F421153

General Info

Members Datasets Scaffolds Average Seq Length
358 240 716 227

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10609830|Ga0111539_106098301
Length 249
Sequence MSLRIGDAAPDFTANTTQGEISFHQWLGDSWGVLFSHPKDFTPVCSTELGYLAKLKPEFDKRDAKVIALSVDPVENHQKWSKDIEDIQGSPVTYPLIGDPTLAVSKLYDMLPNSAGETADGRTAADNHTVRNVYIIGPDKRVKLSIAYPMSTGRNLDEVLRVLDSLQLTSAVRVSTPVQWEPGQDVIIAGSVSNEEARKLYPEGWEEPKPYIRIVPQPVRDGVRGKTDRRASFKGPTDGVSSGTVPFTF

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
237 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
238 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
239 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
240 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.37
Metatranscriptomes 2.23
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 1.12
Rhizoplane 7.54
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10609830 3300009094 Bacteria 1271
2 JGI25407J50210_10000098 3300003373 Bacteria 11942
3 JGI25407J50210_10006915 3300003373 Bacteria 2836
4 Ga0065712_10306631 3300005290 Bacteria 851
5 Ga0065715_10132348 3300005293 Bacteria 1977
6 Ga0070658_10690862 3300005327 Bacteria 885
7 Ga0070676_10051889 3300005328 Bacteria 2409
8 Ga0070683_100108938 3300005329 Bacteria 2613
9 Ga0068869_100038786 3300005334 Bacteria 3398
10 Ga0068868_100027381 3300005338 Bacteria 4349
11 Ga0068868_100027769 3300005338 Bacteria 4319
12 Ga0068868_100056332 3300005338 Bacteria 3104
13 Ga0070689_100116264 3300005340 Bacteria 2132
14 Ga0070689_100122905 3300005340 Bacteria 2075
15 Ga0070691_10236770 3300005341 Bacteria 974
16 Ga0070661_100008185 3300005344 Bacteria 7212
17 Ga0070692_10037610 3300005345 Bacteria 2462
18 Ga0070668_100014043 3300005347 Bacteria 5989
19 Ga0070668_100115946 3300005347 Bacteria 2135
20 Ga0070675_100076087 3300005354 Bacteria 2791
21 Ga0070675_100291250 3300005354 Bacteria 1437
22 Ga0070671_100115066 3300005355 Bacteria 2261
23 Ga0070688_100050972 3300005365 Bacteria 2581
24 Ga0070688_100087664 3300005365 Bacteria 2028
25 Ga0070688_100091728 3300005365 Bacteria 1986
26 Ga0070659_100028669 3300005366 Bacteria 4301
27 Ga0070667_100008804 3300005367 Bacteria 8361
28 Ga0070667_100016138 3300005367 Bacteria 6178
29 Ga0070709_10059520 3300005434 Bacteria 2426
30 Ga0070714_100005586 3300005435 Bacteria 9607
31 Ga0070714_100070315 3300005435 Bacteria 3025
32 Ga0070714_100225118 3300005435 Bacteria 1726
33 Ga0070713_100047115 3300005436 Bacteria 3541
34 Ga0070713_100472950 3300005436 Bacteria 1180
35 Ga0070701_10023425 3300005438 Bacteria 2973
36 Ga0070711_100168165 3300005439 Bacteria 1668
37 Ga0070700_100042634 3300005441 Bacteria 2788
38 Ga0070694_100015958 3300005444 Bacteria 4724
39 Ga0070708_100129779 3300005445 Bacteria 2332
40 Ga0070662_100019458 3300005457 Bacteria 4608
41 Ga0068867_100000078 3300005459 Bacteria 59729
42 Ga0070685_10021088 3300005466 Bacteria 3538
43 Ga0070685_10026227 3300005466 Bacteria 3211
44 Ga0070706_100146138 3300005467 Bacteria 2208
45 Ga0070698_100006722 3300005471 Bacteria 12472
46 Ga0070679_100053686 3300005530 Bacteria 4011
47 Ga0070684_100062754 3300005535 Bacteria 3255
48 Ga0070684_100125644 3300005535 Bacteria 2310
49 Ga0070684_100818958 3300005535 Bacteria 871
50 Ga0068853_100612918 3300005539 Bacteria 1034
51 Ga0070686_100082999 3300005544 Bacteria 2126
52 Ga0070696_100160567 3300005546 Bacteria 1656
53 Ga0070665_100001275 3300005548 Bacteria 30231
54 Ga0070665_100114141 3300005548 Bacteria 2704
55 Ga0068855_100111668 3300005563 Bacteria 3138
56 Ga0070664_100009036 3300005564 Bacteria 8085
57 Ga0068857_100016207 3300005577 Bacteria 6528
58 Ga0068856_100063619 3300005614 Bacteria 3645
59 Ga0070702_100074595 3300005615 Bacteria 2013
60 Ga0068852_100711756 3300005616 Bacteria 1015
61 Ga0068859_100114377 3300005617 Bacteria 2762
62 Ga0068859_100346995 3300005617 Bacteria 1579
63 Ga0068866_10041927 3300005718 Bacteria 2274
64 Ga0068861_100049629 3300005719 Bacteria 3178
65 Ga0068861_100388742 3300005719 Bacteria 1235
66 Ga0068851_10040113 3300005834 Bacteria 2353
67 Ga0068863_100086779 3300005841 Bacteria 2965
68 Ga0068858_100000046 3300005842 Bacteria 127519
69 Ga0068858_100488006 3300005842 Bacteria 1189
70 Ga0068860_100015214 3300005843 Bacteria 7516
71 Ga0068862_100002575 3300005844 Bacteria 16012
72 Ga0068862_100048311 3300005844 Bacteria 3632
73 Ga0081455_10103107 3300005937 Bacteria 2286
74 Ga0081538_10000012 3300005981 Bacteria 153046
75 Ga0081538_10000349 3300005981 Bacteria 52694
76 Ga0081538_10004761 3300005981 Bacteria 12410
77 Ga0081539_10120189 3300005985 Bacteria 1306
78 Ga0070712_100046738 3300006175 Bacteria 2993
79 Ga0070712_100226136 3300006175 Bacteria 1484
80 Ga0075367_10142273 3300006178 Bacteria 1486
81 Ga0075366_10012499 3300006195 Bacteria 4815
82 Ga0075370_10137485 3300006353 Bacteria 1428
83 Ga0075428_100007273 3300006844 Bacteria 12265
84 Ga0075428_100046312 3300006844 Bacteria 4777
85 Ga0075428_100414859 3300006844 Bacteria 1443
86 Ga0075431_100164217 3300006847 Bacteria 2283
87 Ga0075431_100199305 3300006847 Bacteria 2049
88 Ga0075433_10011998 3300006852 Bacteria 6988
89 Ga0075433_10021133 3300006852 Bacteria 5455
90 Ga0075433_10061338 3300006852 Bacteria 3294
91 Ga0075433_10154760 3300006852 Bacteria 2040
92 Ga0075434_100098402 3300006871 Bacteria 2931
93 Ga0075429_100411966 3300006880 Bacteria 1184
94 Ga0068865_100016098 3300006881 Bacteria 4776
95 Ga0097620_100114382 3300006931 Bacteria 2762
96 Ga0097620_100346992 3300006931 Bacteria 1579
97 Ga0111539_10020313 3300009094 Bacteria 8182
98 Ga0111539_10730359 3300009094 Bacteria 1153
99 Ga0105245_10015396 3300009098 Bacteria 6667
100 Ga0105247_10595499 3300009101 Bacteria 819
101 Ga0114129_10004271 3300009147 Bacteria 20184
102 Ga0114129_10168360 3300009147 Bacteria 2989
103 Ga0114129_10177075 3300009147 Bacteria 2905
104 Ga0114129_10234495 3300009147 Bacteria 2470
105 Ga0114129_11092989 3300009147 Bacteria 999
106 Ga0105243_10357846 3300009148 Bacteria 1342
107 Ga0105242_10416603 3300009176 Bacteria 1257
108 Ga0105242_10944502 3300009176 Bacteria 866
109 Ga0105248_10020223 3300009177 Bacteria 7374
110 Ga0105248_10022209 3300009177 Bacteria 7035
111 Ga0105237_10155199 3300009545 Bacteria 2286
112 Ga0105249_10011775 3300009553 Bacteria 7689
113 Ga0105249_10027705 3300009553 Bacteria 5113
114 Ga0105249_10092718 3300009553 Bacteria 2828
115 Ga0105239_10029252 3300010375 Bacteria 6058
116 Ga0105246_10240517 3300011119 Bacteria 1431
117 Ga0157371_10010099 3300013102 Bacteria 7379
118 Ga0157370_10046006 3300013104 Bacteria 4185
119 Ga0157374_10002031 3300013296 Bacteria 16991
120 Ga0157374_10050820 3300013296 Bacteria 3854
121 Ga0157374_10108085 3300013296 Bacteria 2673
122 Ga0157378_10112608 3300013297 Bacteria 2496
123 Ga0157378_10129696 3300013297 Bacteria 2333
124 Ga0163162_10008741 3300013306 Bacteria 9853
125 Ga0163162_10942901 3300013306 Bacteria 974
126 Ga0157372_10232879 3300013307 Bacteria 2136
127 Ga0157372_10361420 3300013307 Bacteria 1692
128 Ga0157375_10043367 3300013308 Bacteria 4362
129 Ga0157380_10004278 3300014326 Bacteria 9885
130 Ga0157380_10626003 3300014326 Bacteria 1069
131 Ga0157377_10005678 3300014745 Bacteria 5881
132 Ga0157379_10018749 3300014968 Bacteria 6102
133 Ga0157379_10091436 3300014968 Bacteria 2730
134 Ga0157376_10089840 3300014969 Bacteria 2657
135 Ga0224712_10202244 3300022467 Bacteria 903
136 Ga0228598_1024831 3300024227 Bacteria 1179
137 Ga0207697_10014978 3300025315 Bacteria 3209
138 Ga0207642_10052094 3300025899 Bacteria 1855
139 Ga0207699_10211107 3300025906 Bacteria 1320
140 Ga0207699_10361442 3300025906 Bacteria 1027
141 Ga0207645_10005353 3300025907 Bacteria 9328
142 Ga0207684_10150994 3300025910 Bacteria 1999
143 Ga0207684_10309851 3300025910 Bacteria 1361
144 Ga0207693_10005994 3300025915 Bacteria 10080
145 Ga0207693_10089327 3300025915 Bacteria 2415
146 Ga0207662_10012095 3300025918 Bacteria 4803
147 Ga0207657_10036539 3300025919 Bacteria 4395
148 Ga0207681_10056114 3300025923 Bacteria 2685
149 Ga0207659_10029871 3300025926 Bacteria 3719
150 Ga0207659_10094035 3300025926 Bacteria 2245
151 Ga0207687_10145964 3300025927 Bacteria 1800
152 Ga0207700_10000003 3300025928 Bacteria 500797
153 Ga0207700_10110845 3300025928 Bacteria 2208
154 Ga0207700_10378888 3300025928 Bacteria 1237
155 Ga0207664_10565849 3300025929 Bacteria 1020
156 Ga0207690_10398494 3300025932 Bacteria 1097
157 Ga0207706_10001219 3300025933 Bacteria 26005
158 Ga0207706_10293482 3300025933 Bacteria 1417
159 Ga0207686_10037851 3300025934 Bacteria 2914
160 Ga0207670_10192683 3300025936 Bacteria 1543
161 Ga0207669_10110918 3300025937 Bacteria 1838
162 Ga0207669_10223371 3300025937 Bacteria 1384
163 Ga0207704_10022765 3300025938 Bacteria 3363
164 Ga0207665_10359857 3300025939 Bacteria 1100
165 Ga0207691_10003471 3300025940 Bacteria 15347
166 Ga0207711_10169327 3300025941 Bacteria 1981
167 Ga0207689_10001849 3300025942 Bacteria 20026
168 Ga0207661_10691790 3300025944 Bacteria 938
169 Ga0207679_11021280 3300025945 Bacteria 758
170 Ga0207651_10028043 3300025960 Bacteria 3546
171 Ga0207712_10050659 3300025961 Bacteria 2900
172 Ga0207712_10166474 3300025961 Bacteria 1719
173 Ga0207668_10031047 3300025972 Bacteria 3515
174 Ga0207640_10253654 3300025981 Bacteria 1367
175 Ga0207640_10920269 3300025981 Bacteria 765
176 Ga0207658_10017570 3300025986 Bacteria 4931
177 Ga0207658_10109098 3300025986 Bacteria 2184
178 Ga0207677_10015178 3300026023 Bacteria 4521
179 Ga0207677_10018140 3300026023 Bacteria 4218
180 Ga0207703_10000042 3300026035 Bacteria 161459
181 Ga0207703_10095042 3300026035 Bacteria 2513
182 Ga0207639_10424163 3300026041 Bacteria 1203
183 Ga0207678_10013290 3300026067 Bacteria 7224
184 Ga0207708_10009419 3300026075 Bacteria 7232
185 Ga0207641_10278380 3300026088 Bacteria 1572
186 Ga0207641_10602569 3300026088 Bacteria 1076
187 Ga0207648_10001238 3300026089 Bacteria 28690
188 Ga0207648_10042111 3300026089 Bacteria 4009
189 Ga0207674_10010317 3300026116 Bacteria 10592
190 Ga0207675_100000596 3300026118 Bacteria 35311
191 Ga0209971_1020931 3300027682 Bacteria 1555
192 Ga0207428_10107374 3300027907 Bacteria 2150
193 Ga0268266_10000526 3300028379 Bacteria 53404
194 Ga0268265_10003751 3300028380 Bacteria 10804
195 Ga0268265_10024588 3300028380 Bacteria 4263
196 Ga0268264_10444273 3300028381 Bacteria 1255
197 Ga0307511_10112146 3300030521 Bacteria 1730
198 Ga0307408_100001946 3300031548 Bacteria 14961
199 Ga0307406_10019762 3300031901 Bacteria 3958
200 Ga0307416_100068213 3300032002 Bacteria 2938
201 Ga0316593_10105071 3300032168 Eukaryota 1005
202 Ga0316592_1075990 3300033524 Eukaryota 762
203 Ga0316588_1058359 3300033528 Eukaryota 940
204 Ga0316587_1026545 3300033529 Eukaryota 1009
205 Ga0316596_1054442 3300033541 Eukaryota 1062
206 Ga0373934_0006370 3300035086 Bacteria 4378
207 Ga0373924_0057867 3300035410 Bacteria 1617
208 Ga0373933_0191209 3300035724 Bacteria 1307
209 Ga0395900_0004800 3300037418 Bacteria 14241
210 Ga0395900_0052427 3300037418 Bacteria 4199
211 Ga0395900_0261798 3300037418 Bacteria 1727
212 Ga0395898_0002434 3300037466 Bacteria 21997
213 Ga0395898_0019727 3300037466 Bacteria 6857
214 Ga0395898_0032689 3300037466 Bacteria 5194
215 Ga0395898_0146249 3300037466 Bacteria 2262
216 Ga0395905_0439874 3300037471 Bacteria 1201
217 Ga0395905_0485224 3300037471 Bacteria 1135
218 Ga0436364_0436242 3300037853 Bacteria 1242
219 Ga0436364_1526230 3300037853 Bacteria 4055
220 Ga0395901_0211227 3300038443 Bacteria 2031
221 Ga0436365_1549520 3300039437 Bacteria 1180
222 Ga0439448_0165576 3300042005 Bacteria 770
223 Ga0466961_0007756 3300044693 Bacteria 6833
224 Ga0466964_0009838 3300044706 Bacteria 3603
225 Ga0466964_0049307 3300044706 Bacteria 1724
226 Ga0466964_0065880 3300044706 Bacteria 1519
227 Ga0466971_0022406 3300044719 Bacteria 2815
228 Ga0466971_0055589 3300044719 Bacteria 1784
229 Ga0466971_0444490 3300044719 Bacteria 635
230 Ga0466957_0029481 3300044842 Bacteria 3272
231 Ga0466957_0095779 3300044842 Bacteria 1864
232 Ga0466959_0123437 3300045049 Bacteria 1839
233 Ga0451576_0638660 3300045051 Bacteria 1118
234 Ga0466958_0048807 3300045836 Bacteria 2559
235 Ga0466958_0052382 3300045836 Bacteria 2474
236 Ga0466967_0013755 3300045976 Bacteria 6270
237 Ga0466967_0024846 3300045976 Bacteria 4932
238 Ga0466967_0090031 3300045976 Bacteria 2787
239 Ga0466967_0093425 3300045976 Bacteria 2737
240 Ga0466967_0099787 3300045976 Bacteria 2652
241 Ga0495592_0042603 3300046454 Bacteria 3399
242 Ga0495603_0236049 3300046455 Bacteria 1054
243 Ga0495651_0008118 3300046462 Bacteria 8048
244 Ga0495651_0037950 3300046462 Bacteria 3751
245 Ga0495653_0000499 3300046463 Bacteria 30327
246 Ga0495653_0054222 3300046463 Bacteria 3064
247 Ga0495653_0223550 3300046463 Bacteria 1264
248 Ga0495580_0209637 3300046472 Bacteria 1341
249 Ga0495639_0016382 3300046475 Bacteria 3218
250 Ga0495594_0035468 3300046499 Bacteria 2717
251 Ga0495608_0018229 3300046511 Bacteria 4844
252 Ga0495608_0035421 3300046511 Bacteria 3366
253 Ga0495618_0000030 3300046514 Bacteria 108007
254 Ga0495630_0000627 3300046517 Bacteria 25585
255 Ga0495666_0300099 3300046526 Bacteria 727
256 Ga0495652_0031683 3300046529 Bacteria 4628
257 Ga0495652_0041321 3300046529 Bacteria 3981
258 Ga0495652_0075518 3300046529 Bacteria 2799
259 Ga0495640_0188257 3300046533 Bacteria 1313
260 Ga0495586_0000741 3300046535 Bacteria 18708
261 Ga0495587_0305572 3300046536 Bacteria 889
262 Ga0495645_0000098 3300046543 Bacteria 59944
263 Ga0495645_0069852 3300046543 Bacteria 2535
264 Ga0495633_0148854 3300046558 Bacteria 1082
265 Ga0495667_0011363 3300046559 Bacteria 6027
266 Ga0495667_0042794 3300046559 Bacteria 3003
267 Ga0495635_0023113 3300046663 Bacteria 4333
268 Ga0495657_0000017 3300046675 Bacteria 174558
269 Ga0495657_0045353 3300046675 Bacteria 2983
270 Ga0495657_0142452 3300046675 Bacteria 1493
271 Ga0495599_0025522 3300046678 Bacteria 3700
272 Ga0495623_0030186 3300046679 Bacteria 3487
273 Ga0495646_0018651 3300046680 Bacteria 4394
274 Ga0495647_0000004 3300046681 Bacteria 140700
275 Ga0495600_0005717 3300046809 Bacteria 7514
276 Ga0495600_0337654 3300046809 Bacteria 945
277 Ga0495604_0000102 3300047317 Bacteria 71652
278 Ga0495636_0000013 3300047318 Bacteria 85265
279 Ga0495672_0048250 3300047320 Bacteria 2526
280 Ga0495680_0005544 3300047322 Bacteria 11849
281 Ga0495680_0020971 3300047322 Bacteria 5478
282 Ga0495675_0027141 3300047444 Bacteria 3649
283 Ga0496100_0003555 3300048903 Bacteria 8144
284 Ga0496100_0023676 3300048903 Bacteria 3734
285 Ga0496101_0009836 3300048904 Bacteria 6299
286 Ga0496101_0274630 3300048904 Bacteria 1316
287 Ga0496102_0014504 3300048905 Bacteria 6846
288 Ga0496103_0196994 3300048906 Bacteria 1295
289 Ga0496104_0010416 3300048907 Bacteria 8304
290 Ga0496104_0187639 3300048907 Bacteria 1978
291 Ga0496104_0778464 3300048907 Bacteria 863
292 Ga0496105_0004082 3300048908 Bacteria 10932
293 Ga0496106_0003714 3300048909 Bacteria 11387
294 Ga0496107_0018297 3300048910 Bacteria 4932
295 Ga0496107_0788579 3300048910 Bacteria 696
296 Ga0496108_0000790 3300048911 Bacteria 24716
297 Ga0496108_0082480 3300048911 Bacteria 2726
298 Ga0496109_0000378 3300048912 Bacteria 40469
299 Ga0496109_0008690 3300048912 Bacteria 8645
300 Ga0496109_0273343 3300048912 Bacteria 1592
301 Ga0496110_0012465 3300048913 Bacteria 6991
302 Ga0496112_0000026 3300048915 Bacteria 144758
303 Ga0496112_0150665 3300048915 Bacteria 2293
304 Ga0496113_0025241 3300048916 Bacteria 4234
305 Ga0496113_0059587 3300048916 Bacteria 2876
306 Ga0496114_0017664 3300048917 Bacteria 5761
307 Ga0496114_0118055 3300048917 Bacteria 2279
308 Ga0496115_0000006 3300048918 Bacteria 252944
309 Ga0496115_0004844 3300048918 Bacteria 9769
310 Ga0496126_0020094 3300048929 Bacteria 6556
311 Ga0501310_032536 3300049130 Bacteria 698
312 Ga0501039_0074307 3300049575 Bacteria 2642
313 Ga0501040_0041471 3300049576 Bacteria 3135
314 Ga0501040_0131581 3300049576 Bacteria 1759
315 Ga0501042_0072996 3300049578 Bacteria 2455
316 Ga0501068_0202477 3300049584 Bacteria 1259
317 Ga0501071_0131187 3300049587 Bacteria 1862
318 Ga0501075_0077608 3300049591 Bacteria 2513
319 Ga0501075_0211337 3300049591 Bacteria 1480
320 Ga0501076_0148338 3300049592 Bacteria 1907
321 Ga0501076_0177193 3300049592 Bacteria 1738
322 Ga0501079_0103187 3300049741 Bacteria 2212
323 Ga0501081_0104345 3300049743 Bacteria 2007
324 Ga0501083_0376128 3300049744 Bacteria 924
325 Ga0501035_0145747 3300049822 Bacteria 2057
326 Ga0501045_0038099 3300049824 Bacteria 3497
327 nmdc:mga06z11_476921_c1 3300050494 Bacteria 755
328 nmdc:mga05p37_31397_c1 3300050507 Bacteria 6487
329 nmdc:mga05p37_80840_c1 3300050507 Bacteria 4003
330 nmdc:mga05p37_91652_c1 3300050507 Bacteria 3745
331 nmdc:mga09592_330416_c1 3300050508 Bacteria 1320
332 nmdc:mga06r32_259152_c1 3300050510 Bacteria 1727
333 nmdc:mga08y16_242251_c1 3300050511 Bacteria 1864
334 nmdc:mga08y16_351453_c1 3300050511 Bacteria 1514
335 nmdc:mga08y16_536332_c1 3300050511 Bacteria 1185
336 nmdc:mga0n895_100318_c1 3300050512 Bacteria 2904
337 nmdc:mga0n895_97730_c1 3300050512 Bacteria 2942
338 nmdc:mga0rr50_797121_c1 3300050513 Bacteria 806
339 nmdc:mga0a205_202031_c1 3300050515 Bacteria 1878
340 nmdc:mga0a205_6195_c1 3300050515 Bacteria 10796
341 nmdc:mga0a205_73384_c1 3300050515 Bacteria 3306
342 nmdc:mga0a205_75821_c1 3300050515 Bacteria 3249
343 Ga0495601_0003968 3300053077 Bacteria 8518
344 Ga0495601_0249481 3300053077 Bacteria 1159
345 Ga0495612_0000212 3300053078 Bacteria 24569
346 Ga0495595_0009652 3300053084 Bacteria 3996
347 Ga0495619_0000001 3300053085 Bacteria 586054
348 Ga0495619_0040623 3300053085 Bacteria 3040
349 Ga0501084_0086500 3300054114 Bacteria 2632
350 Ga0587083_0041378 3300059505 Bacteria 967
351 Ga0501082_1007501 3300060353 Bacteria 728
352 Ga0466962_0000962 3300061719 Bacteria 13087
353 Ga0466962_0015530 3300061719 Bacteria 3673
354 2513691485 2513237101 Bacteria 7952346
355 2876809839 2876808645 Bacteria 8824342
356 2879110645 2879110137 Bacteria 8907982
357 8006964422 8006964411 Bacteria 8966052
358 8006996187 8006994254 Bacteria 8309700
359 Ga0111539_10609830
360 JGI25407J50210_10000098
361 JGI25407J50210_10006915
362 Ga0065712_10306631
363 Ga0065715_10132348
364 Ga0070658_10690862
365 Ga0070676_10051889
366 Ga0070683_100108938
367 Ga0068869_100038786
368 Ga0068868_100027381
369 Ga0068868_100027769
370 Ga0068868_100056332
371 Ga0070689_100116264
372 Ga0070689_100122905
373 Ga0070691_10236770
374 Ga0070661_100008185
375 Ga0070692_10037610
376 Ga0070668_100014043
377 Ga0070668_100115946
378 Ga0070675_100076087
379 Ga0070675_100291250
380 Ga0070671_100115066
381 Ga0070688_100050972
382 Ga0070688_100087664
383 Ga0070688_100091728
384 Ga0070659_100028669
385 Ga0070667_100008804
386 Ga0070667_100016138
387 Ga0070709_10059520
388 Ga0070714_100005586
389 Ga0070714_100070315
390 Ga0070714_100225118
391 Ga0070713_100047115
392 Ga0070713_100472950
393 Ga0070701_10023425
394 Ga0070711_100168165
395 Ga0070700_100042634
396 Ga0070694_100015958
397 Ga0070708_100129779
398 Ga0070662_100019458
399 Ga0068867_100000078
400 Ga0070685_10021088
401 Ga0070685_10026227
402 Ga0070706_100146138
403 Ga0070698_100006722
404 Ga0070679_100053686
405 Ga0070684_100062754
406 Ga0070684_100125644
407 Ga0070684_100818958
408 Ga0068853_100612918
409 Ga0070686_100082999
410 Ga0070696_100160567
411 Ga0070665_100001275
412 Ga0070665_100114141
413 Ga0068855_100111668
414 Ga0070664_100009036
415 Ga0068857_100016207
416 Ga0068856_100063619
417 Ga0070702_100074595
418 Ga0068852_100711756
419 Ga0068859_100114377
420 Ga0068859_100346995
421 Ga0068866_10041927
422 Ga0068861_100049629
423 Ga0068861_100388742
424 Ga0068851_10040113
425 Ga0068863_100086779
426 Ga0068858_100000046
427 Ga0068858_100488006
428 Ga0068860_100015214
429 Ga0068862_100002575
430 Ga0068862_100048311
431 Ga0081455_10103107
432 Ga0081538_10000012
433 Ga0081538_10000349
434 Ga0081538_10004761
435 Ga0081539_10120189
436 Ga0070712_100046738
437 Ga0070712_100226136
438 Ga0075367_10142273
439 Ga0075366_10012499
440 Ga0075370_10137485
441 Ga0075428_100007273
442 Ga0075428_100046312
443 Ga0075428_100414859
444 Ga0075431_100164217
445 Ga0075431_100199305
446 Ga0075433_10011998
447 Ga0075433_10021133
448 Ga0075433_10061338
449 Ga0075433_10154760
450 Ga0075434_100098402
451 Ga0075429_100411966
452 Ga0068865_100016098
453 Ga0097620_100114382
454 Ga0097620_100346992
455 Ga0111539_10020313
456 Ga0111539_10730359
457 Ga0105245_10015396
458 Ga0105247_10595499
459 Ga0114129_10004271
460 Ga0114129_10168360
461 Ga0114129_10177075
462 Ga0114129_10234495
463 Ga0114129_11092989
464 Ga0105243_10357846
465 Ga0105242_10416603
466 Ga0105242_10944502
467 Ga0105248_10020223
468 Ga0105248_10022209
469 Ga0105237_10155199
470 Ga0105249_10011775
471 Ga0105249_10027705
472 Ga0105249_10092718
473 Ga0105239_10029252
474 Ga0105246_10240517
475 Ga0157371_10010099
476 Ga0157370_10046006
477 Ga0157374_10002031
478 Ga0157374_10050820
479 Ga0157374_10108085
480 Ga0157378_10112608
481 Ga0157378_10129696
482 Ga0163162_10008741
483 Ga0163162_10942901
484 Ga0157372_10232879
485 Ga0157372_10361420
486 Ga0157375_10043367
487 Ga0157380_10004278
488 Ga0157380_10626003
489 Ga0157377_10005678
490 Ga0157379_10018749
491 Ga0157379_10091436
492 Ga0157376_10089840
493 Ga0224712_10202244
494 Ga0228598_1024831
495 Ga0207697_10014978
496 Ga0207642_10052094
497 Ga0207699_10211107
498 Ga0207699_10361442
499 Ga0207645_10005353
500 Ga0207684_10150994
501 Ga0207684_10309851
502 Ga0207693_10005994
503 Ga0207693_10089327
504 Ga0207662_10012095
505 Ga0207657_10036539
506 Ga0207681_10056114
507 Ga0207659_10029871
508 Ga0207659_10094035
509 Ga0207687_10145964
510 Ga0207700_10000003
511 Ga0207700_10110845
512 Ga0207700_10378888
513 Ga0207664_10565849
514 Ga0207690_10398494
515 Ga0207706_10001219
516 Ga0207706_10293482
517 Ga0207686_10037851
518 Ga0207670_10192683
519 Ga0207669_10110918
520 Ga0207669_10223371
521 Ga0207704_10022765
522 Ga0207665_10359857
523 Ga0207691_10003471
524 Ga0207711_10169327
525 Ga0207689_10001849
526 Ga0207661_10691790
527 Ga0207679_11021280
528 Ga0207651_10028043
529 Ga0207712_10050659
530 Ga0207712_10166474
531 Ga0207668_10031047
532 Ga0207640_10253654
533 Ga0207640_10920269
534 Ga0207658_10017570
535 Ga0207658_10109098
536 Ga0207677_10015178
537 Ga0207677_10018140
538 Ga0207703_10000042
539 Ga0207703_10095042
540 Ga0207639_10424163
541 Ga0207678_10013290
542 Ga0207708_10009419
543 Ga0207641_10278380
544 Ga0207641_10602569
545 Ga0207648_10001238
546 Ga0207648_10042111
547 Ga0207674_10010317
548 Ga0207675_100000596
549 Ga0209971_1020931
550 Ga0207428_10107374
551 Ga0268266_10000526
552 Ga0268265_10003751
553 Ga0268265_10024588
554 Ga0268264_10444273
555 Ga0307511_10112146
556 Ga0307408_100001946
557 Ga0307406_10019762
558 Ga0307416_100068213
559 Ga0316593_10105071
560 Ga0316592_1075990
561 Ga0316588_1058359
562 Ga0316587_1026545
563 Ga0316596_1054442
564 Ga0373934_0006370
565 Ga0373924_0057867
566 Ga0373933_0191209
567 Ga0395900_0004800
568 Ga0395900_0052427
569 Ga0395900_0261798
570 Ga0395898_0002434
571 Ga0395898_0019727
572 Ga0395898_0032689
573 Ga0395898_0146249
574 Ga0395905_0439874
575 Ga0395905_0485224
576 Ga0436364_0436242
577 Ga0436364_1526230
578 Ga0395901_0211227
579 Ga0436365_1549520
580 Ga0439448_0165576
581 Ga0466961_0007756
582 Ga0466964_0009838
583 Ga0466964_0049307
584 Ga0466964_0065880
585 Ga0466971_0022406
586 Ga0466971_0055589
587 Ga0466971_0444490
588 Ga0466957_0029481
589 Ga0466957_0095779
590 Ga0466959_0123437
591 Ga0451576_0638660
592 Ga0466958_0048807
593 Ga0466958_0052382
594 Ga0466967_0013755
595 Ga0466967_0024846
596 Ga0466967_0090031
597 Ga0466967_0093425
598 Ga0466967_0099787
599 Ga0495592_0042603
600 Ga0495603_0236049
601 Ga0495651_0008118
602 Ga0495651_0037950
603 Ga0495653_0000499
604 Ga0495653_0054222
605 Ga0495653_0223550
606 Ga0495580_0209637
607 Ga0495639_0016382
608 Ga0495594_0035468
609 Ga0495608_0018229
610 Ga0495608_0035421
611 Ga0495618_0000030
612 Ga0495630_0000627
613 Ga0495666_0300099
614 Ga0495652_0031683
615 Ga0495652_0041321
616 Ga0495652_0075518
617 Ga0495640_0188257
618 Ga0495586_0000741
619 Ga0495587_0305572
620 Ga0495645_0000098
621 Ga0495645_0069852
622 Ga0495633_0148854
623 Ga0495667_0011363
624 Ga0495667_0042794
625 Ga0495635_0023113
626 Ga0495657_0000017
627 Ga0495657_0045353
628 Ga0495657_0142452
629 Ga0495599_0025522
630 Ga0495623_0030186
631 Ga0495646_0018651
632 Ga0495647_0000004
633 Ga0495600_0005717
634 Ga0495600_0337654
635 Ga0495604_0000102
636 Ga0495636_0000013
637 Ga0495672_0048250
638 Ga0495680_0005544
639 Ga0495680_0020971
640 Ga0495675_0027141
641 Ga0496100_0003555
642 Ga0496100_0023676
643 Ga0496101_0009836
644 Ga0496101_0274630
645 Ga0496102_0014504
646 Ga0496103_0196994
647 Ga0496104_0010416
648 Ga0496104_0187639
649 Ga0496104_0778464
650 Ga0496105_0004082
651 Ga0496106_0003714
652 Ga0496107_0018297
653 Ga0496107_0788579
654 Ga0496108_0000790
655 Ga0496108_0082480
656 Ga0496109_0000378
657 Ga0496109_0008690
658 Ga0496109_0273343
659 Ga0496110_0012465
660 Ga0496112_0000026
661 Ga0496112_0150665
662 Ga0496113_0025241
663 Ga0496113_0059587
664 Ga0496114_0017664
665 Ga0496114_0118055
666 Ga0496115_0000006
667 Ga0496115_0004844
668 Ga0496126_0020094
669 Ga0501310_032536
670 Ga0501039_0074307
671 Ga0501040_0041471
672 Ga0501040_0131581
673 Ga0501042_0072996
674 Ga0501068_0202477
675 Ga0501071_0131187
676 Ga0501075_0077608
677 Ga0501075_0211337
678 Ga0501076_0148338
679 Ga0501076_0177193
680 Ga0501079_0103187
681 Ga0501081_0104345
682 Ga0501083_0376128
683 Ga0501035_0145747
684 Ga0501045_0038099
685 nmdc:mga06z11_476921_c1
686 nmdc:mga05p37_31397_c1
687 nmdc:mga05p37_80840_c1
688 nmdc:mga05p37_91652_c1
689 nmdc:mga09592_330416_c1
690 nmdc:mga06r32_259152_c1
691 nmdc:mga08y16_242251_c1
692 nmdc:mga08y16_351453_c1
693 nmdc:mga08y16_536332_c1
694 nmdc:mga0n895_100318_c1
695 nmdc:mga0n895_97730_c1
696 nmdc:mga0rr50_797121_c1
697 nmdc:mga0a205_202031_c1
698 nmdc:mga0a205_6195_c1
699 nmdc:mga0a205_73384_c1
700 nmdc:mga0a205_75821_c1
701 Ga0495601_0003968
702 Ga0495601_0249481
703 Ga0495612_0000212
704 Ga0495595_0009652
705 Ga0495619_0000001
706 Ga0495619_0040623
707 Ga0501084_0086500
708 Ga0587083_0041378
709 Ga0501082_1007501
710 Ga0466962_0000962
711 Ga0466962_0015530
712 2513691485
713 2876809839
714 2879110645
715 8006964422
716 8006996187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

5

145

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

165

204

0.94

PF08534

Redoxin

Redoxin

4

160

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9684 3 219
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9637 3 219
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9615 3 219
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9528 3 216
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9521 3 219
ID Description Score Start End Superfamily
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.972 5 106 3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9448 5 106 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.8969 155 218 3.30.1020.10
3a2vB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.896 1 150 3.40.30.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.8946 155 216 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A168ED25-F1-model_v4 Peroxidase 0.9975 2 108 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9964 1 184 GO:0005829
GO:0045454
GO:0051920
AF-A0A3D2RYH4-F1-model_v4 Peroxidase 0.9934 28 161 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2R7L4R8-F1-model_v4 Peroxidase 0.9931 1 99 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3D3B2E6-F1-model_v4 Peroxidase 0.9917 1 134 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Map