F421123

General Info

Members Datasets Scaffolds Average Seq Length
358 171 716 324

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100261881|Ga0068862_1002618812
Length 372
Sequence LIPRRALTLCRDRGYCEGDDEXXDDASVGHRRILPIIAAMIRVMHVGLGPIGAMVARQIASRKGFRIVGAVDLDPRKVGRDLGDVIEAGRTLRVRVTDDIGRTIRATKPDVAVLCTSSSLKAVLPQFEEVLKRRVPIITTTEEAAYPAPRNRRLATRLDSAAKKAKVAVLGTGVNPGFTMDALPIALSAVCERVDRIEVRRVQDARIRRLPFQQKIGAGLTPEQFDRQVALGTVRHVGFTESIQMIGDAMGWTLDRIVDDVAPKIAEQAVASDLLAVKAGQVCGVIQNGVGYVKGVPLITLRLEAYLGAPESYDSVLIEGSPRIHSTIAGGVHGDIATASITVNSIPAVLNAPPGLRTMRDVRLPSFFSGRT

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
127 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
128 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
129 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 0.56
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 17.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100261881 3300005844 Unclassified 1579
2 Ga0065704_10003992 3300005289 Bacteria 4902
3 Ga0065712_10006719 3300005290 Bacteria 6631
4 Ga0065712_10071187 3300005290 Bacteria 5428
5 Ga0065715_10022693 3300005293 Bacteria 2518
6 Ga0065715_10118416 3300005293 Unclassified 2316
7 Ga0065715_10127460 3300005293 Bacteria 2087
8 Ga0065707_10001332 3300005295 Bacteria 10209
9 Ga0065707_10044567 3300005295 Bacteria 1556
10 Ga0065707_10157630 3300005295 Bacteria 1593
11 Ga0070683_100209177 3300005329 Bacteria 1853
12 Ga0070690_100052214 3300005330 Bacteria 2612
13 Ga0070677_10005274 3300005333 Bacteria 4254
14 Ga0070677_10045143 3300005333 Bacteria 1757
15 Ga0070680_100152563 3300005336 Bacteria 1940
16 Ga0070689_100006410 3300005340 Bacteria 8141
17 Ga0070689_100028433 3300005340 Unclassified 4226
18 Ga0070689_100192981 3300005340 Unclassified 1659
19 Ga0070687_100018843 3300005343 Bacteria 3201
20 Ga0070692_10027731 3300005345 Bacteria 2810
21 Ga0070692_10060655 3300005345 Bacteria 1992
22 Ga0070669_100011037 3300005353 Bacteria 6411
23 Ga0070669_100015970 3300005353 Bacteria 5357
24 Ga0070669_100164107 3300005353 Unclassified 1728
25 Ga0070675_100010452 3300005354 Bacteria 7251
26 Ga0070675_100036371 3300005354 Bacteria 4007
27 Ga0070675_100052516 3300005354 Bacteria 3351
28 Ga0070675_100230572 3300005354 Bacteria 1615
29 Ga0070671_100053094 3300005355 Bacteria 3369
30 Ga0070674_100002341 3300005356 Bacteria 10461
31 Ga0070674_100143376 3300005356 Bacteria 1795
32 Ga0070673_100011257 3300005364 Bacteria 6100
33 Ga0070673_100018284 3300005364 Bacteria 5002
34 Ga0070673_100139582 3300005364 Unclassified 2043
35 Ga0070673_100311131 3300005364 Unclassified 1389
36 Ga0070673_100367539 3300005364 Unclassified 1280
37 Ga0070688_100071230 3300005365 Bacteria 2225
38 Ga0070688_100140912 3300005365 Bacteria 1638
39 Ga0070701_10007879 3300005438 Bacteria 4580
40 Ga0070701_10023971 3300005438 Bacteria 2947
41 Ga0070701_10042088 3300005438 Bacteria 2330
42 Ga0070701_10060995 3300005438 Bacteria 1988
43 Ga0070705_100000892 3300005440 Bacteria 16654
44 Ga0070705_100070402 3300005440 Bacteria 2112
45 Ga0070705_100127565 3300005440 Bacteria 1654
46 Ga0070700_100001458 3300005441 Bacteria 11756
47 Ga0070700_100137033 3300005441 Bacteria 1659
48 Ga0070694_100000810 3300005444 Bacteria 17537
49 Ga0070694_100000976 3300005444 Bacteria 16231
50 Ga0070678_100118360 3300005456 Bacteria 2085
51 Ga0070678_100177422 3300005456 Unclassified 1741
52 Ga0070678_100183208 3300005456 Unclassified 1716
53 Ga0070678_100327471 3300005456 Bacteria 1310
54 Ga0070662_100006007 3300005457 Bacteria 7789
55 Ga0070662_100075299 3300005457 Bacteria 2499
56 Ga0070681_10009924 3300005458 Bacteria 9383
57 Ga0068867_100000222 3300005459 Bacteria 37537
58 Ga0070707_100065182 3300005468 Bacteria 3499
59 Ga0070707_100209724 3300005468 Bacteria 1899
60 Ga0070707_100386253 3300005468 Bacteria 1360
61 Ga0070698_100003090 3300005471 Bacteria 18346
62 Ga0070698_100020003 3300005471 Bacteria 7018
63 Ga0070699_100001619 3300005518 Bacteria 20514
64 Ga0070699_100005261 3300005518 Bacteria 11362
65 Ga0070699_100025315 3300005518 Bacteria 5117
66 Ga0070684_100411420 3300005535 Bacteria 1248
67 Ga0070672_100029505 3300005543 Bacteria 4114
68 Ga0070672_100057591 3300005543 Bacteria 3051
69 Ga0070672_100126511 3300005543 Unclassified 2096
70 Ga0070672_100402496 3300005543 Bacteria 1173
71 Ga0070686_100006878 3300005544 Bacteria 6334
72 Ga0070695_100000255 3300005545 Bacteria 26665
73 Ga0070696_100001147 3300005546 Bacteria 17178
74 Ga0070696_100029023 3300005546 Bacteria 3777
75 Ga0070696_100035567 3300005546 Bacteria 3430
76 Ga0070696_100068225 3300005546 Bacteria 2497
77 Ga0070704_100001231 3300005549 Bacteria 13483
78 Ga0070704_100015486 3300005549 Bacteria 4791
79 Ga0070704_100060586 3300005549 Bacteria 2704
80 Ga0070704_100155774 3300005549 Unclassified 1801
81 Ga0070704_100470210 3300005549 Bacteria 1086
82 Ga0070664_100046824 3300005564 Bacteria 3654
83 Ga0070664_100060069 3300005564 Bacteria 3236
84 Ga0070664_100235094 3300005564 Bacteria 1644
85 Ga0068857_100058945 3300005577 Bacteria 3410
86 Ga0068854_100190915 3300005578 Unclassified 1605
87 Ga0068854_100238828 3300005578 Bacteria 1446
88 Ga0068859_100003008 3300005617 Bacteria 17092
89 Ga0068859_100010279 3300005617 Bacteria 9419
90 Ga0068859_100227650 3300005617 Bacteria 1952
91 Ga0068859_100232909 3300005617 Bacteria 1930
92 Ga0068864_100324554 3300005618 Bacteria 1446
93 Ga0068866_10054381 3300005718 Unclassified 2051
94 Ga0068861_100003182 3300005719 Bacteria 10862
95 Ga0068861_100027469 3300005719 Bacteria 4145
96 Ga0068861_100064611 3300005719 Bacteria 2816
97 Ga0068870_10001576 3300005840 Bacteria 9273
98 Ga0068870_10034168 3300005840 Unclassified 2601
99 Ga0068870_10083954 3300005840 Bacteria 1767
100 Ga0068870_10156423 3300005840 Bacteria 1348
101 Ga0068858_100013977 3300005842 Bacteria 7574
102 Ga0068860_100008618 3300005843 Bacteria 10163
103 Ga0068860_100252799 3300005843 Unclassified 1717
104 Ga0068862_100000940 3300005844 Bacteria 28075
105 Ga0068862_100135020 3300005844 Bacteria 2186
106 Ga0081539_10051154 3300005985 Bacteria 2331
107 Ga0075432_10065601 3300006058 Bacteria 1298
108 Ga0097621_100068239 3300006237 Unclassified 2932
109 Ga0075370_10029292 3300006353 Unclassified 3066
110 Ga0068871_100060517 3300006358 Bacteria 3090
111 Ga0075428_100001853 3300006844 Bacteria 22653
112 Ga0075428_100007075 3300006844 Bacteria 12432
113 Ga0075428_100007779 3300006844 Bacteria 11877
114 Ga0075428_100036676 3300006844 Bacteria 5399
115 Ga0075428_100059067 3300006844 Bacteria 4200
116 Ga0075428_100189188 3300006844 Bacteria 2226
117 Ga0075430_100003865 3300006846 Bacteria 12616
118 Ga0075430_100056950 3300006846 Bacteria 3287
119 Ga0075430_100213696 3300006846 Bacteria 1600
120 Ga0075431_100000010 3300006847 Bacteria 96359
121 Ga0075431_100011059 3300006847 Bacteria 9082
122 Ga0075431_100057873 3300006847 Bacteria 3998
123 Ga0075431_100060848 3300006847 Bacteria 3897
124 Ga0075431_100154514 3300006847 Bacteria 2361
125 Ga0075431_100176371 3300006847 Bacteria 2195
126 Ga0075431_100233559 3300006847 Bacteria 1873
127 Ga0075433_10004079 3300006852 Bacteria 11323
128 Ga0075433_10131007 3300006852 Bacteria 2228
129 Ga0075434_100003349 3300006871 Bacteria 14338
130 Ga0075434_100025219 3300006871 Bacteria 5818
131 Ga0075434_100031420 3300006871 Bacteria 5236
132 Ga0075429_100049557 3300006880 Bacteria 3652
133 Ga0075429_100269601 3300006880 Unclassified 1491
134 Ga0075429_100464513 3300006880 Bacteria 1109
135 Ga0068865_100077932 3300006881 Unclassified 2370
136 Ga0068865_100160593 3300006881 Unclassified 1714
137 Ga0097620_100003008 3300006931 Bacteria 17092
138 Ga0097620_100010279 3300006931 Bacteria 9419
139 Ga0097620_100227651 3300006931 Bacteria 1952
140 Ga0097620_100232899 3300006931 Bacteria 1930
141 Ga0075435_100005253 3300007076 Bacteria 9016
142 Ga0075435_100054550 3300007076 Unclassified 3226
143 Ga0075435_100131591 3300007076 Bacteria 2094
144 Ga0111539_10001470 3300009094 Bacteria 31495
145 Ga0111539_10003035 3300009094 Bacteria 22252
146 Ga0111539_10005669 3300009094 Bacteria 16153
147 Ga0111539_10030923 3300009094 Bacteria 6506
148 Ga0111539_10032086 3300009094 Bacteria 6380
149 Ga0111539_10038381 3300009094 Bacteria 5776
150 Ga0111539_10189966 3300009094 Bacteria 2397
151 Ga0105245_10220013 3300009098 Unclassified 1832
152 Ga0114129_10000047 3300009147 Bacteria 104957
153 Ga0114129_10006483 3300009147 Bacteria 16601
154 Ga0114129_10009989 3300009147 Bacteria 13527
155 Ga0114129_10021816 3300009147 Bacteria 9089
156 Ga0114129_10111556 3300009147 Bacteria 3773
157 Ga0114129_10116255 3300009147 Bacteria 3686
158 Ga0114129_10116804 3300009147 Bacteria 3676
159 Ga0114129_10138129 3300009147 Bacteria 3343
160 Ga0114129_10329858 3300009147 Bacteria 2026
161 Ga0105243_10034009 3300009148 Bacteria 3944
162 Ga0105243_10036399 3300009148 Bacteria 3821
163 Ga0105248_10421724 3300009177 Bacteria 1503
164 Ga0105249_10078223 3300009553 Bacteria 3069
165 Ga0157378_10051249 3300013297 Bacteria 3673
166 Ga0163162_10109133 3300013306 Bacteria 2864
167 Ga0157375_10001933 3300013308 Bacteria 17828
168 Ga0157375_10012700 3300013308 Bacteria 7477
169 Ga0157375_10736629 3300013308 Bacteria 1138
170 Ga0163163_10051937 3300014325 Bacteria 4043
171 Ga0163163_10366501 3300014325 Bacteria 1498
172 Ga0157380_10009704 3300014326 Bacteria 6906
173 Ga0157380_10026861 3300014326 Bacteria 4374
174 Ga0157380_10190451 3300014326 Unclassified 1810
175 Ga0157380_10323084 3300014326 Unclassified 1432
176 Ga0157377_10068312 3300014745 Bacteria 2048
177 Ga0157377_10070438 3300014745 Bacteria 2020
178 Ga0157376_10045028 3300014969 Bacteria 3630
179 Ga0157376_10339187 3300014969 Bacteria 1435
180 Ga0163161_10013457 3300017792 Bacteria 5694
181 Ga0207697_10000889 3300025315 Bacteria 16911
182 Ga0207697_10015761 3300025315 Bacteria 3119
183 Ga0207682_10003306 3300025893 Bacteria 7041
184 Ga0207682_10015545 3300025893 Bacteria 2963
185 Ga0207688_10010002 3300025901 Bacteria 5160
186 Ga0207645_10024700 3300025907 Unclassified 3892
187 Ga0207645_10058015 3300025907 Bacteria 2472
188 Ga0207645_10073515 3300025907 Bacteria 2188
189 Ga0207643_10005931 3300025908 Bacteria 6525
190 Ga0207643_10008721 3300025908 Bacteria 5439
191 Ga0207643_10153397 3300025908 Bacteria 1382
192 Ga0207707_10090559 3300025912 Bacteria 2673
193 Ga0207660_10158387 3300025917 Bacteria 1745
194 Ga0207662_10029548 3300025918 Unclassified 3176
195 Ga0207649_10015299 3300025920 Bacteria 4312
196 Ga0207646_10045922 3300025922 Bacteria 3919
197 Ga0207646_10117057 3300025922 Bacteria 2393
198 Ga0207646_10147291 3300025922 Bacteria 2122
199 Ga0207681_10006839 3300025923 Bacteria 6995
200 Ga0207681_10027117 3300025923 Bacteria 3701
201 Ga0207681_10056490 3300025923 Unclassified 2678
202 Ga0207650_10236225 3300025925 Unclassified 1476
203 Ga0207659_10007760 3300025926 Bacteria 6626
204 Ga0207659_10041160 3300025926 Bacteria 3235
205 Ga0207659_10061136 3300025926 Bacteria 2714
206 Ga0207659_10123145 3300025926 Unclassified 1990
207 Ga0207659_10215924 3300025926 Archaea 1539
208 Ga0207700_10009691 3300025928 Bacteria 6033
209 Ga0207644_10012061 3300025931 Bacteria 5732
210 Ga0207644_10027286 3300025931 Bacteria 3944
211 Ga0207644_10035128 3300025931 Bacteria 3511
212 Ga0207706_10015764 3300025933 Bacteria 6831
213 Ga0207706_10100717 3300025933 Bacteria 2541
214 Ga0207706_10127740 3300025933 Bacteria 2235
215 Ga0207669_10001872 3300025937 Bacteria 8921
216 Ga0207669_10122370 3300025937 Bacteria 1769
217 Ga0207704_10047663 3300025938 Bacteria 2563
218 Ga0207691_10014614 3300025940 Bacteria 7483
219 Ga0207691_10029242 3300025940 Bacteria 5154
220 Ga0207691_10029783 3300025940 Bacteria 5105
221 Ga0207691_10093468 3300025940 Bacteria 2693
222 Ga0207691_10169222 3300025940 Unclassified 1914
223 Ga0207691_10212777 3300025940 Unclassified 1679
224 Ga0207691_10312563 3300025940 Bacteria 1348
225 Ga0207689_10050070 3300025942 Bacteria 3445
226 Ga0207661_10423230 3300025944 Bacteria 1210
227 Ga0207679_10011598 3300025945 Bacteria 5718
228 Ga0207679_10054579 3300025945 Bacteria 2942
229 Ga0207679_10175372 3300025945 Unclassified 1769
230 Ga0207679_10362401 3300025945 Bacteria 1266
231 Ga0207651_10028802 3300025960 Bacteria 3509
232 Ga0207651_10265919 3300025960 Unclassified 1410
233 Ga0207712_10006959 3300025961 Bacteria 7135
234 Ga0207668_10035143 3300025972 Unclassified 3334
235 Ga0207640_10219689 3300025981 Bacteria 1454
236 Ga0207658_10171712 3300025986 Bacteria 1787
237 Ga0207677_10235412 3300026023 Unclassified 1478
238 Ga0207703_10013951 3300026035 Bacteria 6263
239 Ga0207678_10004145 3300026067 Bacteria 13027
240 Ga0207678_10241923 3300026067 Unclassified 1545
241 Ga0207708_10004358 3300026075 Bacteria 10433
242 Ga0207708_10089353 3300026075 Unclassified 2374
243 Ga0207648_10010701 3300026089 Bacteria 8670
244 Ga0207676_10344696 3300026095 Bacteria 1376
245 Ga0207674_10026213 3300026116 Bacteria 6199
246 Ga0207674_10189144 3300026116 Unclassified 2008
247 Ga0207675_100000990 3300026118 Bacteria 28136
248 Ga0207675_100021915 3300026118 Bacteria 5949
249 Ga0207675_100039196 3300026118 Bacteria 4422
250 Ga0207683_10079905 3300026121 Bacteria 2900
251 Ga0207683_10140146 3300026121 Unclassified 2178
252 Ga0207428_10000319 3300027907 Bacteria 62926
253 Ga0207428_10001672 3300027907 Bacteria 22959
254 Ga0207428_10009442 3300027907 Bacteria 8740
255 Ga0207428_10031794 3300027907 Bacteria 4349
256 Ga0268265_10000618 3300028380 Bacteria 35420
257 Ga0268265_10241643 3300028380 Bacteria 1594
258 Ga0268264_10021576 3300028381 Bacteria 5258
259 Ga0268264_10235292 3300028381 Unclassified 1694
260 Ga0307408_100027782 3300031548 Bacteria 3903
261 Ga0307408_100093998 3300031548 Unclassified 2269
262 Ga0307405_10050095 3300031731 Bacteria 2584
263 Ga0307413_10116347 3300031824 Unclassified 1801
264 Ga0307410_10008874 3300031852 Bacteria 5607
265 Ga0307410_10014132 3300031852 Bacteria 4684
266 Ga0307406_10255762 3300031901 Archaea 1322
267 Ga0307412_10009963 3300031911 Bacteria 5467
268 Ga0307412_10052806 3300031911 Bacteria 2693
269 Ga0307412_10058886 3300031911 Bacteria 2572
270 Ga0307412_10172512 3300031911 Unclassified 1618
271 Ga0307409_100004421 3300031995 Bacteria 7893
272 Ga0307409_100022084 3300031995 Bacteria 4379
273 Ga0307409_100156511 3300031995 Unclassified 1986
274 Ga0307416_100006345 3300032002 Bacteria 7394
275 Ga0307416_100045111 3300032002 Bacteria 3468
276 Ga0307416_100133394 3300032002 Unclassified 2241
277 Ga0307416_100346678 3300032002 Bacteria 1501
278 Ga0307414_10022711 3300032004 Unclassified 3964
279 Ga0307411_10004352 3300032005 Bacteria 6769
280 Ga0307411_10064437 3300032005 Bacteria 2454
281 Ga0307415_100000856 3300032126 Bacteria 13910
282 Ga0373931_0142990 3300035691 Bacteria 1388
283 Ga0373937_0084812 3300036401 Bacteria 2931
284 Ga0439450_026983 3300042008 Unclassified 1270
285 Ga0450894_000437 3300042131 Bacteria 7174
286 Ga0450908_011693 3300042184 Unclassified 1603
287 Ga0439444_0008014 3300042437 Bacteria 1638
288 Ga0439464_0022054 3300042439 Unclassified 1752
289 Ga0451576_0001276 3300045051 Bacteria 43940
290 Ga0451576_0448691 3300045051 Bacteria 1354
291 Ga0495584_0019898 3300046491 Bacteria 3410
292 Ga0495643_0005550 3300046522 Bacteria 8503
293 Ga0495642_0064189 3300046528 Unclassified 1527
294 Ga0495609_0040557 3300046538 Unclassified 2095
295 Ga0495621_0008571 3300046539 Bacteria 3073
296 Ga0495656_0070511 3300046615 Unclassified 1551
297 Ga0495656_0096308 3300046615 Bacteria 1362
298 Ga0495659_0002125 3300046664 Bacteria 6461
299 Ga0495659_0024365 3300046664 Bacteria 2064
300 Ga0495659_0047182 3300046664 Unclassified 1557
301 Ga0495669_0007377 3300046684 Bacteria 4609
302 Ga0495636_0002627 3300047318 Bacteria 6919
303 Ga0495685_023821 3300047447 Bacteria 2108
304 Ga0495684_0293748 3300047471 Bacteria 1169
305 Ga0496106_0115515 3300048909 Bacteria 2093
306 Ga0496110_0076316 3300048913 Bacteria 2980
307 Ga0501298_008648 3300049521 Bacteria 1716
308 Ga0501033_0098603 3300049570 Bacteria 2134
309 Ga0501040_0028441 3300049576 Unclassified 3769
310 Ga0501041_0042704 3300049577 Bacteria 2756
311 Ga0501042_0097362 3300049578 Bacteria 2114
312 Ga0501046_0136574 3300049580 Bacteria 1857
313 Ga0501068_0130593 3300049584 Bacteria 1571
314 Ga0501073_0134591 3300049589 Bacteria 1713
315 Ga0501075_0032660 3300049591 Bacteria 3868
316 Ga0501079_0035116 3300049741 Bacteria 3858
317 Ga0501080_0041231 3300049742 Bacteria 4303
318 Ga0501081_0016267 3300049743 Unclassified 4916
319 nmdc:mga07m45_33162_c1 3300050496 Unclassified 2391
320 nmdc:mga05p37_129571_c1 3300050507 Bacteria 3096
321 nmdc:mga05p37_14678_c1 3300050507 Bacteria 9411
322 nmdc:mga05p37_151657_c1 3300050507 Bacteria 2834
323 nmdc:mga05p37_177999_c1 3300050507 Unclassified 2590
324 nmdc:mga05p37_236823_c1 3300050507 Bacteria 2197
325 nmdc:mga05p37_328790_c1 3300050507 Bacteria 1806
326 nmdc:mga05p37_39664_c1 3300050507 Bacteria 5782
327 nmdc:mga05p37_447_c1 3300050507 Bacteria 44801
328 nmdc:mga05p37_45919_c1 3300050507 Bacteria 5372
329 nmdc:mga09592_110133_c1 3300050508 Bacteria 2362
330 nmdc:mga09592_2504_c1 3300050508 Bacteria 14847
331 nmdc:mga0qj67_208634_c1 3300050509 Bacteria 1587
332 nmdc:mga0qj67_40980_c1 3300050509 Bacteria 3641
333 nmdc:mga0qj67_65637_c1 3300050509 Bacteria 2890
334 nmdc:mga0qj67_96158_c1 3300050509 Unclassified 2385
335 nmdc:mga06r32_307123_c1 3300050510 Unclassified 1572
336 nmdc:mga08y16_14778_c1 3300050511 Bacteria 8209
337 nmdc:mga08y16_28199_c1 3300050511 Bacteria 5919
338 nmdc:mga08y16_335335_c1 3300050511 Bacteria 1555
339 nmdc:mga08y16_34063_c1 3300050511 Bacteria 5350
340 nmdc:mga08y16_426_c1 3300050511 Bacteria 38831
341 nmdc:mga08y16_53023_c1 3300050511 Bacteria 4242
342 nmdc:mga08y16_6070_c1 3300050511 Bacteria 12667
343 nmdc:mga08y16_621895_c1 3300050511 Bacteria 1087
344 nmdc:mga0n895_16132_c1 3300050512 Bacteria 6844
345 nmdc:mga0n895_18396_c1 3300050512 Bacteria 6465
346 nmdc:mga0n895_355085_c1 3300050512 Bacteria 1485
347 nmdc:mga0n895_421073_c1 3300050512 Archaea 1350
348 nmdc:mga0n895_7417_c1 3300050512 Bacteria 9410
349 nmdc:mga0rr50_45484_c1 3300050513 Unclassified 3226
350 nmdc:mga0rr50_96766_c1 3300050513 Bacteria 2310
351 nmdc:mga0a205_29251_c1 3300050515 Bacteria 5273
352 nmdc:mga0a205_41793_c2 3300050515 Bacteria 3617
353 Ga0495595_0127530 3300053084 Bacteria 1242
354 Ga0590071_000006 3300059421 Bacteria 60899
355 Ga0590074_000967 3300059423 Bacteria 4511
356 Ga0590075_001145 3300059424 Bacteria 6729
357 Ga0590077_001514 3300059426 Bacteria 5389
358 Ga0530510_0047081 3300061734 Bacteria 3116
359 Ga0068862_100261881
360 Ga0065704_10003992
361 Ga0065712_10006719
362 Ga0065712_10071187
363 Ga0065715_10022693
364 Ga0065715_10118416
365 Ga0065715_10127460
366 Ga0065707_10001332
367 Ga0065707_10044567
368 Ga0065707_10157630
369 Ga0070683_100209177
370 Ga0070690_100052214
371 Ga0070677_10005274
372 Ga0070677_10045143
373 Ga0070680_100152563
374 Ga0070689_100006410
375 Ga0070689_100028433
376 Ga0070689_100192981
377 Ga0070687_100018843
378 Ga0070692_10027731
379 Ga0070692_10060655
380 Ga0070669_100011037
381 Ga0070669_100015970
382 Ga0070669_100164107
383 Ga0070675_100010452
384 Ga0070675_100036371
385 Ga0070675_100052516
386 Ga0070675_100230572
387 Ga0070671_100053094
388 Ga0070674_100002341
389 Ga0070674_100143376
390 Ga0070673_100011257
391 Ga0070673_100018284
392 Ga0070673_100139582
393 Ga0070673_100311131
394 Ga0070673_100367539
395 Ga0070688_100071230
396 Ga0070688_100140912
397 Ga0070701_10007879
398 Ga0070701_10023971
399 Ga0070701_10042088
400 Ga0070701_10060995
401 Ga0070705_100000892
402 Ga0070705_100070402
403 Ga0070705_100127565
404 Ga0070700_100001458
405 Ga0070700_100137033
406 Ga0070694_100000810
407 Ga0070694_100000976
408 Ga0070678_100118360
409 Ga0070678_100177422
410 Ga0070678_100183208
411 Ga0070678_100327471
412 Ga0070662_100006007
413 Ga0070662_100075299
414 Ga0070681_10009924
415 Ga0068867_100000222
416 Ga0070707_100065182
417 Ga0070707_100209724
418 Ga0070707_100386253
419 Ga0070698_100003090
420 Ga0070698_100020003
421 Ga0070699_100001619
422 Ga0070699_100005261
423 Ga0070699_100025315
424 Ga0070684_100411420
425 Ga0070672_100029505
426 Ga0070672_100057591
427 Ga0070672_100126511
428 Ga0070672_100402496
429 Ga0070686_100006878
430 Ga0070695_100000255
431 Ga0070696_100001147
432 Ga0070696_100029023
433 Ga0070696_100035567
434 Ga0070696_100068225
435 Ga0070704_100001231
436 Ga0070704_100015486
437 Ga0070704_100060586
438 Ga0070704_100155774
439 Ga0070704_100470210
440 Ga0070664_100046824
441 Ga0070664_100060069
442 Ga0070664_100235094
443 Ga0068857_100058945
444 Ga0068854_100190915
445 Ga0068854_100238828
446 Ga0068859_100003008
447 Ga0068859_100010279
448 Ga0068859_100227650
449 Ga0068859_100232909
450 Ga0068864_100324554
451 Ga0068866_10054381
452 Ga0068861_100003182
453 Ga0068861_100027469
454 Ga0068861_100064611
455 Ga0068870_10001576
456 Ga0068870_10034168
457 Ga0068870_10083954
458 Ga0068870_10156423
459 Ga0068858_100013977
460 Ga0068860_100008618
461 Ga0068860_100252799
462 Ga0068862_100000940
463 Ga0068862_100135020
464 Ga0081539_10051154
465 Ga0075432_10065601
466 Ga0097621_100068239
467 Ga0075370_10029292
468 Ga0068871_100060517
469 Ga0075428_100001853
470 Ga0075428_100007075
471 Ga0075428_100007779
472 Ga0075428_100036676
473 Ga0075428_100059067
474 Ga0075428_100189188
475 Ga0075430_100003865
476 Ga0075430_100056950
477 Ga0075430_100213696
478 Ga0075431_100000010
479 Ga0075431_100011059
480 Ga0075431_100057873
481 Ga0075431_100060848
482 Ga0075431_100154514
483 Ga0075431_100176371
484 Ga0075431_100233559
485 Ga0075433_10004079
486 Ga0075433_10131007
487 Ga0075434_100003349
488 Ga0075434_100025219
489 Ga0075434_100031420
490 Ga0075429_100049557
491 Ga0075429_100269601
492 Ga0075429_100464513
493 Ga0068865_100077932
494 Ga0068865_100160593
495 Ga0097620_100003008
496 Ga0097620_100010279
497 Ga0097620_100227651
498 Ga0097620_100232899
499 Ga0075435_100005253
500 Ga0075435_100054550
501 Ga0075435_100131591
502 Ga0111539_10001470
503 Ga0111539_10003035
504 Ga0111539_10005669
505 Ga0111539_10030923
506 Ga0111539_10032086
507 Ga0111539_10038381
508 Ga0111539_10189966
509 Ga0105245_10220013
510 Ga0114129_10000047
511 Ga0114129_10006483
512 Ga0114129_10009989
513 Ga0114129_10021816
514 Ga0114129_10111556
515 Ga0114129_10116255
516 Ga0114129_10116804
517 Ga0114129_10138129
518 Ga0114129_10329858
519 Ga0105243_10034009
520 Ga0105243_10036399
521 Ga0105248_10421724
522 Ga0105249_10078223
523 Ga0157378_10051249
524 Ga0163162_10109133
525 Ga0157375_10001933
526 Ga0157375_10012700
527 Ga0157375_10736629
528 Ga0163163_10051937
529 Ga0163163_10366501
530 Ga0157380_10009704
531 Ga0157380_10026861
532 Ga0157380_10190451
533 Ga0157380_10323084
534 Ga0157377_10068312
535 Ga0157377_10070438
536 Ga0157376_10045028
537 Ga0157376_10339187
538 Ga0163161_10013457
539 Ga0207697_10000889
540 Ga0207697_10015761
541 Ga0207682_10003306
542 Ga0207682_10015545
543 Ga0207688_10010002
544 Ga0207645_10024700
545 Ga0207645_10058015
546 Ga0207645_10073515
547 Ga0207643_10005931
548 Ga0207643_10008721
549 Ga0207643_10153397
550 Ga0207707_10090559
551 Ga0207660_10158387
552 Ga0207662_10029548
553 Ga0207649_10015299
554 Ga0207646_10045922
555 Ga0207646_10117057
556 Ga0207646_10147291
557 Ga0207681_10006839
558 Ga0207681_10027117
559 Ga0207681_10056490
560 Ga0207650_10236225
561 Ga0207659_10007760
562 Ga0207659_10041160
563 Ga0207659_10061136
564 Ga0207659_10123145
565 Ga0207659_10215924
566 Ga0207700_10009691
567 Ga0207644_10012061
568 Ga0207644_10027286
569 Ga0207644_10035128
570 Ga0207706_10015764
571 Ga0207706_10100717
572 Ga0207706_10127740
573 Ga0207669_10001872
574 Ga0207669_10122370
575 Ga0207704_10047663
576 Ga0207691_10014614
577 Ga0207691_10029242
578 Ga0207691_10029783
579 Ga0207691_10093468
580 Ga0207691_10169222
581 Ga0207691_10212777
582 Ga0207691_10312563
583 Ga0207689_10050070
584 Ga0207661_10423230
585 Ga0207679_10011598
586 Ga0207679_10054579
587 Ga0207679_10175372
588 Ga0207679_10362401
589 Ga0207651_10028802
590 Ga0207651_10265919
591 Ga0207712_10006959
592 Ga0207668_10035143
593 Ga0207640_10219689
594 Ga0207658_10171712
595 Ga0207677_10235412
596 Ga0207703_10013951
597 Ga0207678_10004145
598 Ga0207678_10241923
599 Ga0207708_10004358
600 Ga0207708_10089353
601 Ga0207648_10010701
602 Ga0207676_10344696
603 Ga0207674_10026213
604 Ga0207674_10189144
605 Ga0207675_100000990
606 Ga0207675_100021915
607 Ga0207675_100039196
608 Ga0207683_10079905
609 Ga0207683_10140146
610 Ga0207428_10000319
611 Ga0207428_10001672
612 Ga0207428_10009442
613 Ga0207428_10031794
614 Ga0268265_10000618
615 Ga0268265_10241643
616 Ga0268264_10021576
617 Ga0268264_10235292
618 Ga0307408_100027782
619 Ga0307408_100093998
620 Ga0307405_10050095
621 Ga0307413_10116347
622 Ga0307410_10008874
623 Ga0307410_10014132
624 Ga0307406_10255762
625 Ga0307412_10009963
626 Ga0307412_10052806
627 Ga0307412_10058886
628 Ga0307412_10172512
629 Ga0307409_100004421
630 Ga0307409_100022084
631 Ga0307409_100156511
632 Ga0307416_100006345
633 Ga0307416_100045111
634 Ga0307416_100133394
635 Ga0307416_100346678
636 Ga0307414_10022711
637 Ga0307411_10004352
638 Ga0307411_10064437
639 Ga0307415_100000856
640 Ga0373931_0142990
641 Ga0373937_0084812
642 Ga0439450_026983
643 Ga0450894_000437
644 Ga0450908_011693
645 Ga0439444_0008014
646 Ga0439464_0022054
647 Ga0451576_0001276
648 Ga0451576_0448691
649 Ga0495584_0019898
650 Ga0495643_0005550
651 Ga0495642_0064189
652 Ga0495609_0040557
653 Ga0495621_0008571
654 Ga0495656_0070511
655 Ga0495656_0096308
656 Ga0495659_0002125
657 Ga0495659_0024365
658 Ga0495659_0047182
659 Ga0495669_0007377
660 Ga0495636_0002627
661 Ga0495685_023821
662 Ga0495684_0293748
663 Ga0496106_0115515
664 Ga0496110_0076316
665 Ga0501298_008648
666 Ga0501033_0098603
667 Ga0501040_0028441
668 Ga0501041_0042704
669 Ga0501042_0097362
670 Ga0501046_0136574
671 Ga0501068_0130593
672 Ga0501073_0134591
673 Ga0501075_0032660
674 Ga0501079_0035116
675 Ga0501080_0041231
676 Ga0501081_0016267
677 nmdc:mga07m45_33162_c1
678 nmdc:mga05p37_129571_c1
679 nmdc:mga05p37_14678_c1
680 nmdc:mga05p37_151657_c1
681 nmdc:mga05p37_177999_c1
682 nmdc:mga05p37_236823_c1
683 nmdc:mga05p37_328790_c1
684 nmdc:mga05p37_39664_c1
685 nmdc:mga05p37_447_c1
686 nmdc:mga05p37_45919_c1
687 nmdc:mga09592_110133_c1
688 nmdc:mga09592_2504_c1
689 nmdc:mga0qj67_208634_c1
690 nmdc:mga0qj67_40980_c1
691 nmdc:mga0qj67_65637_c1
692 nmdc:mga0qj67_96158_c1
693 nmdc:mga06r32_307123_c1
694 nmdc:mga08y16_14778_c1
695 nmdc:mga08y16_28199_c1
696 nmdc:mga08y16_335335_c1
697 nmdc:mga08y16_34063_c1
698 nmdc:mga08y16_426_c1
699 nmdc:mga08y16_53023_c1
700 nmdc:mga08y16_6070_c1
701 nmdc:mga08y16_621895_c1
702 nmdc:mga0n895_16132_c1
703 nmdc:mga0n895_18396_c1
704 nmdc:mga0n895_355085_c1
705 nmdc:mga0n895_421073_c1
706 nmdc:mga0n895_7417_c1
707 nmdc:mga0rr50_45484_c1
708 nmdc:mga0rr50_96766_c1
709 nmdc:mga0a205_29251_c1
710 nmdc:mga0a205_41793_c2
711 Ga0495595_0127530
712 Ga0590071_000006
713 Ga0590074_000967
714 Ga0590075_001145
715 Ga0590077_001514
716 Ga0530510_0047081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19328

DAP_DH_C

2,4-diaminopentanoate dehydrogenase C-terminal domain

178

372

0.96

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

41

169

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g1m-assembly2.cif.gz_D amine dehydrogenase from petrotoga mobilis; open and closed form 0.8863 2 328
6g1h-assembly1.cif.gz_A-2 amine dehydrogenase from petrotoga mobilis; open form 0.8715 2 328
6g1m-assembly2.cif.gz_D amine dehydrogenase from petrotoga mobilis; open and closed form 0.8692 2 328
7xdu-assembly1.cif.gz_A ttheramdh-nad+ 0.8689 2 332
7xdu-assembly1.cif.gz_A ttheramdh-nad+ 0.8618 2 332
ID Description Score Start End Superfamily
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9214 1 102 3.40.50.720
af_Q10SL7_36_116_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9191 2 68 3.40.50.720
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8884 1 102 3.40.50.720
af_Q57865_1_131_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.873 2 134 3.40.50.720
3wg9A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8608 2 101 3.40.50.720
ID Description Score Start End GO Terms
AF-X1KYW0-F1-model_v4 Dihydrodipicolinate reductase N-terminal domain-containing protein 0.9916 1 83 GO:0008839
GO:0009089
AF-X1KWP2-F1-model_v4 2,4-diaminopentanoate dehydrogenase C-terminal domain-containing protein 0.9786 157 284
AF-A0A6B3I505-F1-model_v4 Dihydrodipicolinate reductase 0.9722 2 61 GO:0008839
GO:0009089
AF-A0A3D0D625-F1-model_v4 Dihydrodipicolinate reductase 0.9706 2 64 GO:0008839
GO:0009089
AF-A0A2S9FB84-F1-model_v4 Dihydrodipicolinate reductase 0.9674 4 61

Map