F421075

General Info

Members Datasets Scaffolds Average Seq Length
358 218 358 459

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100162686|Ga0070668_1001626861
Length 500
Sequence MRESDPPLPGGGADLGDHPERXXXTKSGTGPAGPETIGDLAIVLHSHMPYVEGFGTYPFGEEWLFDAVIRSYLPVLEVARDLTMTVTPVLADQLEDAGAAERLRRFLLEWRIGAAEADRDQVPEECRAACEGERARYGRALELLDAAGGDPLAPFQRAAAEGRVALATSSATHAVLPLLATRPGLRLQLQAGIRSHRRRFGWDGGFWLPECAYAPGLEWRLAEHGVRWFCIDQSAHAEPLEALAPVATEAGPVALPIDWEAISWLWSLDGYPSHPAHAQFAGKSLRGIRIWKVGGGAYEPAMAEAAARRQGEEFLAAXAARLRTYAERDNRRGLLVFAIDTELLGHWWSEGPIWLRTVLEGAEAAGVRLLTVPQALAEHEPVERPLRASTWGEEKNLHTWDSPAVADLAWGARRAELRLLRAVSGGLHGERLRRASRELLALQASDWAFLDQRKQAGDYAYQRATDHSRAMLEAIDCDRATDPCMRSLAPDLSTAPLLEP

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
119 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0
Rhizoplane 10.61
Rhizosphere 83.8
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000299 3300002074 Bacteria 5810
2 JGI24034J26672_10000180 3300002239 Bacteria 8646
3 Ga0070683_100000501 3300005329 Bacteria 27619
4 Ga0070683_100006767 3300005329 Bacteria 9633
5 Ga0070683_100032820 3300005329 Bacteria 4731
6 Ga0070683_100124685 3300005329 Bacteria 2434
7 Ga0070677_10000098 3300005333 Bacteria 28689
8 Ga0070682_100000013 3300005337 Bacteria 254641
9 Ga0068868_100000393 3300005338 Bacteria 29715
10 Ga0068868_100146132 3300005338 Bacteria 1944
11 Ga0070689_100105339 3300005340 Bacteria 2237
12 Ga0070691_10001700 3300005341 Bacteria 9535
13 Ga0070691_10002622 3300005341 Bacteria 8021
14 Ga0070661_100000599 3300005344 Bacteria 26985
15 Ga0070661_100066981 3300005344 Bacteria 2639
16 Ga0070692_10005508 3300005345 Bacteria 5407
17 Ga0070668_100019675 3300005347 Bacteria 5083
18 Ga0070668_100162686 3300005347 Bacteria 1812
19 Ga0070675_100000053 3300005354 Bacteria 70601
20 Ga0070675_100050731 3300005354 Bacteria 3408
21 Ga0070674_100000048 3300005356 Bacteria 52194
22 Ga0070673_100001851 3300005364 Bacteria 12652
23 Ga0070673_100014165 3300005364 Bacteria 5543
24 Ga0070688_100000012 3300005365 Bacteria 79406
25 Ga0070688_100000269 3300005365 Bacteria 26936
26 Ga0070688_100019738 3300005365 Bacteria 3908
27 Ga0070659_100018141 3300005366 Bacteria 5308
28 Ga0070659_100027670 3300005366 Bacteria 4370
29 Ga0070667_100001647 3300005367 Bacteria 19972
30 Ga0070713_100000009 3300005436 Bacteria 153056
31 Ga0070701_10080358 3300005438 Bacteria 1763
32 Ga0070711_100061589 3300005439 Bacteria 2613
33 Ga0070663_100022695 3300005455 Bacteria 4198
34 Ga0070678_100003896 3300005456 Bacteria 8388
35 Ga0070662_100000007 3300005457 Bacteria 168761
36 Ga0070685_10000018 3300005466 Bacteria 110132
37 Ga0070685_10000142 3300005466 Bacteria 46324
38 Ga0070679_100018917 3300005530 Bacteria 6689
39 Ga0070684_100006378 3300005535 Bacteria 9124
40 Ga0070684_100026690 3300005535 Bacteria 4867
41 Ga0068853_100016879 3300005539 Bacteria 6016
42 Ga0068853_100255091 3300005539 Bacteria 1611
43 Ga0070672_100045759 3300005543 Bacteria 3387
44 Ga0070686_100010837 3300005544 Bacteria 5157
45 Ga0070686_100015642 3300005544 Bacteria 4401
46 Ga0070693_100001370 3300005547 Bacteria 10977
47 Ga0070665_100000202 3300005548 Bacteria 104773
48 Ga0070665_100038403 3300005548 Bacteria 4813
49 Ga0070665_100049630 3300005548 Bacteria 4210
50 Ga0070704_100010732 3300005549 Bacteria 5580
51 Ga0068854_100000031 3300005578 Bacteria 107298
52 Ga0068854_100052928 3300005578 Bacteria 2913
53 Ga0068856_100002986 3300005614 Bacteria 17301
54 Ga0068856_100154095 3300005614 Bacteria 2308
55 Ga0068852_100000012 3300005616 Bacteria 140734
56 Ga0068852_100078648 3300005616 Bacteria 2918
57 Ga0068864_100000178 3300005618 Bacteria 58416
58 Ga0068866_10000224 3300005718 Bacteria 26642
59 Ga0068861_100030435 3300005719 Bacteria 3956
60 Ga0068851_10003555 3300005834 Bacteria 6940
61 Ga0068851_10027344 3300005834 Bacteria 2811
62 Ga0068851_10030393 3300005834 Bacteria 2679
63 Ga0068863_100000021 3300005841 Bacteria 198088
64 Ga0068863_100150730 3300005841 Bacteria 2225
65 Ga0068858_100000109 3300005842 Bacteria 86772
66 Ga0068858_100001590 3300005842 Bacteria 23153
67 Ga0068858_100067551 3300005842 Bacteria 3312
68 Ga0068862_100003153 3300005844 Bacteria 14325
69 Ga0081455_10008355 3300005937 Bacteria 10779
70 Ga0081455_10031697 3300005937 Bacteria 4776
71 Ga0081538_10000163 3300005981 Bacteria 70652
72 Ga0081540_1000006 3300005983 Bacteria 208724
73 Ga0081540_1004230 3300005983 Bacteria 11027
74 Ga0081539_10001003 3300005985 Bacteria 52435
75 Ga0075365_10000930 3300006038 Bacteria 12367
76 Ga0075365_10002862 3300006038 Bacteria 8671
77 Ga0075365_10004371 3300006038 Bacteria 7472
78 Ga0075365_10010138 3300006038 Bacteria 5469
79 Ga0075365_10011435 3300006038 Bacteria 5218
80 Ga0075364_10082727 3300006051 Bacteria 2124
81 Ga0075364_10086082 3300006051 Bacteria 2082
82 Ga0075364_10106623 3300006051 Bacteria 1867
83 Ga0070715_10000001 3300006163 Bacteria 693690
84 Ga0070712_100001362 3300006175 Bacteria 14813
85 Ga0070712_100024692 3300006175 Bacteria 3986
86 Ga0075431_100000548 3300006847 Bacteria 31565
87 Ga0075431_100014338 3300006847 Bacteria 8016
88 Ga0075433_10000030 3300006852 Bacteria 55877
89 Ga0075433_10011635 3300006852 Bacteria 7087
90 Ga0075433_10039941 3300006852 Bacteria 4060
91 Ga0075434_100045034 3300006871 Bacteria 4377
92 Ga0068865_100000301 3300006881 Bacteria 27213
93 Ga0068865_100029201 3300006881 Bacteria 3656
94 Ga0068865_100193591 3300006881 Bacteria 1574
95 Ga0111539_10009532 3300009094 Bacteria 12255
96 Ga0111539_10098797 3300009094 Bacteria 3428
97 Ga0105245_10000180 3300009098 Bacteria 59695
98 Ga0105245_10000832 3300009098 Bacteria 28099
99 Ga0105245_10011890 3300009098 Bacteria 7568
100 Ga0105245_10079366 3300009098 Bacteria 2997
101 Ga0105247_10000323 3300009101 Bacteria 42551
102 Ga0114129_10036474 3300009147 Bacteria 6941
103 Ga0105243_10007823 3300009148 Bacteria 8218
104 Ga0105243_10124394 3300009148 Bacteria 2179
105 Ga0105242_10000132 3300009176 Bacteria 54347
106 Ga0105242_10003600 3300009176 Bacteria 12051
107 Ga0105248_10000032 3300009177 Bacteria 201114
108 Ga0105248_10069540 3300009177 Bacteria 3953
109 Ga0105238_10000201 3300009551 Bacteria 66092
110 Ga0105249_10000074 3300009553 Bacteria 145235
111 Ga0105249_10010780 3300009553 Bacteria 8031
112 Ga0157370_10003066 3300013104 Bacteria 19809
113 Ga0157370_10048344 3300013104 Bacteria 4075
114 Ga0157369_10000142 3300013105 Bacteria 101760
115 Ga0157378_10033827 3300013297 Bacteria 4521
116 Ga0157378_10065638 3300013297 Bacteria 3249
117 Ga0157375_10004976 3300013308 Bacteria 11555
118 Ga0157380_10063566 3300014326 Bacteria 2960
119 Ga0157380_10156823 3300014326 Bacteria 1974
120 Ga0157377_10023216 3300014745 Bacteria 3285
121 Ga0157379_10004315 3300014968 Bacteria 12160
122 Ga0157379_10058052 3300014968 Bacteria 3459
123 Ga0157379_10138437 3300014968 Bacteria 2194
124 Ga0157376_10016893 3300014969 Bacteria 5552
125 Ga0163161_10000032 3300017792 Bacteria 165511
126 Ga0163161_10010179 3300017792 Bacteria 6510
127 Ga0207656_10000321 3300025321 Bacteria 16492
128 Ga0207682_10000182 3300025893 Bacteria 28392
129 Ga0207642_10000201 3300025899 Bacteria 17517
130 Ga0207710_10000549 3300025900 Bacteria 22590
131 Ga0207685_10000011 3300025905 Bacteria 213430
132 Ga0207695_10203611 3300025913 Bacteria 1892
133 Ga0207693_10007556 3300025915 Bacteria 8932
134 Ga0207693_10028320 3300025915 Bacteria 4426
135 Ga0207663_10000683 3300025916 Bacteria 15043
136 Ga0207649_10000076 3300025920 Bacteria 83824
137 Ga0207652_10012858 3300025921 Bacteria 6767
138 Ga0207694_10000004 3300025924 Bacteria 967075
139 Ga0207650_10097173 3300025925 Bacteria 2260
140 Ga0207659_10000010 3300025926 Bacteria 286639
141 Ga0207687_10000007 3300025927 Bacteria 604185
142 Ga0207687_10000018 3300025927 Bacteria 236159
143 Ga0207687_10002274 3300025927 Bacteria 13067
144 Ga0207687_10027230 3300025927 Bacteria 3834
145 Ga0207700_10000025 3300025928 Bacteria 147429
146 Ga0207690_10011339 3300025932 Bacteria 5328
147 Ga0207690_10058720 3300025932 Bacteria 2603
148 Ga0207706_10000018 3300025933 Bacteria 168729
149 Ga0207706_10007707 3300025933 Bacteria 9940
150 Ga0207686_10000289 3300025934 Bacteria 37190
151 Ga0207686_10000859 3300025934 Bacteria 18488
152 Ga0207709_10019226 3300025935 Bacteria 3836
153 Ga0207709_10077106 3300025935 Bacteria 2135
154 Ga0207670_10103954 3300025936 Bacteria 2033
155 Ga0207669_10000004 3300025937 Bacteria 196828
156 Ga0207704_10000720 3300025938 Bacteria 14555
157 Ga0207691_10049799 3300025940 Bacteria 3838
158 Ga0207711_10000020 3300025941 Bacteria 363325
159 Ga0207661_10000403 3300025944 Bacteria 27999
160 Ga0207661_10001894 3300025944 Bacteria 14344
161 Ga0207661_10004642 3300025944 Bacteria 9622
162 Ga0207661_10010508 3300025944 Bacteria 6666
163 Ga0207651_10019744 3300025960 Bacteria 4048
164 Ga0207712_10000007 3300025961 Bacteria 539589
165 Ga0207712_10036822 3300025961 Bacteria 3335
166 Ga0207668_10070605 3300025972 Bacteria 2491
167 Ga0207640_10000015 3300025981 Bacteria 215411
168 Ga0207640_10033569 3300025981 Bacteria 3195
169 Ga0207658_10001533 3300025986 Bacteria 17952
170 Ga0207677_10000400 3300026023 Bacteria 29863
171 Ga0207677_10020125 3300026023 Bacteria 4046
172 Ga0207703_10000040 3300026035 Bacteria 168191
173 Ga0207703_10001203 3300026035 Bacteria 24263
174 Ga0207703_10045075 3300026035 Bacteria 3546
175 Ga0207639_10090793 3300026041 Bacteria 2444
176 Ga0207678_10051530 3300026067 Bacteria 3553
177 Ga0207708_10021456 3300026075 Bacteria 4870
178 Ga0207708_10146584 3300026075 Bacteria 1855
179 Ga0207702_10000016 3300026078 Bacteria 226633
180 Ga0207702_10104856 3300026078 Bacteria 2503
181 Ga0207702_10129661 3300026078 Bacteria 2268
182 Ga0207641_10000094 3300026088 Bacteria 124545
183 Ga0207641_10112198 3300026088 Bacteria 2419
184 Ga0207676_10000016 3300026095 Bacteria 311561
185 Ga0207675_100050776 3300026118 Bacteria 3870
186 Ga0207683_10005039 3300026121 Bacteria 11343
187 Ga0207698_10000012 3300026142 Bacteria 260061
188 Ga0207428_10020111 3300027907 Bacteria 5679
189 Ga0268266_10000020 3300028379 Bacteria 527065
190 Ga0268266_10010633 3300028379 Bacteria 8017
191 Ga0268266_10012151 3300028379 Bacteria 7452
192 Ga0268265_10003291 3300028380 Bacteria 11710
193 Ga0268264_10200227 3300028381 Bacteria 1826
194 Ga0265337_1000002 3300028556 Bacteria 139247
195 Ga0265326_10000007 3300028558 Bacteria 223057
196 Ga0265319_1000025 3300028563 Bacteria 142639
197 Ga0265322_10000001 3300028654 Bacteria 543854
198 Ga0265336_10005097 3300028666 Bacteria 4887
199 Ga0265338_10000486 3300028800 Bacteria 70900
200 Ga0265324_10000368 3300029957 Bacteria 32654
201 Ga0265328_10029067 3300031239 Bacteria 2066
202 Ga0265320_10000002 3300031240 Bacteria 542875
203 Ga0265325_10020607 3300031241 Bacteria 3633
204 Ga0265339_10048443 3300031249 Bacteria 2330
205 Ga0265331_10001462 3300031250 Bacteria 17370
206 Ga0265327_10000011 3300031251 Bacteria 543807
207 Ga0307408_100193615 3300031548 Unclassified 1640
208 Ga0265314_10000058 3300031711 Bacteria 167476
209 Ga0307415_100034398 3300032126 Bacteria 3299
210 Ga0373937_0036065 3300036401 Bacteria 4505
211 Ga0316584_0109627 3300036712 Bacteria 2066
212 Ga0395900_0161886 3300037418 Bacteria 2282
213 Ga0395898_0044062 3300037466 Bacteria 4395
214 Ga0395898_0064166 3300037466 Bacteria 3562
215 Ga0395898_0164603 3300037466 Bacteria 2121
216 Ga0395905_0036989 3300037471 Bacteria 4585
217 Ga0395901_0019384 3300038443 Bacteria 6955
218 Ga0395901_0035620 3300038443 Bacteria 5143
219 Ga0395901_0280536 3300038443 Bacteria 1731
220 Ga0451853_2212221 3300041512 Bacteria 1948
221 Ga0466963_0000312 3300044694 Bacteria 21872
222 Ga0466957_0005251 3300044842 Bacteria 7252
223 Ga0466958_0043401 3300045836 Bacteria 2708
224 Ga0466967_0000033 3300045976 Bacteria 54859
225 Ga0495592_0001746 3300046454 Bacteria 15268
226 Ga0495603_0000943 3300046455 Bacteria 16721
227 Ga0495629_0002666 3300046459 Bacteria 13663
228 Ga0495629_0006408 3300046459 Bacteria 8724
229 Ga0495629_0007203 3300046459 Bacteria 8190
230 Ga0495641_0000003 3300046461 Bacteria 242879
231 Ga0495641_0006893 3300046461 Bacteria 7252
232 Ga0495641_0045749 3300046461 Bacteria 2014
233 Ga0495651_0151651 3300046462 Bacteria 1670
234 Ga0495582_0006962 3300046473 Bacteria 6289
235 Ga0495662_0000749 3300046476 Bacteria 15587
236 Ga0495662_0007722 3300046476 Bacteria 5297
237 Ga0495606_0000221 3300046507 Bacteria 101157
238 Ga0495608_0000031 3300046511 Bacteria 145255
239 Ga0495608_0001401 3300046511 Bacteria 17150
240 Ga0495608_0008515 3300046511 Bacteria 7186
241 Ga0495618_0000004 3300046514 Bacteria 245690
242 Ga0495620_0000246 3300046515 Bacteria 40444
243 Ga0495628_0000595 3300046516 Bacteria 33337
244 Ga0495628_0011721 3300046516 Bacteria 7403
245 Ga0495630_0000018 3300046517 Bacteria 186064
246 Ga0495644_0002924 3300046523 Bacteria 6785
247 Ga0495652_0000019 3300046529 Bacteria 190248
248 Ga0495640_0004574 3300046533 Bacteria 11028
249 Ga0495598_0001845 3300046537 Bacteria 4266
250 Ga0495621_0001660 3300046539 Bacteria 5832
251 Ga0495667_0000032 3300046559 Bacteria 143493
252 Ga0495656_0000122 3300046615 Bacteria 29816
253 Ga0495668_0043438 3300046616 Bacteria 2500
254 Ga0495625_0000122 3300046660 Bacteria 121146
255 Ga0495635_0000770 3300046663 Bacteria 20877
256 Ga0495588_0000376 3300046674 Bacteria 26068
257 Ga0495657_0000024 3300046675 Bacteria 145255
258 Ga0495599_0027842 3300046678 Bacteria 3540
259 Ga0495647_0000007 3300046681 Bacteria 103790
260 Ga0495647_0000228 3300046681 Bacteria 15271
261 Ga0495647_0005429 3300046681 Bacteria 4176
262 Ga0495647_0038195 3300046681 Bacteria 1815
263 Ga0495613_0000073 3300046689 Bacteria 98688
264 Ga0495613_0000152 3300046689 Bacteria 68384
265 Ga0495613_0043665 3300046689 Bacteria 3316
266 Ga0495624_0000009 3300046690 Bacteria 145026
267 Ga0495624_0000037 3300046690 Bacteria 83796
268 Ga0495624_0013989 3300046690 Bacteria 5461
269 Ga0495649_0004196 3300046694 Bacteria 9460
270 Ga0495600_0024194 3300046809 Bacteria 3908
271 Ga0495604_0000038 3300047317 Bacteria 123703
272 Ga0495604_0000073 3300047317 Bacteria 86844
273 Ga0495604_0005183 3300047317 Bacteria 10324
274 Ga0495676_0001150 3300047321 Bacteria 22493
275 Ga0495676_0027941 3300047321 Bacteria 4830
276 Ga0495680_0000061 3300047322 Bacteria 90676
277 Ga0495680_0001442 3300047322 Bacteria 25638
278 Ga0495680_0017757 3300047322 Bacteria 6058
279 Ga0495680_0038446 3300047322 Bacteria 3824
280 Ga0495675_0000090 3300047444 Bacteria 63705
281 Ga0495593_0033375 3300047673 Bacteria 2803
282 Ga0495602_0000021 3300048088 Bacteria 168585
283 Ga0495602_0001155 3300048088 Bacteria 25844
284 Ga0496102_0000146 3300048905 Bacteria 96361
285 Ga0496102_0074309 3300048905 Bacteria 3124
286 Ga0496103_0000043 3300048906 Bacteria 167983
287 Ga0496103_0004880 3300048906 Bacteria 8101
288 Ga0496104_0000004 3300048907 Bacteria 641830
289 Ga0496104_0000013 3300048907 Bacteria 397163
290 Ga0496105_0000001 3300048908 Bacteria 1328178
291 Ga0496105_0000006 3300048908 Bacteria 393578
292 Ga0496106_0000138 3300048909 Bacteria 54275
293 Ga0496106_0031558 3300048909 Bacteria 3949
294 Ga0496107_0004661 3300048910 Bacteria 9306
295 Ga0496107_0086934 3300048910 Bacteria 2282
296 Ga0496108_0000001 3300048911 Bacteria 919044
297 Ga0496108_0000107 3300048911 Bacteria 86395
298 Ga0496108_0000150 3300048911 Bacteria 67068
299 Ga0496108_0001941 3300048911 Bacteria 16566
300 Ga0496108_0005419 3300048911 Bacteria 10313
301 Ga0496108_0101117 3300048911 Bacteria 2459
302 Ga0496109_0000007 3300048912 Bacteria 247554
303 Ga0496109_0000028 3300048912 Bacteria 168138
304 Ga0496109_0000190 3300048912 Bacteria 61169
305 Ga0496109_0051510 3300048912 Bacteria 3750
306 Ga0496110_0000105 3300048913 Bacteria 45468
307 Ga0496110_0001693 3300048913 Bacteria 16200
308 Ga0496110_0007645 3300048913 Bacteria 8648
309 Ga0496110_0104270 3300048913 Bacteria 2544
310 Ga0496110_0196658 3300048913 Bacteria 1831
311 Ga0496110_0249601 3300048913 Bacteria 1615
312 Ga0496111_0000261 3300048914 Bacteria 25723
313 Ga0496111_0027521 3300048914 Bacteria 4022
314 Ga0496111_0043451 3300048914 Bacteria 3230
315 Ga0496112_0000003 3300048915 Bacteria 660147
316 Ga0496112_0000938 3300048915 Bacteria 21148
317 Ga0496113_0000007 3300048916 Bacteria 95884
318 Ga0496114_0000014 3300048917 Bacteria 297902
319 Ga0496114_0021444 3300048917 Bacteria 5258
320 Ga0496115_0000316 3300048918 Bacteria 41025
321 Ga0496115_0004682 3300048918 Bacteria 9913
322 Ga0496116_0000769 3300048919 Bacteria 40716
323 Ga0496119_0003085 3300048922 Bacteria 17574
324 Ga0496120_0003588 3300048923 Bacteria 13945
325 Ga0496121_0055767 3300048924 Bacteria 3289
326 Ga0496121_0058851 3300048924 Bacteria 3173
327 Ga0496126_0044882 3300048929 Bacteria 4067
328 Ga0501047_0116275 3300049581 Bacteria 2556
329 Ga0501047_0251841 3300049581 Bacteria 1614
330 Ga0501068_0129023 3300049584 Bacteria 1580
331 Ga0501069_0031259 3300049585 Bacteria 2926
332 Ga0501070_0202746 3300049586 Bacteria 1629
333 Ga0501074_0025353 3300049590 Bacteria 4306
334 Ga0501076_0125487 3300049592 Bacteria 2080
335 Ga0501044_0118120 3300049823 Bacteria 2655
336 nmdc:mga0yw44_10448_c1 3300050492 Bacteria 4744
337 nmdc:mga0yw44_51993_c1 3300050492 Bacteria 2483
338 nmdc:mga0yw44_9715_c1 3300050492 Bacteria 4883
339 nmdc:mga05p37_109407_c1 3300050507 Bacteria 2320
340 nmdc:mga06r32_19827_c1 3300050510 Bacteria 6179
341 nmdc:mga06r32_2035_c1 3300050510 Bacteria 18077
342 nmdc:mga08y16_15591_c1 3300050511 Bacteria 7991
343 nmdc:mga08y16_51884_c1 3300050511 Bacteria 4291
344 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
345 nmdc:mga0a205_3884_c1 3300050515 Bacteria 13377
346 Ga0495601_0000039 3300053077 Bacteria 79594
347 Ga0495601_0000126 3300053077 Bacteria 42871
348 Ga0495655_0000001 3300053083 Bacteria 419518
349 Ga0495595_0000014 3300053084 Bacteria 145255
350 Ga0495595_0000151 3300053084 Bacteria 27542
351 Ga0495595_0052150 3300053084 Bacteria 1897
352 Ga0495619_0000021 3300053085 Bacteria 187095
353 Ga0495619_0000114 3300053085 Bacteria 59624
354 Ga0495619_0000243 3300053085 Bacteria 39638
355 Ga0495619_0002645 3300053085 Bacteria 11706
356 Ga0495619_0005724 3300053085 Bacteria 7881
357 Ga0500614_000984 3300053123 Bacteria 7071
358 Ga0500628_000017 3300053129 Bacteria 90481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10146584 Ga0207708_101465842 369
2 3300046681 Ga0495647_0000007 Ga0495647_0000007_43685_45103 407
3 3300005530 Ga0070679_100018917 Ga0070679_1000189177 413
4 3300046507 Ga0495606_0000221 Ga0495606_0000221_94124_95485 413
5 3300048905 Ga0496102_0000146 Ga0496102_0000146_63335_64696 413
6 3300048906 Ga0496103_0000043 Ga0496103_0000043_42331_43692 413
7 3300048923 Ga0496120_0003588 Ga0496120_0003588_11521_12900 413
8 3300049586 Ga0501070_0202746 Ga0501070_0202746_164_1525 413
9 3300038443 Ga0395901_0280536 Ga0395901_0280536_354_1715 414
10 3300009176 Ga0105242_10000132 Ga0105242_100001328 415
11 3300037466 Ga0395898_0064166 Ga0395898_0064166_33_1484 419
12 3300037471 Ga0395905_0036989 Ga0395905_0036989_1399_2850 419
13 3300049584 Ga0501068_0129023 Ga0501068_0129023_116_1477 424
14 3300005457 Ga0070662_100000007 Ga0070662_100000007177 425
15 3300025933 Ga0207706_10000018 Ga0207706_100000189 425
16 3300049581 Ga0501047_0251841 Ga0501047_0251841_93_1511 425
17 3300005547 Ga0070693_100001370 Ga0070693_1000013707 426
18 3300045976 Ga0466967_0000033 Ga0466967_0000033_33607_34968 428
19 3300047322 Ga0495680_0000061 Ga0495680_0000061_30973_32385 430
20 3300005340 Ga0070689_100105339 Ga0070689_1001053391 431
21 3300013308 Ga0157375_10004976 Ga0157375_100049767 431
22 3300025936 Ga0207670_10103954 Ga0207670_101039542 431
23 3300046511 Ga0495608_0001401 Ga0495608_0001401_10142_11503 431
24 3300046681 Ga0495647_0005429 Ga0495647_0005429_112_1473 431
25 3300046690 Ga0495624_0013989 Ga0495624_0013989_2845_4206 431
26 3300047317 Ga0495604_0000038 Ga0495604_0000038_117698_119059 431
27 3300005614 Ga0068856_100154095 Ga0068856_1001540952 432
28 3300025921 Ga0207652_10012858 Ga0207652_100128587 432
29 3300026078 Ga0207702_10129661 Ga0207702_101296612 432
30 3300005338 Ga0068868_100146132 Ga0068868_1001461322 433
31 3300005364 Ga0070673_100014165 Ga0070673_1000141656 433
32 3300005544 Ga0070686_100015642 Ga0070686_1000156423 433
33 3300005549 Ga0070704_100010732 Ga0070704_1000107326 433
34 3300014326 Ga0157380_10156823 Ga0157380_101568232 433
35 3300025934 Ga0207686_10000289 Ga0207686_1000028938 433
36 3300046473 Ga0495582_0006962 Ga0495582_0006962_1495_2859 433
37 3300046476 Ga0495662_0007722 Ga0495662_0007722_892_2253 433
38 3300046523 Ga0495644_0002924 Ga0495644_0002924_2190_3551 433
39 3300046539 Ga0495621_0001660 Ga0495621_0001660_4365_5726 433
40 3300046674 Ga0495588_0000376 Ga0495588_0000376_2246_3607 433
41 3300046681 Ga0495647_0038195 Ga0495647_0038195_92_1456 433
42 3300047321 Ga0495676_0027941 Ga0495676_0027941_2343_3707 433
43 3300048906 Ga0496103_0004880 Ga0496103_0004880_2703_4067 433
44 3300048910 Ga0496107_0004661 Ga0496107_0004661_4238_5602 433
45 3300048911 Ga0496108_0005419 Ga0496108_0005419_4836_6197 433
46 3300048911 Ga0496108_0101117 Ga0496108_0101117_478_1842 433
47 3300048913 Ga0496110_0196658 Ga0496110_0196658_436_1800 433
48 3300048914 Ga0496111_0027521 Ga0496111_0027521_490_1854 433
49 3300048915 Ga0496112_0000938 Ga0496112_0000938_15872_17233 433
50 3300048916 Ga0496113_0000007 Ga0496113_0000007_27654_29015 433
51 3300048919 Ga0496116_0000769 Ga0496116_0000769_37033_38394 433
52 3300048922 Ga0496119_0003085 Ga0496119_0003085_2164_3525 433
53 3300048924 Ga0496121_0055767 Ga0496121_0055767_1319_2683 433
54 3300048924 Ga0496121_0058851 Ga0496121_0058851_1764_3125 433
55 3300048929 Ga0496126_0044882 Ga0496126_0044882_1950_3311 433
56 3300049581 Ga0501047_0116275 Ga0501047_0116275_1131_2492 433
57 3300049585 Ga0501069_0031259 Ga0501069_0031259_1394_2755 433
58 3300049590 Ga0501074_0025353 Ga0501074_0025353_1662_3023 433
59 3300049823 Ga0501044_0118120 Ga0501044_0118120_301_1662 433
60 3300053084 Ga0495595_0000151 Ga0495595_0000151_6319_7680 433
61 3300005341 Ga0070691_10001700 Ga0070691_100017009 434
62 3300013104 Ga0157370_10003066 Ga0157370_1000306618 434
63 3300046615 Ga0495656_0000122 Ga0495656_0000122_20459_21823 434
64 3300048911 Ga0496108_0000107 Ga0496108_0000107_49427_50791 434
65 3300048912 Ga0496109_0000190 Ga0496109_0000190_10452_11816 434
66 3300053085 Ga0495619_0000021 Ga0495619_0000021_54179_55543 434
67 3300009101 Ga0105247_10000323 Ga0105247_1000032329 437
68 3300025900 Ga0207710_10000549 Ga0207710_1000054922 437
69 3300036712 Ga0316584_0109627 Ga0316584_0109627_342_1805 437
70 3300053083 Ga0495655_0000001 Ga0495655_0000001_28479_29900 437
71 3300053129 Ga0500628_000017 Ga0500628_000017_67367_68788 437
72 3300005981 Ga0081538_10000163 Ga0081538_1000016343 438
73 3300053077 Ga0495601_0000126 Ga0495601_0000126_24816_26228 438
74 3300005616 Ga0068852_100000012 Ga0068852_10000001258 440
75 3300025913 Ga0207695_10203611 Ga0207695_102036112 440
76 3300026142 Ga0207698_10000012 Ga0207698_10000012178 440
77 3300046459 Ga0495629_0006408 Ga0495629_0006408_6879_8288 440
78 3300047317 Ga0495604_0005183 Ga0495604_0005183_591_2006 440
79 3300048088 Ga0495602_0000021 Ga0495602_0000021_50171_51586 440
80 3300053084 Ga0495595_0052150 Ga0495595_0052150_314_1729 440
81 3300005329 Ga0070683_100124685 Ga0070683_1001246852 441
82 3300006881 Ga0068865_100000301 Ga0068865_10000030126 441
83 3300009177 Ga0105248_10000032 Ga0105248_10000032193 441
84 3300013297 Ga0157378_10065638 Ga0157378_100656383 441
85 3300025938 Ga0207704_10000720 Ga0207704_1000072011 441
86 3300025941 Ga0207711_10000020 Ga0207711_10000020181 441
87 3300025944 Ga0207661_10000403 Ga0207661_100004032 441
88 3300028563 Ga0265319_1000025 Ga0265319_1000025150 441
89 3300028800 Ga0265338_10000486 Ga0265338_100004863 441
90 3300031241 Ga0265325_10020607 Ga0265325_100206073 441
91 3300046516 Ga0495628_0000595 Ga0495628_0000595_21945_23354 441
92 3300046681 Ga0495647_0000228 Ga0495647_0000228_7227_8612 441
93 3300048088 Ga0495602_0001155 Ga0495602_0001155_5833_7242 441
94 3300048911 Ga0496108_0000150 Ga0496108_0000150_22640_24055 441
95 3300048912 Ga0496109_0000007 Ga0496109_0000007_203317_204732 441
96 3300005329 Ga0070683_100000501 Ga0070683_1000005019 442
97 3300005341 Ga0070691_10002622 Ga0070691_100026226 442
98 3300005535 Ga0070684_100026690 Ga0070684_1000266902 442
99 3300005548 Ga0070665_100000202 Ga0070665_10000020222 442
100 3300005548 Ga0070665_100049630 Ga0070665_1000496303 442
101 3300005842 Ga0068858_100001590 Ga0068858_10000159023 442
102 3300006175 Ga0070712_100001362 Ga0070712_1000013623 442
103 3300006852 Ga0075433_10011635 Ga0075433_100116354 442
104 3300009098 Ga0105245_10000832 Ga0105245_100008329 442
105 3300025915 Ga0207693_10007556 Ga0207693_1000755610 442
106 3300025927 Ga0207687_10000018 Ga0207687_100000189 442
107 3300025944 Ga0207661_10001894 Ga0207661_1000189413 442
108 3300026035 Ga0207703_10001203 Ga0207703_1000120323 442
109 3300028379 Ga0268266_10000020 Ga0268266_10000020114 442
110 3300028379 Ga0268266_10012151 Ga0268266_100121517 442
111 3300046511 Ga0495608_0000031 Ga0495608_0000031_72909_74324 442
112 3300046675 Ga0495657_0000024 Ga0495657_0000024_72909_74324 442
113 3300047322 Ga0495680_0017757 Ga0495680_0017757_2620_4029 442
114 3300047444 Ga0495675_0000090 Ga0495675_0000090_32034_33449 442
115 3300048909 Ga0496106_0000138 Ga0496106_0000138_47395_48807 442
116 3300048910 Ga0496107_0086934 Ga0496107_0086934_363_1775 442
117 3300050515 nmdc:mga0a205_3884_c1 nmdc:mga0a205_3884_c1_3030_4454 442
118 3300053084 Ga0495595_0000014 Ga0495595_0000014_70932_72347 442
119 3300053085 Ga0495619_0000114 Ga0495619_0000114_39194_40609 442
120 3300005983 Ga0081540_1000006 Ga0081540_1000006141 443
121 3300046537 Ga0495598_0001845 Ga0495598_0001845_433_1842 443
122 3300005618 Ga0068864_100000178 Ga0068864_10000017824 444
123 3300006051 Ga0075364_10106623 Ga0075364_101066231 444
124 3300009098 Ga0105245_10000180 Ga0105245_1000018049 444
125 3300013105 Ga0157369_10000142 Ga0157369_1000014261 444
126 3300025927 Ga0207687_10000007 Ga0207687_10000007192 444
127 3300025927 Ga0207687_10002274 Ga0207687_100022745 444
128 3300026095 Ga0207676_10000016 Ga0207676_10000016185 444
129 3300031548 Ga0307408_100193615 Ga0307408_1001936152 444
130 3300006038 Ga0075365_10010138 Ga0075365_100101382 445
131 3300013104 Ga0157370_10048344 Ga0157370_100483442 445
132 3300032126 Ga0307415_100034398 Ga0307415_1000343982 445
133 3300050492 nmdc:mga0yw44_10448_c1 nmdc:mga0yw44_10448_c1_2935_4338 445
134 3300005338 Ga0068868_100000393 Ga0068868_1000003932 446
135 3300026023 Ga0207677_10000400 Ga0207677_100004002 446
136 3300049592 Ga0501076_0125487 Ga0501076_0125487_83_1489 446
137 3300006847 Ga0075431_100000548 Ga0075431_10000054824 447
138 3300006871 Ga0075434_100045034 Ga0075434_1000450344 447
139 3300009094 Ga0111539_10009532 Ga0111539_100095324 447
140 3300009147 Ga0114129_10036474 Ga0114129_100364742 447
141 3300017792 Ga0163161_10000032 Ga0163161_1000003253 447
142 3300027907 Ga0207428_10020111 Ga0207428_100201114 447
143 3300046454 Ga0495592_0001746 Ga0495592_0001746_6277_7695 447
144 3300046533 Ga0495640_0004574 Ga0495640_0004574_9535_10953 447
145 3300046663 Ga0495635_0000770 Ga0495635_0000770_6329_7741 447
146 3300047317 Ga0495604_0000073 Ga0495604_0000073_67848_69260 447
147 3300047322 Ga0495680_0001442 Ga0495680_0001442_24188_25606 447
148 3300048907 Ga0496104_0000004 Ga0496104_0000004_28827_30239 447
149 3300048908 Ga0496105_0000001 Ga0496105_0000001_611592_613004 447
150 3300048913 Ga0496110_0000105 Ga0496110_0000105_18464_19876 447
151 3300048914 Ga0496111_0000261 Ga0496111_0000261_13995_15407 447
152 3300050507 nmdc:mga05p37_109407_c1 nmdc:mga05p37_109407_c1_300_1742 447
153 3300050510 nmdc:mga06r32_2035_c1 nmdc:mga06r32_2035_c1_13155_14597 447
154 3300050511 nmdc:mga08y16_15591_c1 nmdc:mga08y16_15591_c1_3153_4595 447
155 3300006852 Ga0075433_10000030 Ga0075433_1000003029 448
156 3300028556 Ga0265337_1000002 Ga0265337_100000276 448
157 3300028558 Ga0265326_10000007 Ga0265326_10000007134 448
158 3300028654 Ga0265322_10000001 Ga0265322_10000001170 448
159 3300028666 Ga0265336_10005097 Ga0265336_100050973 448
160 3300029957 Ga0265324_10000368 Ga0265324_1000036818 448
161 3300031239 Ga0265328_10029067 Ga0265328_100290672 448
162 3300031240 Ga0265320_10000002 Ga0265320_10000002169 448
163 3300031249 Ga0265339_10048443 Ga0265339_100484432 448
164 3300031250 Ga0265331_10001462 Ga0265331_1000146216 448
165 3300031251 Ga0265327_10000011 Ga0265327_10000011169 448
166 3300031711 Ga0265314_10000058 Ga0265314_1000005876 448
167 3300044694 Ga0466963_0000312 Ga0466963_0000312_14549_15961 448
168 3300046461 Ga0495641_0045749 Ga0495641_0045749_509_1921 448
169 3300046462 Ga0495651_0151651 Ga0495651_0151651_254_1660 448
170 3300046476 Ga0495662_0000749 Ga0495662_0000749_6282_7694 448
171 3300046559 Ga0495667_0000032 Ga0495667_0000032_140216_141622 448
172 3300046690 Ga0495624_0000037 Ga0495624_0000037_20721_22133 448
173 3300047322 Ga0495680_0038446 Ga0495680_0038446_1401_2807 448
174 3300048915 Ga0496112_0000003 Ga0496112_0000003_195277_196689 448
175 3300048918 Ga0496115_0004682 Ga0496115_0004682_5976_7382 448
176 3300050515 nmdc:mga0a205_11_c1 nmdc:mga0a205_11_c1_89080_90489 448
177 3300005337 Ga0070682_100000013 Ga0070682_100000013232 449
178 3300005365 Ga0070688_100000269 Ga0070688_1000002696 449
179 3300005466 Ga0070685_10000018 Ga0070685_1000001854 449
180 3300005539 Ga0068853_100255091 Ga0068853_1002550911 449
181 3300005937 Ga0081455_10031697 Ga0081455_100316973 449
182 3300005983 Ga0081540_1004230 Ga0081540_10042304 449
183 3300006038 Ga0075365_10000930 Ga0075365_100009302 449
184 3300006038 Ga0075365_10011435 Ga0075365_100114352 449
185 3300006881 Ga0068865_100193591 Ga0068865_1001935912 449
186 3300013297 Ga0157378_10033827 Ga0157378_100338274 449
187 3300026041 Ga0207639_10090793 Ga0207639_100907931 449
188 3300037418 Ga0395900_0161886 Ga0395900_0161886_501_1913 449
189 3300037466 Ga0395898_0044062 Ga0395898_0044062_1865_3313 449
190 3300037466 Ga0395898_0164603 Ga0395898_0164603_56_1468 449
191 3300038443 Ga0395901_0019384 Ga0395901_0019384_161_1609 449
192 3300038443 Ga0395901_0035620 Ga0395901_0035620_1329_2741 449
193 3300041512 Ga0451853_2212221 Ga0451853_2212221_388_1800 449
194 3300046455 Ga0495603_0000943 Ga0495603_0000943_5844_7265 449
195 3300046459 Ga0495629_0007203 Ga0495629_0007203_5891_7306 449
196 3300046529 Ga0495652_0000019 Ga0495652_0000019_162404_163816 449
197 3300046689 Ga0495613_0000073 Ga0495613_0000073_74484_75899 449
198 3300046689 Ga0495613_0000152 Ga0495613_0000152_66917_68335 449
199 3300046809 Ga0495600_0024194 Ga0495600_0024194_520_1929 449
200 3300048912 Ga0496109_0000028 Ga0496109_0000028_88599_90044 449
201 3300048912 Ga0496109_0051510 Ga0496109_0051510_2134_3546 449
202 3300048913 Ga0496110_0001693 Ga0496110_0001693_6516_7925 449
203 3300048913 Ga0496110_0249601 Ga0496110_0249601_118_1530 449
204 3300048917 Ga0496114_0000014 Ga0496114_0000014_87777_89186 449
205 3300048918 Ga0496115_0000316 Ga0496115_0000316_2088_3497 449
206 3300050492 nmdc:mga0yw44_51993_c1 nmdc:mga0yw44_51993_c1_746_2170 449
207 3300053077 Ga0495601_0000039 Ga0495601_0000039_61612_63027 449
208 3300005329 Ga0070683_100006767 Ga0070683_1000067679 450
209 3300005333 Ga0070677_10000098 Ga0070677_100000988 450
210 3300005344 Ga0070661_100000599 Ga0070661_1000005992 450
211 3300005354 Ga0070675_100000053 Ga0070675_1000000535 450
212 3300005364 Ga0070673_100001851 Ga0070673_1000018515 450
213 3300005365 Ga0070688_100000012 Ga0070688_10000001244 450
214 3300005366 Ga0070659_100018141 Ga0070659_1000181414 450
215 3300005456 Ga0070678_100003896 Ga0070678_1000038967 450
216 3300005466 Ga0070685_10000142 Ga0070685_1000014215 450
217 3300005578 Ga0068854_100000031 Ga0068854_10000003120 450
218 3300005614 Ga0068856_100002986 Ga0068856_1000029865 450
219 3300005834 Ga0068851_10003555 Ga0068851_100035554 450
220 3300005841 Ga0068863_100000021 Ga0068863_10000002124 450
221 3300005841 Ga0068863_100150730 Ga0068863_1001507302 450
222 3300005985 Ga0081539_10001003 Ga0081539_1000100340 450
223 3300006038 Ga0075365_10002862 Ga0075365_100028622 450
224 3300006051 Ga0075364_10086082 Ga0075364_100860822 450
225 3300006163 Ga0070715_10000001 Ga0070715_10000001132 450
226 3300006175 Ga0070712_100024692 Ga0070712_1000246923 450
227 3300009098 Ga0105245_10011890 Ga0105245_100118907 450
228 3300009176 Ga0105242_10003600 Ga0105242_100036002 450
229 3300009177 Ga0105248_10069540 Ga0105248_100695403 450
230 3300009551 Ga0105238_10000201 Ga0105238_1000020121 450
231 3300009553 Ga0105249_10000074 Ga0105249_10000074138 450
232 3300014968 Ga0157379_10138437 Ga0157379_101384372 450
233 3300017792 Ga0163161_10010179 Ga0163161_100101793 450
234 3300025321 Ga0207656_10000321 Ga0207656_100003218 450
235 3300025893 Ga0207682_10000182 Ga0207682_1000018223 450
236 3300025905 Ga0207685_10000011 Ga0207685_10000011132 450
237 3300025915 Ga0207693_10028320 Ga0207693_100283203 450
238 3300025920 Ga0207649_10000076 Ga0207649_1000007632 450
239 3300025924 Ga0207694_10000004 Ga0207694_10000004667 450
240 3300025926 Ga0207659_10000010 Ga0207659_10000010294 450
241 3300025932 Ga0207690_10011339 Ga0207690_100113394 450
242 3300025934 Ga0207686_10000859 Ga0207686_1000085920 450
243 3300025944 Ga0207661_10004642 Ga0207661_100046429 450
244 3300025960 Ga0207651_10019744 Ga0207651_100197443 450
245 3300025961 Ga0207712_10000007 Ga0207712_10000007141 450
246 3300025981 Ga0207640_10000015 Ga0207640_10000015195 450
247 3300026023 Ga0207677_10020125 Ga0207677_100201254 450
248 3300026078 Ga0207702_10000016 Ga0207702_10000016163 450
249 3300026078 Ga0207702_10104856 Ga0207702_101048562 450
250 3300026088 Ga0207641_10000094 Ga0207641_1000009468 450
251 3300026088 Ga0207641_10112198 Ga0207641_101121982 450
252 3300026121 Ga0207683_10005039 Ga0207683_100050397 450
253 3300028381 Ga0268264_10200227 Ga0268264_102002272 450
254 3300044842 Ga0466957_0005251 Ga0466957_0005251_3625_5040 450
255 3300046461 Ga0495641_0000003 Ga0495641_0000003_160749_162161 450
256 3300046461 Ga0495641_0006893 Ga0495641_0006893_2937_4349 450
257 3300046511 Ga0495608_0008515 Ga0495608_0008515_156_1568 450
258 3300046514 Ga0495618_0000004 Ga0495618_0000004_158631_160043 450
259 3300046516 Ga0495628_0011721 Ga0495628_0011721_2035_3447 450
260 3300046517 Ga0495630_0000018 Ga0495630_0000018_78385_79797 450
261 3300046616 Ga0495668_0043438 Ga0495668_0043438_105_1517 450
262 3300046660 Ga0495625_0000122 Ga0495625_0000122_65817_67229 450
263 3300046678 Ga0495599_0027842 Ga0495599_0027842_1637_3049 450
264 3300046689 Ga0495613_0043665 Ga0495613_0043665_356_1768 450
265 3300046690 Ga0495624_0000009 Ga0495624_0000009_70316_71734 450
266 3300046694 Ga0495649_0004196 Ga0495649_0004196_3842_5254 450
267 3300047321 Ga0495676_0001150 Ga0495676_0001150_5139_6551 450
268 3300047673 Ga0495593_0033375 Ga0495593_0033375_1019_2431 450
269 3300048905 Ga0496102_0074309 Ga0496102_0074309_922_2334 450
270 3300048907 Ga0496104_0000013 Ga0496104_0000013_376848_378263 450
271 3300048908 Ga0496105_0000006 Ga0496105_0000006_18901_20316 450
272 3300048911 Ga0496108_0000001 Ga0496108_0000001_416370_417785 450
273 3300048913 Ga0496110_0007645 Ga0496110_0007645_4644_6056 450
274 3300048913 Ga0496110_0104270 Ga0496110_0104270_246_1658 450
275 3300048914 Ga0496111_0043451 Ga0496111_0043451_182_1594 450
276 3300048917 Ga0496114_0021444 Ga0496114_0021444_1432_2844 450
277 3300053085 Ga0495619_0000243 Ga0495619_0000243_34195_35607 450
278 3300053085 Ga0495619_0002645 Ga0495619_0002645_8683_10095 450
279 3300053123 Ga0500614_000984 Ga0500614_000984_4829_6241 450
280 3300006051 Ga0075364_10082727 Ga0075364_100827272 451
281 3300036401 Ga0373937_0036065 Ga0373937_0036065_2492_3907 451
282 3300046459 Ga0495629_0002666 Ga0495629_0002666_7495_8916 451
283 3300053085 Ga0495619_0005724 Ga0495619_0005724_1397_2812 451
284 3300005347 Ga0070668_100162686 Ga0070668_1001626861 452
285 3300005439 Ga0070711_100061589 Ga0070711_1000615892 452
286 3300005834 Ga0068851_10027344 Ga0068851_100273442 452
287 3300006852 Ga0075433_10039941 Ga0075433_100399412 452
288 3300014969 Ga0157376_10016893 Ga0157376_100168932 452
289 3300025916 Ga0207663_10000683 Ga0207663_1000068314 452
290 3300025925 Ga0207650_10097173 Ga0207650_100971732 452
291 3300025944 Ga0207661_10010508 Ga0207661_100105085 452
292 3300005347 Ga0070668_100019675 Ga0070668_1000196753 453
293 3300005356 Ga0070674_100000048 Ga0070674_10000004839 453
294 3300005367 Ga0070667_100001647 Ga0070667_10000164711 453
295 3300005436 Ga0070713_100000009 Ga0070713_10000000911 453
296 3300005548 Ga0070665_100038403 Ga0070665_1000384034 453
297 3300005718 Ga0068866_10000224 Ga0068866_1000022413 453
298 3300005842 Ga0068858_100000109 Ga0068858_10000010946 453
299 3300005842 Ga0068858_100067551 Ga0068858_1000675512 453
300 3300005844 Ga0068862_100003153 Ga0068862_10000315312 453
301 3300005937 Ga0081455_10008355 Ga0081455_100083553 453
302 3300009148 Ga0105243_10124394 Ga0105243_101243942 453
303 3300009553 Ga0105249_10010780 Ga0105249_100107807 453
304 3300014968 Ga0157379_10004315 Ga0157379_100043157 453
305 3300025899 Ga0207642_10000201 Ga0207642_100002018 453
306 3300025928 Ga0207700_10000025 Ga0207700_1000002511 453
307 3300025935 Ga0207709_10077106 Ga0207709_100771062 453
308 3300025937 Ga0207669_10000004 Ga0207669_1000000440 453
309 3300025961 Ga0207712_10036822 Ga0207712_100368223 453
310 3300025986 Ga0207658_10001533 Ga0207658_100015339 453
311 3300026035 Ga0207703_10000040 Ga0207703_1000004046 453
312 3300026035 Ga0207703_10045075 Ga0207703_100450753 453
313 3300028379 Ga0268266_10010633 Ga0268266_100106332 453
314 3300028380 Ga0268265_10003291 Ga0268265_100032912 453
315 3300046515 Ga0495620_0000246 Ga0495620_0000246_32852_34285 453
316 3300014968 Ga0157379_10058052 Ga0157379_100580523 454
317 3300045836 Ga0466958_0043401 Ga0466958_0043401_283_1710 454
318 3300005329 Ga0070683_100032820 Ga0070683_1000328201 455
319 3300005344 Ga0070661_100066981 Ga0070661_1000669812 455
320 3300005345 Ga0070692_10005508 Ga0070692_100055083 455
321 3300005354 Ga0070675_100050731 Ga0070675_1000507311 455
322 3300005365 Ga0070688_100019738 Ga0070688_1000197382 455
323 3300005366 Ga0070659_100027670 Ga0070659_1000276704 455
324 3300005438 Ga0070701_10080358 Ga0070701_100803581 455
325 3300005455 Ga0070663_100022695 Ga0070663_1000226953 455
326 3300005535 Ga0070684_100006378 Ga0070684_1000063788 455
327 3300005539 Ga0068853_100016879 Ga0068853_1000168794 455
328 3300005543 Ga0070672_100045759 Ga0070672_1000457593 455
329 3300005544 Ga0070686_100010837 Ga0070686_1000108373 455
330 3300005578 Ga0068854_100052928 Ga0068854_1000529283 455
331 3300005616 Ga0068852_100078648 Ga0068852_1000786482 455
332 3300005719 Ga0068861_100030435 Ga0068861_1000304353 455
333 3300005834 Ga0068851_10030393 Ga0068851_100303932 455
334 3300006038 Ga0075365_10004371 Ga0075365_100043711 455
335 3300006847 Ga0075431_100014338 Ga0075431_1000143386 455
336 3300006881 Ga0068865_100029201 Ga0068865_1000292012 455
337 3300009094 Ga0111539_10098797 Ga0111539_100987972 455
338 3300009098 Ga0105245_10079366 Ga0105245_100793663 455
339 3300009148 Ga0105243_10007823 Ga0105243_100078235 455
340 3300014326 Ga0157380_10063566 Ga0157380_100635663 455
341 3300014745 Ga0157377_10023216 Ga0157377_100232162 455
342 3300025927 Ga0207687_10027230 Ga0207687_100272302 455
343 3300025932 Ga0207690_10058720 Ga0207690_100587202 455
344 3300025933 Ga0207706_10007707 Ga0207706_100077076 455
345 3300025935 Ga0207709_10019226 Ga0207709_100192264 455
346 3300025940 Ga0207691_10049799 Ga0207691_100497994 455
347 3300025972 Ga0207668_10070605 Ga0207668_100706052 455
348 3300025981 Ga0207640_10033569 Ga0207640_100335692 455
349 3300026067 Ga0207678_10051530 Ga0207678_100515303 455
350 3300026075 Ga0207708_10021456 Ga0207708_100214563 455
351 3300026118 Ga0207675_100050776 Ga0207675_1000507763 455
352 3300048909 Ga0496106_0031558 Ga0496106_0031558_732_2195 455
353 3300048911 Ga0496108_0001941 Ga0496108_0001941_2592_4055 455
354 3300050492 nmdc:mga0yw44_9715_c1 nmdc:mga0yw44_9715_c1_3400_4863 455
355 3300050510 nmdc:mga06r32_19827_c1 nmdc:mga06r32_19827_c1_2985_4415 455
356 3300050511 nmdc:mga08y16_51884_c1 nmdc:mga08y16_51884_c1_607_2070 455
357 3300002074 JGI24748J21848_1000299 JGI24748J21848_10002993 456
358 3300002239 JGI24034J26672_10000180 JGI24034J26672_100001805 456

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09210

BE_C

1,4-alpha-glucan branching enzyme, C-terminal

413

485

0.88

PF03065

Glyco_hydro_57

Glycosyl hydrolase family 57

41

386

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wu7-assembly2.cif.gz_B crystal structure of gh57-type branching enzyme from hyperthermophilic archaeon pyrococcus horikoshii 0.8699 12 455
3n92-assembly1.cif.gz_A crystal structure of tk1436, a gh57 branching enzyme from hyperthermophilic archaeon thermococcus kodakaraensis, in complex with glucose 0.8581 12 455
5wu7-assembly1.cif.gz_A crystal structure of gh57-type branching enzyme from hyperthermophilic archaeon pyrococcus horikoshii 0.8503 12 455
4djg-assembly1.cif.gz_B crystal structure of the coiled-coil 1 domain of actin-binding protein scab1 0.8495 76 119
1ufa-assembly1.cif.gz_A crystal structure of tt1467 from thermus thermophilus hb8 0.8473 13 454
ID Description Score Start End Superfamily
5wu7B01 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.8797 12 356 3.20.110.10
2b5dX01 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.865 13 349 3.20.110.10
4djgB00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.8495 76 119 1.20.5.440
af_P9WQ27_8_405_3.20.110.10 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.8441 13 356 3.20.110.10
3p0bA01 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.8216 13 356 3.20.110.10
ID Description Score Start End GO Terms
AF-O50148-F1-model_v4 Glycoside hydrolase family 57 N-terminal domain-containing protein 0.9363 58 190 GO:0003844
GO:0005576
GO:0030979
AF-A0A537ZVV8-F1-model_v4 DUF1957 domain-containing protein 0.9344 8 456 GO:0003844
GO:0005576
GO:0030979
AF-A0A7J9YWL8-F1-model_v4 Glycoside hydrolase family 57 N-terminal domain-containing protein 0.934 11 364 GO:0003844
GO:0005576
GO:0030979
AF-A0A537ZSM6-F1-model_v4 DUF1957 domain-containing protein 0.926 58 456 GO:0003844
GO:0005576
GO:0030979
AF-A0A537ZVV8-F1-model_v4 DUF1957 domain-containing protein 0.9184 8 456 GO:0003844
GO:0005576
GO:0030979

Feature Viewer

pLDDT pTM Quality
84.16 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map