Bacteria 3104
151 Ga0207652_10118913 3300025921 Bacteria 2349
152 Ga0207652_10398335 3300025921 Bacteria 1242
153 Ga0207652_10472496 3300025921 Bacteria 1130
154 Ga0207646_10516826 3300025922 Bacteria 1075
155 Ga0207681_10084137 3300025923 Bacteria 2254
156 Ga0207694_10050435 3300025924 Bacteria 3223
157 Ga0207694_10089988 3300025924 Bacteria 2421
158 Ga0207694_10150667 3300025924 Bacteria 1873
159 Ga0207650_10041683 3300025925 Bacteria 3365
160 Ga0207659_10009416 3300025926 Bacteria 6102
161 Ga0207687_10078286 3300025927 Bacteria 2380
162 Ga0207687_10551829 3300025927 Bacteria 967
163 Ga0207690_10031630 3300025932 Bacteria 3388
164 Ga0207706_10430161 3300025933 Bacteria 1143
165 Ga0207686_10002896 3300025934 Bacteria 9249
166 Ga0207686_10094314 3300025934 Bacteria 1984
167 Ga0207686_10204969 3300025934 Bacteria 1414
168 Ga0207686_10249361 3300025934 Bacteria 1296
169 Ga0207709_10069309 3300025935 Bacteria 2232
170 Ga0207709_10124089 3300025935 Bacteria 1749
171 Ga0207670_10130346 3300025936 Bacteria 1841
172 Ga0207704_10005216 3300025938 Bacteria 5982
173 Ga0207704_10245579 3300025938 Bacteria 1340
174 Ga0207704_10408066 3300025938 Bacteria 1074
175 Ga0207691_10098821 3300025940 Bacteria 2607
176 Ga0207689_10000796 3300025942 Bacteria 30368
177 Ga0207689_10185724 3300025942 Bacteria 1715
178 Ga0207679_10526224 3300025945 Bacteria 1058
179 Ga0207667_10306826 3300025949 Bacteria 1621
180 Ga0207667_10939525 3300025949 Bacteria 855
181 Ga0207651_10046106 3300025960 Bacteria 2928
182 Ga0207651_10046827 3300025960 Bacteria 2911
183 Ga0207712_10029442 3300025961 Bacteria 3684
184 Ga0207703_10007545 3300026035 Bacteria 8625
185 Ga0207703_10379523 3300026035 Unclassified 1307
186 Ga0207639_10313543 3300026041 Bacteria 1390
187 Ga0207639_10314840 3300026041 Bacteria 1388
188 Ga0207678_10248490 3300026067 Bacteria 1523
189 Ga0207678_10278130 3300026067 Bacteria 1436
190 Ga0207678_10404892 3300026067 Bacteria 1182
191 Ga0207708_10004384 3300026075 Bacteria 10398
192 Ga0207641_10040768 3300026088 Bacteria 3889
193 Ga0207648_10000077 3300026089 Bacteria 93009
194 Ga0207648_10006135 3300026089 Bacteria 11982
195 Ga0207676_10152835 3300026095 Bacteria 1990
196 Ga0207674_10072018 3300026116 Bacteria 3472
197 Ga0207674_10129228 3300026116 Bacteria 2491
198 Ga0207675_100005769 3300026118 Bacteria 11842
199 Ga0207675_100834025 3300026118 Bacteria 936
200 Ga0207683_10021119 3300026121 Bacteria 5572
201 Ga0207683_10041079 3300026121 Bacteria 4037
202 Ga0207683_10111365 3300026121 Bacteria 2451
203 Ga0207683_10140539 3300026121 Bacteria 2176
204 Ga0268266_10000605 3300028379 Bacteria 48989
205 Ga0268266_10023440 3300028379 Bacteria 5257
206 Ga0268266_10129288 3300028379 Bacteria 2257
207 Ga0268264_10018542 3300028381 Bacteria 5691
208 Ga0265338_10006547 3300028800 Bacteria 14803
209 Ga0265332_10076594 3300031238 Bacteria 1421
210 Ga0265325_10150759 3300031241 Bacteria 1100
211 Ga0265340_10037086 3300031247 Bacteria 2415
212 Ga0265331_10015502 3300031250 Bacteria 4021
213 Ga0265331_10053113 3300031250 Bacteria 1934
214 Ga0265327_10001715 3300031251 Bacteria 26075
215 Ga0265316_10217240 3300031344 Bacteria 1412
216 Ga0307513_10103878 3300031456 Bacteria 2857
217 Ga0265314_10057547 3300031711 Viruses 2669
218 Ga0265342_10017672 3300031712 Bacteria 4634
219 Ga0307409_100886059 3300031995 Bacteria 905
220 Ga0395899_0080103 3300037312 Bacteria 2377
221 Ga0395899_0103549 3300037312 Bacteria 2053
222 Ga0395899_0163311 3300037312 Bacteria 1572
223 Ga0395900_0004968 3300037418 Bacteria 13987
224 Ga0395898_0026402 3300037466 Bacteria 5844
225 Ga0436365_0463687 3300039437 Bacteria 640
226 Ga0436365_0898727 3300039437 Bacteria 982
227 Ga0451807_0620802 3300041486 Bacteria 1543
228 Ga0439449_0070380 3300042007 Bacteria 1289
229 Ga0453683_0042672 3300044673 Bacteria 2848
230 Ga0466964_0050675 3300044706 Bacteria 1702
231 Ga0495617_000029 3300046452 Bacteria 153239
232 Ga0495590_0000071 3300046457 Bacteria 71082
233 Ga0495591_000240 3300046458 Bacteria 52636
234 Ga0495584_0022570 3300046491 Bacteria 3192
235 Ga0495584_0024282 3300046491 Bacteria 3074
236 Ga0495585_0002136 3300046492 Bacteria 14426
237 Ga0495585_0002920 3300046492 Bacteria 11835
238 Ga0495596_0000954 3300046500 Bacteria 17266
239 Ga0495596_0010651 3300046500 Bacteria 3996
240 Ga0495607_0011885 3300046501 Bacteria 5766
241 Ga0495583_0008636 3300046506 Bacteria 6199
242 Ga0495606_0478147 3300046507 Bacteria 633
243 Ga0495610_0007276 3300046512 Bacteria 7413
244 Ga0495620_0073955 3300046515 Bacteria 1389
245 Ga0495631_0015456 3300046518 Bacteria 3655
246 Ga0495632_0021594 3300046519 Bacteria 3467
247 Ga0495637_0000004 3300046520 Bacteria 589740
248 Ga0495644_0016513 3300046523 Bacteria 2825
249 Ga0495644_0219122 3300046523 Bacteria 735
250 Ga0495621_0311600 3300046539 Bacteria 654
251 Ga0495633_0042734 3300046558 Bacteria 2151
252 Ga0495656_0033562 3300046615 Bacteria 2096
253 Ga0495668_0277069 3300046616 Bacteria 919
254 Ga0495611_0074179 3300046648 Bacteria 1558
255 Ga0495661_0030820 3300046665 Bacteria 3411
256 Ga0495661_0099376 3300046665 Bacteria 1641
257 Ga0495661_0144779 3300046665 Bacteria 1289
258 Ga0495670_0187306 3300046691 Bacteria 1094
259 Ga0495649_0032689 3300046694 Bacteria 2864
260 Ga0495649_0250566 3300046694 Bacteria 910
261 Ga0495672_0000240 3300047320 Bacteria 77639
262 Ga0495683_0000516 3300047323 Bacteria 29659
263 Ga0495677_0000066 3300047445 Bacteria 56474
264 Ga0495679_004653 3300047446 Bacteria 6254
265 Ga0495681_0090672 3300047470 Unclassified 1350
266 Ga0495686_0000744 3300047472 Bacteria 43385
267 Ga0495626_0112819 3300048091 Bacteria 1175
268 Ga0496102_0000410 3300048905 Bacteria 49794
269 Ga0496106_0338526 3300048909 Bacteria 1208
270 Ga0496107_0246880 3300048910 Bacteria 1328
271 Ga0496108_0271643 3300048911 Bacteria 1476
272 Ga0496109_0111832 3300048912 Bacteria 2539
273 Ga0496110_0035462 3300048913 Bacteria 4327
274 Ga0496111_0008542 3300048914 Bacteria 6785
275 Ga0496121_0001925 3300048924 Bacteria 33163
276 Ga0496124_0050960 3300048927 Bacteria 3524
277 Ga0495678_000240 3300049459 Bacteria 61885
278 Ga0501031_0005044 3300049568 Bacteria 8586
279 Ga0501032_0123505 3300049569 Bacteria 1711
280 Ga0501032_0265285 3300049569 Bacteria 1113
281 Ga0501033_0012728 3300049570 Bacteria 6415
282 Ga0501033_0013251 3300049570 Bacteria 6280
283 Ga0501033_0054344 3300049570 Bacteria 2963
284 Ga0501033_0119189 3300049570 Bacteria 1916
285 Ga0501033_0383668 3300049570 Bacteria 981
286 Ga0501033_0482722 3300049570 Bacteria 858
287 Ga0501034_0009126 3300049571 Bacteria 10411
288 Ga0501034_0095935 3300049571 Bacteria 2962
289 Ga0501034_0180721 3300049571 Bacteria 2074
290 Ga0501034_0381082 3300049571 Bacteria 1335
291 Ga0501036_0009873 3300049572 Bacteria 7859
292 Ga0501036_0097789 3300049572 Bacteria 2481
293 Ga0501036_0220082 3300049572 Bacteria 1594
294 Ga0501037_0170742 3300049573 Bacteria 1546
295 Ga0501038_0022083 3300049574 Bacteria 5705
296 Ga0501038_0186171 3300049574 Bacteria 1673
297 Ga0501039_0019091 3300049575 Bacteria 5260
298 Ga0501040_0294297 3300049576 Bacteria 1160
299 Ga0501043_0148877 3300049579 Bacteria 1832
300 Ga0501043_0198664 3300049579 Bacteria 1557
301 Ga0501046_0015648 3300049580 Bacteria 6369
302 Ga0501046_0024051 3300049580 Bacteria 5002
303 Ga0501046_0130063 3300049580 Bacteria 1910
304 Ga0501047_0009340 3300049581 Bacteria 9258
305 Ga0501047_0010363 3300049581 Bacteria 8818
306 Ga0501047_0096124 3300049581 Bacteria 2841
307 Ga0501047_0412777 3300049581 Bacteria 1182
308 Ga0501048_0007096 3300049582 Bacteria 8510
309 Ga0501067_0012727 3300049583 Bacteria 4663
310 Ga0501069_0000637 3300049585 Bacteria 16234
311 Ga0501070_0011205 3300049586 Bacteria 7568
312 Ga0501070_0076441 3300049586 Bacteria 2772
313 Ga0501070_0097872 3300049586 Bacteria 2427
314 Ga0501070_0275468 3300049586 Bacteria 1373
315 Ga0501071_0464064 3300049587 Bacteria 970
316 Ga0501072_0002723 3300049588 Bacteria 13272
317 Ga0501072_0059045 3300049588 Bacteria 3024
318 Ga0501073_0012438 3300049589 Bacteria 6209
319 Ga0501073_0015615 3300049589 Bacteria 5510
320 Ga0501073_0088578 3300049589 Bacteria 2152
321 Ga0501073_0127917 3300049589 Bacteria 1761
322 Ga0501074_0004038 3300049590 Bacteria 10469
323 Ga0501076_0177318 3300049592 Bacteria 1737
324 Ga0501223_000063 3300049663 Bacteria 34326
325 Ga0501224_000006 3300049664 Bacteria 149611
326 Ga0501233_000629 3300049668 Bacteria 5753
327 Ga0501225_0000123 3300049705 Bacteria 23813
328 Ga0501234_000531 3300049707 Bacteria 5823
329 Ga0501079_0002391 3300049741 Bacteria 13609
330 Ga0501080_0015619 3300049742 Bacteria 7002
331 Ga0501080_0129920 3300049742 Bacteria 2332
332 Ga0501080_0242053 3300049742 Bacteria 1646
333 Ga0501083_0003185 3300049744 Bacteria 11424
334 Ga0501083_0228322 3300049744 Bacteria 1212
335 Ga0501035_0016722 3300049822 Bacteria 6762
336 Ga0501035_0036871 3300049822 Bacteria 4430
337 Ga0501035_0065595 3300049822 Bacteria 3224
338 Ga0501035_0082501 3300049822 Bacteria 2837
339 Ga0501035_0353998 3300049822 Bacteria 1228
340 Ga0501044_0002816 3300049823 Bacteria 19820
341 Ga0501044_0005978 3300049823 Bacteria 13461
342 Ga0501044_0068309 3300049823 Bacteria 3620
343 Ga0501044_0252439 3300049823 Bacteria 1704
344 Ga0501044_0291197 3300049823 Bacteria 1564
345 Ga0501045_0395557 3300049824 Bacteria 1028
346 Ga0501226_000048 3300049853 Bacteria 53910
347 Ga0500635_0079190 3300053080 Bacteria 1178
348 Ga0500555_000896 3300053103 Bacteria 10591
349 Ga0500595_018483 3300053119 Bacteria 2548
350 Ga0500642_0072646 3300053130 Bacteria 1568
351 Ga0500568_0001406 3300053139 Bacteria 15618
352 Ga0500573_0000009 3300053140 Bacteria 230823
353 Ga0500616_0000902 3300053153 Bacteria 32595
354 Ga0500645_000309 3300053730 Bacteria 34835
355 Ga0500645_013433 3300053730 Bacteria 2628
356 Ga0501084_0003412 3300054114 Bacteria 12886
357 Ga0501082_0003576 3300060353 Bacteria 13573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0463687 Ga0436365_0463687_33_593 181
2 3300046507 Ga0495606_0478147 Ga0495606_0478147_11_571 181
3 3300046539 Ga0495621_0311600 Ga0495621_0311600_22_639 200
4 3300046523 Ga0495644_0219122 Ga0495644_0219122_19_648 208
5 3300053103 Ga0500555_000896 Ga0500555_000896_639_1295 218
6 3300053730 Ga0500645_000309 Ga0500645_000309_8869_9525 218
7 iso_pu_bacteria 2808606418 2809145070 220
8 iso_pu_bacteria 8057101203 8057105563 223
9 3300003759 Ga0055525_1000001 Ga0055525_1000001136 224
10 3300005262 Ga0065165_1006332 Ga0065165_10063322 224
11 3300005563 Ga0068855_100285635 Ga0068855_1002856352 224
12 3300013100 Ga0157373_10329968 Ga0157373_103299682 224
13 3300013307 Ga0157372_10458117 Ga0157372_104581172 224
14 3300025254 Ga0209148_1000938 Ga0209148_10009389 224
15 3300025933 Ga0207706_10430161 Ga0207706_104301611 224
16 3300037312 Ga0395899_0080103 Ga0395899_0080103_649_1326 224
17 3300037312 Ga0395899_0103549 Ga0395899_0103549_275_952 224
18 3300037312 Ga0395899_0163311 Ga0395899_0163311_219_896 224
19 3300042007 Ga0439449_0070380 Ga0439449_0070380_439_1116 224
20 3300044706 Ga0466964_0050675 Ga0466964_0050675_445_1122 224
21 3300046452 Ga0495617_000029 Ga0495617_000029_54288_54965 224
22 3300046457 Ga0495590_0000071 Ga0495590_0000071_67063_67740 224
23 3300046458 Ga0495591_000240 Ga0495591_000240_2906_3583 224
24 3300046491 Ga0495584_0022570 Ga0495584_0022570_2101_2778 224
25 3300046491 Ga0495584_0024282 Ga0495584_0024282_1642_2319 224
26 3300046492 Ga0495585_0002136 Ga0495585_0002136_12625_13302 224
27 3300046492 Ga0495585_0002920 Ga0495585_0002920_2084_2761 224
28 3300046500 Ga0495596_0000954 Ga0495596_0000954_15939_16616 224
29 3300046500 Ga0495596_0010651 Ga0495596_0010651_2142_2819 224
30 3300046501 Ga0495607_0011885 Ga0495607_0011885_2906_3583 224
31 3300046506 Ga0495583_0008636 Ga0495583_0008636_2566_3243 224
32 3300046512 Ga0495610_0007276 Ga0495610_0007276_3261_3938 224
33 3300046518 Ga0495631_0015456 Ga0495631_0015456_2576_3253 224
34 3300046519 Ga0495632_0021594 Ga0495632_0021594_2229_2906 224
35 3300046520 Ga0495637_0000004 Ga0495637_0000004_203358_204035 224
36 3300046523 Ga0495644_0016513 Ga0495644_0016513_65_742 224
37 3300046558 Ga0495633_0042734 Ga0495633_0042734_213_890 224
38 3300046616 Ga0495668_0277069 Ga0495668_0277069_35_712 224
39 3300046648 Ga0495611_0074179 Ga0495611_0074179_113_790 224
40 3300046665 Ga0495661_0030820 Ga0495661_0030820_652_1329 224
41 3300046665 Ga0495661_0099376 Ga0495661_0099376_109_786 224
42 3300046665 Ga0495661_0144779 Ga0495661_0144779_350_1027 224
43 3300046694 Ga0495649_0032689 Ga0495649_0032689_449_1126 224
44 3300047320 Ga0495672_0000240 Ga0495672_0000240_66284_66961 224
45 3300047323 Ga0495683_0000516 Ga0495683_0000516_27201_27878 224
46 3300047445 Ga0495677_0000066 Ga0495677_0000066_52327_53004 224
47 3300047446 Ga0495679_004653 Ga0495679_004653_5563_6240 224
48 3300047472 Ga0495686_0000744 Ga0495686_0000744_1694_2395 224
49 3300048091 Ga0495626_0112819 Ga0495626_0112819_449_1126 224
50 3300048905 Ga0496102_0000410 Ga0496102_0000410_2349_3026 224
51 3300048909 Ga0496106_0338526 Ga0496106_0338526_502_1179 224
52 3300048910 Ga0496107_0246880 Ga0496107_0246880_527_1204 224
53 3300048911 Ga0496108_0271643 Ga0496108_0271643_491_1168 224
54 3300048912 Ga0496109_0111832 Ga0496109_0111832_1438_2115 224
55 3300048913 Ga0496110_0035462 Ga0496110_0035462_344_1021 224
56 3300048914 Ga0496111_0008542 Ga0496111_0008542_3439_4116 224
57 3300048927 Ga0496124_0050960 Ga0496124_0050960_1573_2250 224
58 3300049459 Ga0495678_000240 Ga0495678_000240_5691_6368 224
59 3300003215 JGI25153J46596_10001840 JGI25153J46596_100018405 226
60 3300005327 Ga0070658_10019575 Ga0070658_100195753 226
61 3300005327 Ga0070658_10087610 Ga0070658_100876102 226
62 3300005327 Ga0070658_10123865 Ga0070658_101238652 226
63 3300005328 Ga0070676_10055420 Ga0070676_100554202 226
64 3300005328 Ga0070676_10056920 Ga0070676_100569202 226
65 3300005330 Ga0070690_100007445 Ga0070690_1000074452 226
66 3300005334 Ga0068869_100004447 Ga0068869_1000044476 226
67 3300005334 Ga0068869_100083903 Ga0068869_1000839032 226
68 3300005334 Ga0068869_100204765 Ga0068869_1002047652 226
69 3300005335 Ga0070666_10019346 Ga0070666_100193463 226
70 3300005335 Ga0070666_10214074 Ga0070666_102140742 226
71 3300005336 Ga0070680_100033630 Ga0070680_1000336302 226
72 3300005337 Ga0070682_100573054 Ga0070682_1005730542 226
73 3300005338 Ga0068868_100022602 Ga0068868_1000226025 226
74 3300005339 Ga0070660_100014839 Ga0070660_1000148392 226
75 3300005340 Ga0070689_100041851 Ga0070689_1000418514 226
76 3300005344 Ga0070661_100008963 Ga0070661_1000089632 226
77 3300005353 Ga0070669_100024664 Ga0070669_1000246644 226
78 3300005364 Ga0070673_100012626 Ga0070673_1000126262 226
79 3300005364 Ga0070673_100092027 Ga0070673_1000920272 226
80 3300005365 Ga0070688_100188811 Ga0070688_1001888112 226
81 3300005366 Ga0070659_100013679 Ga0070659_1000136796 226
82 3300005367 Ga0070667_100048894 Ga0070667_1000488942 226
83 3300005437 Ga0070710_10158329 Ga0070710_101583292 226
84 3300005438 Ga0070701_10032884 Ga0070701_100328842 226
85 3300005439 Ga0070711_100453965 Ga0070711_1004539652 226
86 3300005441 Ga0070700_100003842 Ga0070700_1000038425 226
87 3300005456 Ga0070678_100034259 Ga0070678_1000342592 226
88 3300005458 Ga0070681_10089988 Ga0070681_100899882 226
89 3300005458 Ga0070681_10095937 Ga0070681_100959372 226
90 3300005459 Ga0068867_100012483 Ga0068867_1000124832 226
91 3300005459 Ga0068867_100018876 Ga0068867_1000188762 226
92 3300005468 Ga0070707_100592737 Ga0070707_1005927372 226
93 3300005530 Ga0070679_100079302 Ga0070679_1000793022 226
94 3300005539 Ga0068853_100057032 Ga0068853_1000570323 226
95 3300005543 Ga0070672_100032007 Ga0070672_1000320074 226
96 3300005544 Ga0070686_100011593 Ga0070686_1000115933 226
97 3300005548 Ga0070665_100000366 Ga0070665_10000036631 226
98 3300005548 Ga0070665_100015760 Ga0070665_1000157602 226
99 3300005548 Ga0070665_100170565 Ga0070665_1001705652 226
100 3300005563 Ga0068855_100052241 Ga0068855_1000522415 226
101 3300005563 Ga0068855_100251589 Ga0068855_1002515892 226
102 3300005577 Ga0068857_100557385 Ga0068857_1005573852 226
103 3300005577 Ga0068857_100752542 Ga0068857_1007525422 226
104 3300005578 Ga0068854_100424657 Ga0068854_1004246571 226
105 3300005615 Ga0070702_100039593 Ga0070702_1000395933 226
106 3300005617 Ga0068859_100159717 Ga0068859_1001597173 226
107 3300005618 Ga0068864_100141316 Ga0068864_1001413162 226
108 3300005618 Ga0068864_100160728 Ga0068864_1001607282 226
109 3300005718 Ga0068866_10044982 Ga0068866_100449823 226
110 3300005719 Ga0068861_100007387 Ga0068861_1000073874 226
111 3300005840 Ga0068870_10030758 Ga0068870_100307583 226
112 3300005840 Ga0068870_10068337 Ga0068870_100683372 226
113 3300005841 Ga0068863_100017603 Ga0068863_1000176036 226
114 3300005842 Ga0068858_100006175 Ga0068858_1000061754 226
115 3300005843 Ga0068860_100136609 Ga0068860_1001366093 226
116 3300005843 Ga0068860_100188473 Ga0068860_1001884732 226
117 3300006237 Ga0097621_100000026 Ga0097621_10000002619 226
118 3300006237 Ga0097621_100027992 Ga0097621_1000279924 226
119 3300006237 Ga0097621_100431316 Ga0097621_1004313162 226
120 3300006358 Ga0068871_100003516 Ga0068871_1000035165 226
121 3300006358 Ga0068871_100009444 Ga0068871_1000094446 226
122 3300006358 Ga0068871_100214036 Ga0068871_1002140362 226
123 3300006358 Ga0068871_100448837 Ga0068871_1004488372 226
124 3300006881 Ga0068865_100014791 Ga0068865_1000147913 226
125 3300006881 Ga0068865_100037928 Ga0068865_1000379284 226
126 3300006931 Ga0097620_100159715 Ga0097620_1001597153 226
127 3300009092 Ga0105250_10112005 Ga0105250_101120052 226
128 3300009093 Ga0105240_10044700 Ga0105240_100447003 226
129 3300009093 Ga0105240_10102070 Ga0105240_101020702 226
130 3300009098 Ga0105245_10032799 Ga0105245_100327992 226
131 3300009098 Ga0105245_10175144 Ga0105245_101751443 226
132 3300009098 Ga0105245_10585662 Ga0105245_105856622 226
133 3300009098 Ga0105245_11246689 Ga0105245_112466891 226
134 3300009148 Ga0105243_10003006 Ga0105243_1000300612 226
135 3300009148 Ga0105243_10008985 Ga0105243_100089854 226
136 3300009174 Ga0105241_10017280 Ga0105241_100172802 226
137 3300009174 Ga0105241_10043771 Ga0105241_100437712 226
138 3300009174 Ga0105241_10066539 Ga0105241_100665392 226
139 3300009174 Ga0105241_10218859 Ga0105241_102188592 226
140 3300009174 Ga0105241_10238866 Ga0105241_102388662 226
141 3300009174 Ga0105241_10615172 Ga0105241_106151721 226
142 3300009176 Ga0105242_10001073 Ga0105242_100010738 226
143 3300009176 Ga0105242_10077559 Ga0105242_100775592 226
144 3300009176 Ga0105242_10129679 Ga0105242_101296792 226
145 3300009176 Ga0105242_10142131 Ga0105242_101421312 226
146 3300009177 Ga0105248_10024980 Ga0105248_100249807 226
147 3300009177 Ga0105248_10380618 Ga0105248_103806182 226
148 3300009177 Ga0105248_10453583 Ga0105248_104535831 226
149 3300009545 Ga0105237_10018540 Ga0105237_100185402 226
150 3300009545 Ga0105237_10161483 Ga0105237_101614832 226
151 3300009551 Ga0105238_10116690 Ga0105238_101166903 226
152 3300009551 Ga0105238_10125421 Ga0105238_101254212 226
153 3300009551 Ga0105238_10145845 Ga0105238_101458453 226
154 3300009551 Ga0105238_10181359 Ga0105238_101813592 226
155 3300009553 Ga0105249_10101040 Ga0105249_101010403 226
156 3300010375 Ga0105239_10103138 Ga0105239_101031382 226
157 3300010375 Ga0105239_10275813 Ga0105239_102758132 226
158 3300011119 Ga0105246_10045818 Ga0105246_100458182 226
159 3300011119 Ga0105246_10292199 Ga0105246_102921992 226
160 3300013104 Ga0157370_10016442 Ga0157370_100164427 226
161 3300013104 Ga0157370_10024392 Ga0157370_100243922 226
162 3300013296 Ga0157374_10072575 Ga0157374_100725755 226
163 3300013296 Ga0157374_10133239 Ga0157374_101332393 226
164 3300013297 Ga0157378_10033513 Ga0157378_100335133 226
165 3300013308 Ga0157375_10154687 Ga0157375_101546873 226
166 3300013308 Ga0157375_10434853 Ga0157375_104348532 226
167 3300013308 Ga0157375_11148190 Ga0157375_111481902 226
168 3300014325 Ga0163163_10129023 Ga0163163_101290232 226
169 3300014326 Ga0157380_10003533 Ga0157380_100035335 226
170 3300014745 Ga0157377_10012076 Ga0157377_100120763 226
171 3300014968 Ga0157379_10022148 Ga0157379_100221481 226
172 3300014969 Ga0157376_10317339 Ga0157376_103173392 226
173 3300014969 Ga0157376_10676882 Ga0157376_106768821 226
174 3300017792 Ga0163161_10040042 Ga0163161_100400422 226
175 3300025297 Ga0209758_1000008 Ga0209758_1000008858 226
176 3300025893 Ga0207682_10234806 Ga0207682_102348062 226
177 3300025899 Ga0207642_10057157 Ga0207642_100571572 226
178 3300025903 Ga0207680_10041245 Ga0207680_100412452 226
179 3300025903 Ga0207680_10134868 Ga0207680_101348682 226
180 3300025907 Ga0207645_10019407 Ga0207645_100194074 226
181 3300025907 Ga0207645_10042912 Ga0207645_100429122 226
182 3300025908 Ga0207643_10075729 Ga0207643_100757292 226
183 3300025909 Ga0207705_10002646 Ga0207705_100026466 226
184 3300025909 Ga0207705_10061362 Ga0207705_100613623 226
185 3300025909 Ga0207705_10145785 Ga0207705_101457852 226
186 3300025911 Ga0207654_10018628 Ga0207654_100186282 226
187 3300025911 Ga0207654_10230122 Ga0207654_102301222 226
188 3300025911 Ga0207654_10311128 Ga0207654_103111282 226
189 3300025912 Ga0207707_10071495 Ga0207707_100714952 226
190 3300025913 Ga0207695_10043546 Ga0207695_100435463 226
191 3300025914 Ga0207671_10106333 Ga0207671_101063332 226
192 3300025914 Ga0207671_10119886 Ga0207671_101198862 226
193 3300025918 Ga0207662_10120463 Ga0207662_101204633 226
194 3300025919 Ga0207657_10005569 Ga0207657_100055697 226
195 3300025919 Ga0207657_10049921 Ga0207657_100499212 226
196 3300025920 Ga0207649_10000037 Ga0207649_100000378 226
197 3300025921 Ga0207652_10067379 Ga0207652_100673793 226
198 3300025921 Ga0207652_10118913 Ga0207652_101189133 226
199 3300025921 Ga0207652_10398335 Ga0207652_103983352 226
200 3300025921 Ga0207652_10472496 Ga0207652_104724962 226
201 3300025922 Ga0207646_10516826 Ga0207646_105168261 226
202 3300025923 Ga0207681_10084137 Ga0207681_100841372 226
203 3300025924 Ga0207694_10050435 Ga0207694_100504354 226
204 3300025924 Ga0207694_10089988 Ga0207694_100899883 226
205 3300025924 Ga0207694_10150667 Ga0207694_101506671 226
206 3300025925 Ga0207650_10041683 Ga0207650_100416833 226
207 3300025926 Ga0207659_10009416 Ga0207659_100094164 226
208 3300025927 Ga0207687_10078286 Ga0207687_100782863 226
209 3300025927 Ga0207687_10551829 Ga0207687_105518292 226
210 3300025932 Ga0207690_10031630 Ga0207690_100316303 226
211 3300025934 Ga0207686_10002896 Ga0207686_100028966 226
212 3300025934 Ga0207686_10094314 Ga0207686_100943142 226
213 3300025934 Ga0207686_10204969 Ga0207686_102049691 226
214 3300025934 Ga0207686_10249361 Ga0207686_102493612 226
215 3300025935 Ga0207709_10069309 Ga0207709_100693093 226
216 3300025935 Ga0207709_10124089 Ga0207709_101240892 226
217 3300025936 Ga0207670_10130346 Ga0207670_101303462 226
218 3300025938 Ga0207704_10005216 Ga0207704_100052164 226
219 3300025938 Ga0207704_10245579 Ga0207704_102455792 226
220 3300025938 Ga0207704_10408066 Ga0207704_104080662 226
221 3300025940 Ga0207691_10098821 Ga0207691_100988213 226
222 3300025942 Ga0207689_10000796 Ga0207689_1000079610 226
223 3300025942 Ga0207689_10185724 Ga0207689_101857242 226
224 3300025945 Ga0207679_10526224 Ga0207679_105262241 226
225 3300025949 Ga0207667_10306826 Ga0207667_103068262 226
226 3300025949 Ga0207667_10939525 Ga0207667_109395251 226
227 3300025960 Ga0207651_10046106 Ga0207651_100461062 226
228 3300025960 Ga0207651_10046827 Ga0207651_100468272 226
229 3300025961 Ga0207712_10029442 Ga0207712_100294422 226
230 3300026035 Ga0207703_10007545 Ga0207703_100075452 226
231 3300026035 Ga0207703_10379523 Ga0207703_103795232 226
232 3300026041 Ga0207639_10313543 Ga0207639_103135432 226
233 3300026041 Ga0207639_10314840 Ga0207639_103148403 226
234 3300026067 Ga0207678_10248490 Ga0207678_102484902 226
235 3300026067 Ga0207678_10278130 Ga0207678_102781302 226
236 3300026067 Ga0207678_10404892 Ga0207678_104048922 226
237 3300026075 Ga0207708_10004384 Ga0207708_100043845 226
238 3300026088 Ga0207641_10040768 Ga0207641_100407682 226
239 3300026089 Ga0207648_10000077 Ga0207648_1000007786 226
240 3300026089 Ga0207648_10006135 Ga0207648_1000613511 226
241 3300026095 Ga0207676_10152835 Ga0207676_101528352 226
242 3300026116 Ga0207674_10072018 Ga0207674_100720181 226
243 3300026116 Ga0207674_10129228 Ga0207674_101292282 226
244 3300026118 Ga0207675_100005769 Ga0207675_1000057693 226
245 3300026118 Ga0207675_100834025 Ga0207675_1008340252 226
246 3300026121 Ga0207683_10021119 Ga0207683_100211192 226
247 3300026121 Ga0207683_10041079 Ga0207683_100410792 226
248 3300026121 Ga0207683_10111365 Ga0207683_101113653 226
249 3300026121 Ga0207683_10140539 Ga0207683_101405391 226
250 3300028379 Ga0268266_10000605 Ga0268266_1000060536 226
251 3300028379 Ga0268266_10023440 Ga0268266_100234402 226
252 3300028379 Ga0268266_10129288 Ga0268266_101292882 226
253 3300028381 Ga0268264_10018542 Ga0268264_100185422 226
254 3300028800 Ga0265338_10006547 Ga0265338_100065478 226
255 3300031238 Ga0265332_10076594 Ga0265332_100765942 226
256 3300031241 Ga0265325_10150759 Ga0265325_101507592 226
257 3300031247 Ga0265340_10037086 Ga0265340_100370861 226
258 3300031250 Ga0265331_10015502 Ga0265331_100155024 226
259 3300031250 Ga0265331_10053113 Ga0265331_100531132 226
260 3300031251 Ga0265327_10001715 Ga0265327_1000171518 226
261 3300031344 Ga0265316_10217240 Ga0265316_102172402 226
262 3300031456 Ga0307513_10103878 Ga0307513_101038782 226
263 3300031711 Ga0265314_10057547 Ga0265314_100575472 226
264 3300031712 Ga0265342_10017672 Ga0265342_100176722 226
265 3300031995 Ga0307409_100886059 Ga0307409_1008860591 226
266 3300037418 Ga0395900_0004968 Ga0395900_0004968_5337_6023 226
267 3300037466 Ga0395898_0026402 Ga0395898_0026402_3202_3888 226
268 3300039437 Ga0436365_0898727 Ga0436365_0898727_270_965 226
269 3300041486 Ga0451807_0620802 Ga0451807_0620802_106_786 226
270 3300044673 Ga0453683_0042672 Ga0453683_0042672_466_1149 226
271 3300046515 Ga0495620_0073955 Ga0495620_0073955_231_917 226
272 3300046615 Ga0495656_0033562 Ga0495656_0033562_1312_2007 226
273 3300046691 Ga0495670_0187306 Ga0495670_0187306_259_954 226
274 3300046694 Ga0495649_0250566 Ga0495649_0250566_95_781 226
275 3300047470 Ga0495681_0090672 Ga0495681_0090672_602_1297 226
276 3300048924 Ga0496121_0001925 Ga0496121_0001925_25825_26520 226
277 3300049568 Ga0501031_0005044 Ga0501031_0005044_6473_7168 226
278 3300049569 Ga0501032_0123505 Ga0501032_0123505_130_810 226
279 3300049569 Ga0501032_0265285 Ga0501032_0265285_226_906 226
280 3300049570 Ga0501033_0012728 Ga0501033_0012728_1115_1810 226
281 3300049570 Ga0501033_0013251 Ga0501033_0013251_4746_5426 226
282 3300049570 Ga0501033_0054344 Ga0501033_0054344_1493_2173 226
283 3300049570 Ga0501033_0119189 Ga0501033_0119189_370_1056 226
284 3300049570 Ga0501033_0383668 Ga0501033_0383668_104_784 226
285 3300049570 Ga0501033_0482722 Ga0501033_0482722_16_696 226
286 3300049571 Ga0501034_0009126 Ga0501034_0009126_6436_7131 226
287 3300049571 Ga0501034_0095935 Ga0501034_0095935_1091_1771 226
288 3300049571 Ga0501034_0180721 Ga0501034_0180721_498_1193 226
289 3300049572 Ga0501036_0009873 Ga0501036_0009873_6091_6786 226
290 3300049572 Ga0501036_0097789 Ga0501036_0097789_1105_1791 226
291 3300049572 Ga0501036_0220082 Ga0501036_0220082_742_1422 226
292 3300049573 Ga0501037_0170742 Ga0501037_0170742_541_1221 226
293 3300049574 Ga0501038_0022083 Ga0501038_0022083_791_1486 226
294 3300049574 Ga0501038_0186171 Ga0501038_0186171_129_824 226
295 3300049575 Ga0501039_0019091 Ga0501039_0019091_3916_4611 226
296 3300049576 Ga0501040_0294297 Ga0501040_0294297_162_857 226
297 3300049579 Ga0501043_0148877 Ga0501043_0148877_125_805 226
298 3300049579 Ga0501043_0198664 Ga0501043_0198664_844_1524 226
299 3300049580 Ga0501046_0015648 Ga0501046_0015648_1174_1869 226
300 3300049580 Ga0501046_0024051 Ga0501046_0024051_3300_3980 226
301 3300049580 Ga0501046_0130063 Ga0501046_0130063_407_1093 226
302 3300049581 Ga0501047_0009340 Ga0501047_0009340_7315_8001 226
303 3300049581 Ga0501047_0010363 Ga0501047_0010363_7500_8195 226
304 3300049581 Ga0501047_0096124 Ga0501047_0096124_41_736 226
305 3300049581 Ga0501047_0412777 Ga0501047_0412777_52_732 226
306 3300049582 Ga0501048_0007096 Ga0501048_0007096_6288_6983 226
307 3300049583 Ga0501067_0012727 Ga0501067_0012727_92_787 226
308 3300049585 Ga0501069_0000637 Ga0501069_0000637_9444_10139 226
309 3300049586 Ga0501070_0011205 Ga0501070_0011205_3281_3976 226
310 3300049586 Ga0501070_0076441 Ga0501070_0076441_871_1551 226
311 3300049586 Ga0501070_0275468 Ga0501070_0275468_143_823 226
312 3300049587 Ga0501071_0464064 Ga0501071_0464064_216_911 226
313 3300049588 Ga0501072_0002723 Ga0501072_0002723_8917_9597 226
314 3300049588 Ga0501072_0059045 Ga0501072_0059045_915_1610 226
315 3300049589 Ga0501073_0012438 Ga0501073_0012438_1142_1837 226
316 3300049589 Ga0501073_0015615 Ga0501073_0015615_4723_5403 226
317 3300049589 Ga0501073_0088578 Ga0501073_0088578_1156_1851 226
318 3300049589 Ga0501073_0127917 Ga0501073_0127917_229_909 226
319 3300049590 Ga0501074_0004038 Ga0501074_0004038_6494_7189 226
320 3300049592 Ga0501076_0177318 Ga0501076_0177318_622_1317 226
321 3300049741 Ga0501079_0002391 Ga0501079_0002391_8384_9079 226
322 3300049742 Ga0501080_0015619 Ga0501080_0015619_3152_3832 226
323 3300049742 Ga0501080_0129920 Ga0501080_0129920_1414_2109 226
324 3300049742 Ga0501080_0242053 Ga0501080_0242053_576_1262 226
325 3300049744 Ga0501083_0003185 Ga0501083_0003185_4220_4915 226
326 3300049744 Ga0501083_0228322 Ga0501083_0228322_70_750 226
327 3300049822 Ga0501035_0016722 Ga0501035_0016722_1567_2262 226
328 3300049822 Ga0501035_0036871 Ga0501035_0036871_618_1313 226
329 3300049822 Ga0501035_0065595 Ga0501035_0065595_1016_1696 226
330 3300049822 Ga0501035_0082501 Ga0501035_0082501_67_753 226
331 3300049822 Ga0501035_0353998 Ga0501035_0353998_288_968 226
332 3300049823 Ga0501044_0002816 Ga0501044_0002816_13436_14122 226
333 3300049823 Ga0501044_0005978 Ga0501044_0005978_7058_7753 226
334 3300049823 Ga0501044_0068309 Ga0501044_0068309_1485_2165 226
335 3300049823 Ga0501044_0252439 Ga0501044_0252439_230_925 226
336 3300049823 Ga0501044_0291197 Ga0501044_0291197_154_834 226
337 3300049824 Ga0501045_0395557 Ga0501045_0395557_50_745 226
338 3300053080 Ga0500635_0079190 Ga0500635_0079190_284_970 226
339 3300053119 Ga0500595_018483 Ga0500595_018483_185_871 226
340 3300053130 Ga0500642_0072646 Ga0500642_0072646_234_920 226
341 3300053139 Ga0500568_0001406 Ga0500568_0001406_7833_8513 226
342 3300053140 Ga0500573_0000009 Ga0500573_0000009_126846_127541 226
343 3300053153 Ga0500616_0000902 Ga0500616_0000902_1739_2419 226
344 3300053730 Ga0500645_013433 Ga0500645_013433_1522_2217 226
345 3300054114 Ga0501084_0003412 Ga0501084_0003412_5966_6661 226
346 3300060353 Ga0501082_0003576 Ga0501082_0003576_6427_7122 226
347 3300001915 JGI24741J21665_1016293 JGI24741J21665_10162932 227
348 3300002076 JGI24749J21850_1000462 JGI24749J21850_10004622 227
349 3300006880 Ga0075429_100301271 Ga0075429_1003012712 227
350 3300013308 Ga0157375_11020617 Ga0157375_110206172 227
351 3300025913 Ga0207695_10015013 Ga0207695_100150132 227
352 3300049571 Ga0501034_0381082 Ga0501034_0381082_240_923 227
353 3300049586 Ga0501070_0097872 Ga0501070_0097872_1495_2178 227
354 3300049663 Ga0501223_000063 Ga0501223_000063_28419_29102 227
355 3300049664 Ga0501224_000006 Ga0501224_000006_26079_26762 227
356 3300049668 Ga0501233_000629 Ga0501233_000629_4690_5373 227
357 3300049705 Ga0501225_0000123 Ga0501225_0000123_21802_22485 227
358 3300049707 Ga0501234_000531 Ga0501234_000531_5004_5687 227
359 3300049853 Ga0501226_000048 Ga0501226_000048_5277_5960 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

188

230

0.98

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

82

182

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9742 2 227
2c0s-assembly1.cif.gz_A nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis 0.9711 184 223
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9566 1 227
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9373 2 227
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9354 1 227
ID Description Score Start End Superfamily
2c0sA00 Few Secondary Structures;Irregular;MYOD Basic-Helix-Loop-Helix Domain, subunit B;Helix-loop-helix DNA-binding domain 0.9711 184 223 4.10.280.10
af_Q8N4C7_48_170_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9689 187 224 1.20.58.70
af_Q8R1Q0_41_164_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9665 187 224 1.20.58.70
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9448 2 178 2.60.120.620
af_Q9D3G5_40_165_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9217 181 224 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A2X3F8N6-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.991 111 175 GO:0006879
GO:0006974
GO:0016706
AF-A0A377TSW3-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9874 111 191 GO:0006879
GO:0006974
GO:0016706
AF-A0A087NCM8-F1-model_v4 Putative hydroxylase 0.9873 119 227 GO:0006879
GO:0006974
GO:0016706
AF-A0A645EQ15-F1-model_v4 PKHD-type hydroxylase (EC 1.14.11.-) 0.9849 116 227 GO:0006879
GO:0006974
GO:0016706
AF-A0A4Q3SUN3-F1-model_v4 PKHD-type hydroxylase 0.9847 1 98 GO:0006879
GO:0006974
GO:0016706

Feature Viewer

pLDDT pTM Quality
90.89 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map