F421012

General Info

Members Datasets Scaffolds Average Seq Length
357 201 714 138

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_042297|Ga0590071_042297_29_505
Length 158
Sequence MTHPRMVRLNFDCEQGRDGSMKLHTFLNYGGNCEQALRFYEQHLGGKITMLMRRAEQPNQPVTWPGWENSVQYATMDLGETQLMASDVPPDRFQPMRSVYLSLTVDSAADAERLWALLSDGGQILMPMEETFFASRFGQLRDKFGTSWMILAFQPQTP

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
155 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
177 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.24
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 33.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_042297 3300059421 Bacteria 1097
2 Ga0065712_10321704 3300005290 Bacteria 825
3 Ga0065715_10151806 3300005293 Bacteria 1719
4 Ga0065715_10159760 3300005293 Bacteria 1641
5 Ga0065715_10606739 3300005293 Unclassified 704
6 Ga0065715_10860687 3300005293 Unclassified 588
7 Ga0065707_10005767 3300005295 Unclassified 3225
8 Ga0065707_10008252 3300005295 Unclassified 2632
9 Ga0070658_10006945 3300005327 Bacteria 9146
10 Ga0070658_10394637 3300005327 Bacteria 1188
11 Ga0070658_11104128 3300005327 Unclassified 690
12 Ga0070683_100298220 3300005329 Unclassified 1533
13 Ga0070690_100686016 3300005330 Bacteria 785
14 Ga0068869_100382437 3300005334 Bacteria 1154
15 Ga0070666_10109729 3300005335 Unclassified 1907
16 Ga0070680_100814413 3300005336 Unclassified 805
17 Ga0068868_100197140 3300005338 Bacteria 1677
18 Ga0070660_100032437 3300005339 Unclassified 3930
19 Ga0070689_100142645 3300005340 Bacteria 1927
20 Ga0070661_100632311 3300005344 Bacteria 867
21 Ga0070668_100253982 3300005347 Bacteria 1460
22 Ga0070669_100505122 3300005353 Bacteria 1003
23 Ga0070674_100007491 3300005356 Bacteria 6440
24 Ga0070674_102040063 3300005356 Unclassified 523
25 Ga0070688_100172644 3300005365 Bacteria 1493
26 Ga0070659_100518814 3300005366 Bacteria 1017
27 Ga0070659_101863132 3300005366 Unclassified 539
28 Ga0070713_100002760 3300005436 Bacteria 11481
29 Ga0070713_100205477 3300005436 Bacteria 1781
30 Ga0070713_100459698 3300005436 Bacteria 1197
31 Ga0070710_10014908 3300005437 Unclassified 3921
32 Ga0070711_100001021 3300005439 Bacteria 14890
33 Ga0070711_100024336 3300005439 Unclassified 3949
34 Ga0070708_100094435 3300005445 Bacteria 2729
35 Ga0070708_100359840 3300005445 Bacteria 1371
36 Ga0070708_101770035 3300005445 Unclassified 574
37 Ga0070681_11093176 3300005458 Unclassified 718
38 Ga0068867_100029058 3300005459 Plasmid 3983
39 Ga0068867_100109945 3300005459 Unclassified 2117
40 Ga0068867_101817173 3300005459 Unclassified 573
41 Ga0070706_100043712 3300005467 Bacteria 4139
42 Ga0070706_100070871 3300005467 Bacteria 3224
43 Ga0070707_100284825 3300005468 Unclassified 1606
44 Ga0070707_100389159 3300005468 Bacteria 1354
45 Ga0070707_102105730 3300005468 Unclassified 532
46 Ga0070698_100156234 3300005471 Bacteria 2226
47 Ga0070699_100571657 3300005518 Unclassified 1030
48 Ga0070699_100600947 3300005518 Unclassified 1003
49 Ga0070699_101115867 3300005518 Unclassified 723
50 Ga0070679_100040722 3300005530 Unclassified 4622
51 Ga0070684_100177001 3300005535 Bacteria 1939
52 Ga0070684_100783943 3300005535 Unclassified 891
53 Ga0070697_100010794 3300005536 Bacteria 7133
54 Ga0070697_100265840 3300005536 Bacteria 1469
55 Ga0070697_100664947 3300005536 Unclassified 918
56 Ga0070697_100755024 3300005536 Bacteria 860
57 Ga0070672_100190829 3300005543 Bacteria 1711
58 Ga0070686_100278378 3300005544 Unclassified 1233
59 Ga0070686_100566804 3300005544 Bacteria 890
60 Ga0070665_100014545 3300005548 Bacteria 7896
61 Ga0070665_100242801 3300005548 Unclassified 1801
62 Ga0070704_100167516 3300005549 Unclassified 1744
63 Ga0070704_100464973 3300005549 Unclassified 1092
64 Ga0068855_100158365 3300005563 Unclassified 2572
65 Ga0068855_100311014 3300005563 Bacteria 1743
66 Ga0068855_100625136 3300005563 Bacteria 1159
67 Ga0068855_101300062 3300005563 Unclassified 753
68 Ga0070664_100137688 3300005564 Bacteria 2148
69 Ga0068857_100648797 3300005577 Bacteria 1000
70 Ga0068854_101483670 3300005578 Unclassified 615
71 Ga0068856_100205812 3300005614 Bacteria 1982
72 Ga0068852_100853061 3300005616 Bacteria 926
73 Ga0068859_100106311 3300005617 Bacteria 2866
74 Ga0068859_101512741 3300005617 Bacteria 741
75 Ga0068864_100112359 3300005618 Bacteria 2428
76 Ga0068866_10007463 3300005718 Bacteria 4578
77 Ga0068861_100338583 3300005719 Bacteria 1316
78 Ga0068863_100133271 3300005841 Bacteria 2373
79 Ga0068858_100045660 3300005842 Bacteria 4061
80 Ga0068858_100545658 3300005842 Bacteria 1122
81 Ga0068860_100089532 3300005843 Bacteria 2930
82 Ga0068860_100667217 3300005843 Bacteria 1048
83 Ga0068860_100797485 3300005843 Unclassified 958
84 Ga0081539_10208626 3300005985 Bacteria 897
85 Ga0070715_10018935 3300006163 Unclassified 2632
86 Ga0070716_100002615 3300006173 Bacteria 8318
87 Ga0070712_100000627 3300006175 Bacteria 20778
88 Ga0097621_100030272 3300006237 Bacteria 4283
89 Ga0097621_100147167 3300006237 Unclassified 2018
90 Ga0097621_100223167 3300006237 Bacteria 1643
91 Ga0068871_100138687 3300006358 Bacteria 2066
92 Ga0068871_100352450 3300006358 Unclassified 1302
93 Ga0075428_100009397 3300006844 Bacteria 10847
94 Ga0075428_100016451 3300006844 Bacteria 8169
95 Ga0075428_100027003 3300006844 Bacteria 6357
96 Ga0075428_100341829 3300006844 Unclassified 1607
97 Ga0075428_100345832 3300006844 Bacteria 1596
98 Ga0075428_100525875 3300006844 Unclassified 1265
99 Ga0075428_101612109 3300006844 Bacteria 678
100 Ga0075428_102370252 3300006844 Unclassified 545
101 Ga0075430_100669207 3300006846 Bacteria 856
102 Ga0075431_100000029 3300006847 Bacteria 73283
103 Ga0075431_100060704 3300006847 Bacteria 3901
104 Ga0075431_100112451 3300006847 Bacteria 2810
105 Ga0075431_101518266 3300006847 Bacteria 628
106 Ga0075434_100315071 3300006871 Unclassified 1585
107 Ga0075434_100624688 3300006871 Bacteria 1096
108 Ga0075429_100127923 3300006880 Bacteria 2222
109 Ga0075429_100170331 3300006880 Bacteria 1907
110 Ga0075429_100291891 3300006880 Bacteria 1428
111 Ga0075429_101716689 3300006880 Bacteria 545
112 Ga0068865_100015843 3300006881 Bacteria 4812
113 Ga0068865_100019623 3300006881 Unclassified 4376
114 Ga0097620_100106315 3300006931 Bacteria 2866
115 Ga0097620_101512939 3300006931 Bacteria 741
116 Ga0075435_100579038 3300007076 Unclassified 973
117 Ga0105240_10014617 3300009093 Bacteria 10710
118 Ga0105240_10019554 3300009093 Bacteria 9045
119 Ga0105240_10124499 3300009093 Bacteria 3100
120 Ga0105240_10480500 3300009093 Unclassified 1385
121 Ga0111539_10035680 3300009094 Bacteria 6020
122 Ga0111539_10857638 3300009094 Unclassified 1057
123 Ga0105245_10050443 3300009098 Bacteria 3730
124 Ga0105245_10610896 3300009098 Bacteria 1118
125 Ga0105245_10650267 3300009098 Bacteria 1084
126 Ga0105245_10671662 3300009098 Bacteria 1067
127 Ga0114129_10000164 3300009147 Bacteria 71718
128 Ga0114129_10020896 3300009147 Bacteria 9300
129 Ga0114129_10035534 3300009147 Bacteria 7039
130 Ga0114129_10379732 3300009147 Bacteria 1866
131 Ga0114129_10436453 3300009147 Unclassified 1720
132 Ga0114129_10728676 3300009147 Bacteria 1271
133 Ga0114129_11143202 3300009147 Bacteria 973
134 Ga0105243_10139017 3300009148 Bacteria 2070
135 Ga0105243_10619234 3300009148 Bacteria 1045
136 Ga0105241_10172754 3300009174 Bacteria 1786
137 Ga0105241_10194528 3300009174 Bacteria 1690
138 Ga0105242_10010775 3300009176 Bacteria 7019
139 Ga0105242_10038650 3300009176 Bacteria 3839
140 Ga0105248_10136193 3300009177 Bacteria 2770
141 Ga0105248_10360242 3300009177 Bacteria 1637
142 Ga0105248_10389008 3300009177 Bacteria 1570
143 Ga0105237_10099033 3300009545 Bacteria 2907
144 Ga0105238_10022907 3300009551 Bacteria 6367
145 Ga0105238_10111569 3300009551 Unclassified 2715
146 Ga0105249_12141337 3300009553 Unclassified 632
147 Ga0105249_12686917 3300009553 Bacteria 570
148 Ga0105249_12908990 3300009553 Unclassified 550
149 Ga0105239_10253124 3300010375 Bacteria 1978
150 Ga0105239_10360444 3300010375 Bacteria 1642
151 Ga0105246_10011949 3300011119 Bacteria 5404
152 Ga0105246_10068812 3300011119 Bacteria 2484
153 Ga0157373_10244556 3300013100 Bacteria 1268
154 Ga0157371_11009695 3300013102 Bacteria 635
155 Ga0157371_11026560 3300013102 Bacteria 630
156 Ga0157370_10146810 3300013104 Bacteria 2196
157 Ga0157370_10511019 3300013104 Bacteria 1103
158 Ga0157369_10363087 3300013105 Unclassified 1503
159 Ga0157369_10842645 3300013105 Bacteria 941
160 Ga0157369_11356465 3300013105 Bacteria 724
161 Ga0157369_11610120 3300013105 Unclassified 660
162 Ga0157374_10159759 3300013296 Unclassified 2195
163 Ga0157374_10214295 3300013296 Bacteria 1889
164 Ga0157374_10386172 3300013296 Bacteria 1395
165 Ga0157374_10701251 3300013296 Bacteria 1025
166 Ga0157374_10780441 3300013296 Unclassified 971
167 Ga0157378_10002179 3300013297 Bacteria 17362
168 Ga0157378_10290851 3300013297 Unclassified 1578
169 Ga0163162_10025031 3300013306 Bacteria 5897
170 Ga0157372_11046865 3300013307 Bacteria 945
171 Ga0157372_11226966 3300013307 Bacteria 866
172 Ga0157375_10119175 3300013308 Unclassified 2747
173 Ga0163163_10100388 3300014325 Bacteria 2916
174 Ga0163163_10584537 3300014325 Unclassified 1180
175 Ga0163163_10674752 3300014325 Bacteria 1097
176 Ga0157380_10126115 3300014326 Bacteria 2176
177 Ga0157380_10718227 3300014326 Bacteria 1006
178 Ga0157379_10287354 3300014968 Unclassified 1497
179 Ga0157379_10830493 3300014968 Bacteria 873
180 Ga0157376_10508287 3300014969 Bacteria 1185
181 Ga0157376_10790254 3300014969 Bacteria 961
182 Ga0157376_11103671 3300014969 Bacteria 819
183 Ga0163161_10346800 3300017792 Unclassified 1179
184 Ga0213874_10442662 3300021377 Unclassified 512
185 Ga0207692_10057782 3300025898 Bacteria 1996
186 Ga0207692_10336317 3300025898 Unclassified 927
187 Ga0207642_10136041 3300025899 Bacteria 1289
188 Ga0207680_10330709 3300025903 Unclassified 1067
189 Ga0207705_10138254 3300025909 Bacteria 1817
190 Ga0207705_11018209 3300025909 Unclassified 640
191 Ga0207684_10101151 3300025910 Bacteria 2463
192 Ga0207654_10415959 3300025911 Unclassified 937
193 Ga0207707_10576838 3300025912 Bacteria 954
194 Ga0207695_10022316 3300025913 Bacteria 7191
195 Ga0207695_10433095 3300025913 Unclassified 1199
196 Ga0207695_10903858 3300025913 Unclassified 763
197 Ga0207693_10001711 3300025915 Bacteria 19305
198 Ga0207663_10101351 3300025916 Bacteria 1934
199 Ga0207663_10862393 3300025916 Unclassified 723
200 Ga0207657_10002256 3300025919 Bacteria 20893
201 Ga0207657_10471686 3300025919 Bacteria 984
202 Ga0207649_10285091 3300025920 Unclassified 1202
203 Ga0207646_10132651 3300025922 Unclassified 2242
204 Ga0207646_10628213 3300025922 Unclassified 963
205 Ga0207681_10459164 3300025923 Bacteria 1037
206 Ga0207694_10413969 3300025924 Bacteria 1122
207 Ga0207687_10119321 3300025927 Bacteria 1970
208 Ga0207687_10267423 3300025927 Bacteria 1365
209 Ga0207687_10345250 3300025927 Bacteria 1211
210 Ga0207687_10800719 3300025927 Bacteria 804
211 Ga0207700_10005031 3300025928 Bacteria 7865
212 Ga0207700_10309326 3300025928 Bacteria 1366
213 Ga0207664_10710792 3300025929 Unclassified 904
214 Ga0207664_10815986 3300025929 Bacteria 839
215 Ga0207686_10017436 3300025934 Bacteria 4047
216 Ga0207686_10176767 3300025934 Bacteria 1510
217 Ga0207709_10052257 3300025935 Bacteria 2509
218 Ga0207709_10252307 3300025935 Bacteria 1289
219 Ga0207709_10393320 3300025935 Bacteria 1058
220 Ga0207669_10239102 3300025937 Unclassified 1345
221 Ga0207669_11329787 3300025937 Unclassified 611
222 Ga0207704_10136858 3300025938 Unclassified 1707
223 Ga0207704_10334572 3300025938 Bacteria 1173
224 Ga0207665_10219694 3300025939 Bacteria 1392
225 Ga0207691_10201797 3300025940 Bacteria 1730
226 Ga0207711_10391448 3300025941 Unclassified 1290
227 Ga0207711_10603061 3300025941 Unclassified 1024
228 Ga0207711_10667004 3300025941 Viruses 970
229 Ga0207689_10145766 3300025942 Bacteria 1951
230 Ga0207689_10171768 3300025942 Bacteria 1787
231 Ga0207689_10551173 3300025942 Unclassified 968
232 Ga0207661_10140631 3300025944 Unclassified 2077
233 Ga0207661_10275699 3300025944 Bacteria 1502
234 Ga0207679_10284789 3300025945 Bacteria 1419
235 Ga0207679_10306897 3300025945 Unclassified 1370
236 Ga0207667_10202214 3300025949 Unclassified 2038
237 Ga0207667_10395395 3300025949 Bacteria 1407
238 Ga0207667_10970449 3300025949 Bacteria 838
239 Ga0207712_10629835 3300025961 Bacteria 930
240 Ga0207640_11043806 3300025981 Bacteria 721
241 Ga0207677_10030127 3300026023 Bacteria 3459
242 Ga0207703_10157341 3300026035 Bacteria 1987
243 Ga0207703_10894792 3300026035 Unclassified 850
244 Ga0207648_10068563 3300026089 Bacteria 3091
245 Ga0207648_10144352 3300026089 Unclassified 2099
246 Ga0207648_10221980 3300026089 Bacteria 1680
247 Ga0207676_10143622 3300026095 Bacteria 2046
248 Ga0207675_100278918 3300026118 Unclassified 1623
249 Ga0207675_100993706 3300026118 Unclassified 857
250 Ga0207683_10173208 3300026121 Bacteria 1955
251 Ga0207428_10058644 3300027907 Unclassified 3054
252 Ga0268266_10018335 3300028379 Bacteria 5966
253 Ga0268266_10034413 3300028379 Bacteria 4309
254 Ga0268266_10440669 3300028379 Bacteria 1237
255 Ga0268264_10056318 3300028381 Bacteria 3287
256 Ga0268264_10509145 3300028381 Bacteria 1175
257 Ga0268264_10601803 3300028381 Bacteria 1083
258 Ga0265762_1051200 3300030760 Bacteria 830
259 Ga0265762_1114380 3300030760 Unclassified 611
260 Ga0307408_100090143 3300031548 Bacteria 2313
261 Ga0307405_10353522 3300031731 Unclassified 1134
262 Ga0307413_10884270 3300031824 Bacteria 757
263 Ga0307410_10138677 3300031852 Bacteria 1796
264 Ga0307410_10391694 3300031852 Bacteria 1120
265 Ga0307406_10038437 3300031901 Bacteria 2963
266 Ga0307406_11201035 3300031901 Bacteria 659
267 Ga0307407_10068330 3300031903 Bacteria 2104
268 Ga0307412_10098623 3300031911 Unclassified 2061
269 Ga0307409_100406979 3300031995 Bacteria 1301
270 Ga0307409_102447560 3300031995 Unclassified 551
271 Ga0307416_100159253 3300032002 Bacteria 2084
272 Ga0307416_100186639 3300032002 Bacteria 1950
273 Ga0307416_100564246 3300032002 Bacteria 1213
274 Ga0307414_10149783 3300032004 Bacteria 1839
275 Ga0307411_10002400 3300032005 Bacteria 8263
276 Ga0307411_10060848 3300032005 Unclassified 2510
277 Ga0307411_10192880 3300032005 Bacteria 1557
278 Ga0307415_100073399 3300032126 Unclassified 2414
279 Ga0316583_10122106 3300032133 Unclassified 908
280 Ga0373947_0558208 3300035725 Bacteria 780
281 Ga0373947_0716595 3300035725 Unclassified 683
282 Ga0395905_0409258 3300037471 Unclassified 1252
283 Ga0436364_0505132 3300037853 Bacteria 2815
284 Ga0436363_0804796 3300039450 Bacteria 771
285 Ga0436362_1139175 3300039453 Bacteria 1247
286 Ga0439453_0174713 3300041408 Unclassified 521
287 Ga0451793_1736568 3300041452 Unclassified 526
288 Ga0439434_0069268 3300042435 Bacteria 1109
289 Ga0439444_0028687 3300042437 Unclassified 1032
290 Ga0450916_005380 3300042530 Unclassified 1478
291 Ga0451576_1043097 3300045051 Unclassified 856
292 Ga0495603_0156913 3300046455 Bacteria 1320
293 Ga0495603_0216521 3300046455 Bacteria 1105
294 Ga0495580_0295405 3300046472 Bacteria 1104
295 Ga0495584_0572128 3300046491 Unclassified 576
296 Ga0495594_0127748 3300046499 Unclassified 1439
297 Ga0495594_0230880 3300046499 Unclassified 1055
298 Ga0495663_0242764 3300046525 Unclassified 638
299 Ga0495586_0385458 3300046535 Unclassified 806
300 Ga0495598_0271171 3300046537 Unclassified 634
301 Ga0495621_0010710 3300046539 Bacteria 2816
302 Ga0495659_0004337 3300046664 Bacteria 4464
303 Ga0495588_0022521 3300046674 Unclassified 3114
304 Ga0495599_0254095 3300046678 Bacteria 1069
305 Ga0495658_0265758 3300046683 Bacteria 1080
306 Ga0495658_0377118 3300046683 Bacteria 903
307 Ga0495660_0483443 3300046810 Unclassified 531
308 Ga0495676_1096945 3300047321 Unclassified 506
309 Ga0496102_0449768 3300048905 Bacteria 1208
310 Ga0496105_0176207 3300048908 Unclassified 1752
311 Ga0496106_1027339 3300048909 Bacteria 648
312 Ga0496108_0602816 3300048911 Bacteria 957
313 Ga0496112_0838026 3300048915 Bacteria 843
314 Ga0496112_1646077 3300048915 Bacteria 555
315 Ga0496112_1655818 3300048915 Unclassified 553
316 Ga0501295_126732 3300049518 Unclassified 617
317 Ga0501298_063942 3300049521 Bacteria 784
318 Ga0501299_110978 3300049522 Bacteria 649
319 Ga0501032_1084530 3300049569 Unclassified 502
320 Ga0501048_1064604 3300049582 Bacteria 582
321 Ga0501076_1068854 3300049592 Unclassified 665
322 Ga0501077_0610966 3300049593 Unclassified 700
323 Ga0501225_0193024 3300049705 Bacteria 642
324 Ga0501080_1361054 3300049742 Unclassified 606
325 Ga0501081_0032354 3300049743 Bacteria 3548
326 Ga0501275_088537 3300049772 Bacteria 512
327 nmdc:mga05p37_118710_c1 3300050507 Bacteria 1872
328 nmdc:mga05p37_1271930_c1 3300050507 Bacteria 753
329 nmdc:mga05p37_15_c1 3300050507 Bacteria 134650
330 nmdc:mga05p37_27251_c1 3300050507 Bacteria 6957
331 nmdc:mga05p37_360575_c1 3300050507 Bacteria 1709
332 nmdc:mga05p37_689046_c1 3300050507 Bacteria 1137
333 nmdc:mga05p37_870123_c1 3300050507 Bacteria 976
334 nmdc:mga09592_120883_c1 3300050508 Bacteria 2250
335 nmdc:mga09592_1517936_c1 3300050508 Bacteria 545
336 nmdc:mga09592_201081_c1 3300050508 Bacteria 1725
337 nmdc:mga09592_37990_c1 3300050508 Bacteria 4040
338 nmdc:mga0qj67_116388_c1 3300050509 Unclassified 2160
339 nmdc:mga06r32_1448882_c1 3300050510 Bacteria 628
340 nmdc:mga06r32_28960_c1 3300050510 Bacteria 5185
341 nmdc:mga06r32_346024_c1 3300050510 Bacteria 1471
342 nmdc:mga06r32_85_c1 3300050510 Bacteria 64050
343 nmdc:mga08y16_13502_c1 3300050511 Bacteria 8594
344 nmdc:mga08y16_1957890_c1 3300050511 Unclassified 536
345 nmdc:mga08y16_356803_c1 3300050511 Bacteria 1501
346 nmdc:mga08y16_37973_c1 3300050511 Bacteria 5056
347 nmdc:mga0n895_1787024_c1 3300050512 Unclassified 576
348 nmdc:mga0rr50_742450_c1 3300050513 Unclassified 838
349 nmdc:mga0a205_1066143_c1 3300050515 Bacteria 655
350 nmdc:mga0a205_656568_c1 3300050515 Unclassified 900
351 Ga0495601_0680356 3300053077 Unclassified 657
352 Ga0495619_0250139 3300053085 Bacteria 1228
353 Ga0590075_015557 3300059424 Bacteria 1867
354 Ga0590077_023159 3300059426 Bacteria 1328
355 Ga0501082_0025128 3300060353 Bacteria 5132
356 Ga0466962_0416376 3300061719 Unclassified 674
357 Ga0530510_0303636 3300061734 Unclassified 1195
358 Ga0590071_042297
359 Ga0065712_10321704
360 Ga0065715_10151806
361 Ga0065715_10159760
362 Ga0065715_10606739
363 Ga0065715_10860687
364 Ga0065707_10005767
365 Ga0065707_10008252
366 Ga0070658_10006945
367 Ga0070658_10394637
368 Ga0070658_11104128
369 Ga0070683_100298220
370 Ga0070690_100686016
371 Ga0068869_100382437
372 Ga0070666_10109729
373 Ga0070680_100814413
374 Ga0068868_100197140
375 Ga0070660_100032437
376 Ga0070689_100142645
377 Ga0070661_100632311
378 Ga0070668_100253982
379 Ga0070669_100505122
380 Ga0070674_100007491
381 Ga0070674_102040063
382 Ga0070688_100172644
383 Ga0070659_100518814
384 Ga0070659_101863132
385 Ga0070713_100002760
386 Ga0070713_100205477
387 Ga0070713_100459698
388 Ga0070710_10014908
389 Ga0070711_100001021
390 Ga0070711_100024336
391 Ga0070708_100094435
392 Ga0070708_100359840
393 Ga0070708_101770035
394 Ga0070681_11093176
395 Ga0068867_100029058
396 Ga0068867_100109945
397 Ga0068867_101817173
398 Ga0070706_100043712
399 Ga0070706_100070871
400 Ga0070707_100284825
401 Ga0070707_100389159
402 Ga0070707_102105730
403 Ga0070698_100156234
404 Ga0070699_100571657
405 Ga0070699_100600947
406 Ga0070699_101115867
407 Ga0070679_100040722
408 Ga0070684_100177001
409 Ga0070684_100783943
410 Ga0070697_100010794
411 Ga0070697_100265840
412 Ga0070697_100664947
413 Ga0070697_100755024
414 Ga0070672_100190829
415 Ga0070686_100278378
416 Ga0070686_100566804
417 Ga0070665_100014545
418 Ga0070665_100242801
419 Ga0070704_100167516
420 Ga0070704_100464973
421 Ga0068855_100158365
422 Ga0068855_100311014
423 Ga0068855_100625136
424 Ga0068855_101300062
425 Ga0070664_100137688
426 Ga0068857_100648797
427 Ga0068854_101483670
428 Ga0068856_100205812
429 Ga0068852_100853061
430 Ga0068859_100106311
431 Ga0068859_101512741
432 Ga0068864_100112359
433 Ga0068866_10007463
434 Ga0068861_100338583
435 Ga0068863_100133271
436 Ga0068858_100045660
437 Ga0068858_100545658
438 Ga0068860_100089532
439 Ga0068860_100667217
440 Ga0068860_100797485
441 Ga0081539_10208626
442 Ga0070715_10018935
443 Ga0070716_100002615
444 Ga0070712_100000627
445 Ga0097621_100030272
446 Ga0097621_100147167
447 Ga0097621_100223167
448 Ga0068871_100138687
449 Ga0068871_100352450
450 Ga0075428_100009397
451 Ga0075428_100016451
452 Ga0075428_100027003
453 Ga0075428_100341829
454 Ga0075428_100345832
455 Ga0075428_100525875
456 Ga0075428_101612109
457 Ga0075428_102370252
458 Ga0075430_100669207
459 Ga0075431_100000029
460 Ga0075431_100060704
461 Ga0075431_100112451
462 Ga0075431_101518266
463 Ga0075434_100315071
464 Ga0075434_100624688
465 Ga0075429_100127923
466 Ga0075429_100170331
467 Ga0075429_100291891
468 Ga0075429_101716689
469 Ga0068865_100015843
470 Ga0068865_100019623
471 Ga0097620_100106315
472 Ga0097620_101512939
473 Ga0075435_100579038
474 Ga0105240_10014617
475 Ga0105240_10019554
476 Ga0105240_10124499
477 Ga0105240_10480500
478 Ga0111539_10035680
479 Ga0111539_10857638
480 Ga0105245_10050443
481 Ga0105245_10610896
482 Ga0105245_10650267
483 Ga0105245_10671662
484 Ga0114129_10000164
485 Ga0114129_10020896
486 Ga0114129_10035534
487 Ga0114129_10379732
488 Ga0114129_10436453
489 Ga0114129_10728676
490 Ga0114129_11143202
491 Ga0105243_10139017
492 Ga0105243_10619234
493 Ga0105241_10172754
494 Ga0105241_10194528
495 Ga0105242_10010775
496 Ga0105242_10038650
497 Ga0105248_10136193
498 Ga0105248_10360242
499 Ga0105248_10389008
500 Ga0105237_10099033
501 Ga0105238_10022907
502 Ga0105238_10111569
503 Ga0105249_12141337
504 Ga0105249_12686917
505 Ga0105249_12908990
506 Ga0105239_10253124
507 Ga0105239_10360444
508 Ga0105246_10011949
509 Ga0105246_10068812
510 Ga0157373_10244556
511 Ga0157371_11009695
512 Ga0157371_11026560
513 Ga0157370_10146810
514 Ga0157370_10511019
515 Ga0157369_10363087
516 Ga0157369_10842645
517 Ga0157369_11356465
518 Ga0157369_11610120
519 Ga0157374_10159759
520 Ga0157374_10214295
521 Ga0157374_10386172
522 Ga0157374_10701251
523 Ga0157374_10780441
524 Ga0157378_10002179
525 Ga0157378_10290851
526 Ga0163162_10025031
527 Ga0157372_11046865
528 Ga0157372_11226966
529 Ga0157375_10119175
530 Ga0163163_10100388
531 Ga0163163_10584537
532 Ga0163163_10674752
533 Ga0157380_10126115
534 Ga0157380_10718227
535 Ga0157379_10287354
536 Ga0157379_10830493
537 Ga0157376_10508287
538 Ga0157376_10790254
539 Ga0157376_11103671
540 Ga0163161_10346800
541 Ga0213874_10442662
542 Ga0207692_10057782
543 Ga0207692_10336317
544 Ga0207642_10136041
545 Ga0207680_10330709
546 Ga0207705_10138254
547 Ga0207705_11018209
548 Ga0207684_10101151
549 Ga0207654_10415959
550 Ga0207707_10576838
551 Ga0207695_10022316
552 Ga0207695_10433095
553 Ga0207695_10903858
554 Ga0207693_10001711
555 Ga0207663_10101351
556 Ga0207663_10862393
557 Ga0207657_10002256
558 Ga0207657_10471686
559 Ga0207649_10285091
560 Ga0207646_10132651
561 Ga0207646_10628213
562 Ga0207681_10459164
563 Ga0207694_10413969
564 Ga0207687_10119321
565 Ga0207687_10267423
566 Ga0207687_10345250
567 Ga0207687_10800719
568 Ga0207700_10005031
569 Ga0207700_10309326
570 Ga0207664_10710792
571 Ga0207664_10815986
572 Ga0207686_10017436
573 Ga0207686_10176767
574 Ga0207709_10052257
575 Ga0207709_10252307
576 Ga0207709_10393320
577 Ga0207669_10239102
578 Ga0207669_11329787
579 Ga0207704_10136858
580 Ga0207704_10334572
581 Ga0207665_10219694
582 Ga0207691_10201797
583 Ga0207711_10391448
584 Ga0207711_10603061
585 Ga0207711_10667004
586 Ga0207689_10145766
587 Ga0207689_10171768
588 Ga0207689_10551173
589 Ga0207661_10140631
590 Ga0207661_10275699
591 Ga0207679_10284789
592 Ga0207679_10306897
593 Ga0207667_10202214
594 Ga0207667_10395395
595 Ga0207667_10970449
596 Ga0207712_10629835
597 Ga0207640_11043806
598 Ga0207677_10030127
599 Ga0207703_10157341
600 Ga0207703_10894792
601 Ga0207648_10068563
602 Ga0207648_10144352
603 Ga0207648_10221980
604 Ga0207676_10143622
605 Ga0207675_100278918
606 Ga0207675_100993706
607 Ga0207683_10173208
608 Ga0207428_10058644
609 Ga0268266_10018335
610 Ga0268266_10034413
611 Ga0268266_10440669
612 Ga0268264_10056318
613 Ga0268264_10509145
614 Ga0268264_10601803
615 Ga0265762_1051200
616 Ga0265762_1114380
617 Ga0307408_100090143
618 Ga0307405_10353522
619 Ga0307413_10884270
620 Ga0307410_10138677
621 Ga0307410_10391694
622 Ga0307406_10038437
623 Ga0307406_11201035
624 Ga0307407_10068330
625 Ga0307412_10098623
626 Ga0307409_100406979
627 Ga0307409_102447560
628 Ga0307416_100159253
629 Ga0307416_100186639
630 Ga0307416_100564246
631 Ga0307414_10149783
632 Ga0307411_10002400
633 Ga0307411_10060848
634 Ga0307411_10192880
635 Ga0307415_100073399
636 Ga0316583_10122106
637 Ga0373947_0558208
638 Ga0373947_0716595
639 Ga0395905_0409258
640 Ga0436364_0505132
641 Ga0436363_0804796
642 Ga0436362_1139175
643 Ga0439453_0174713
644 Ga0451793_1736568
645 Ga0439434_0069268
646 Ga0439444_0028687
647 Ga0450916_005380
648 Ga0451576_1043097
649 Ga0495603_0156913
650 Ga0495603_0216521
651 Ga0495580_0295405
652 Ga0495584_0572128
653 Ga0495594_0127748
654 Ga0495594_0230880
655 Ga0495663_0242764
656 Ga0495586_0385458
657 Ga0495598_0271171
658 Ga0495621_0010710
659 Ga0495659_0004337
660 Ga0495588_0022521
661 Ga0495599_0254095
662 Ga0495658_0265758
663 Ga0495658_0377118
664 Ga0495660_0483443
665 Ga0495676_1096945
666 Ga0496102_0449768
667 Ga0496105_0176207
668 Ga0496106_1027339
669 Ga0496108_0602816
670 Ga0496112_0838026
671 Ga0496112_1646077
672 Ga0496112_1655818
673 Ga0501295_126732
674 Ga0501298_063942
675 Ga0501299_110978
676 Ga0501032_1084530
677 Ga0501048_1064604
678 Ga0501076_1068854
679 Ga0501077_0610966
680 Ga0501225_0193024
681 Ga0501080_1361054
682 Ga0501081_0032354
683 Ga0501275_088537
684 nmdc:mga05p37_118710_c1
685 nmdc:mga05p37_1271930_c1
686 nmdc:mga05p37_15_c1
687 nmdc:mga05p37_27251_c1
688 nmdc:mga05p37_360575_c1
689 nmdc:mga05p37_689046_c1
690 nmdc:mga05p37_870123_c1
691 nmdc:mga09592_120883_c1
692 nmdc:mga09592_1517936_c1
693 nmdc:mga09592_201081_c1
694 nmdc:mga09592_37990_c1
695 nmdc:mga0qj67_116388_c1
696 nmdc:mga06r32_1448882_c1
697 nmdc:mga06r32_28960_c1
698 nmdc:mga06r32_346024_c1
699 nmdc:mga06r32_85_c1
700 nmdc:mga08y16_13502_c1
701 nmdc:mga08y16_1957890_c1
702 nmdc:mga08y16_356803_c1
703 nmdc:mga08y16_37973_c1
704 nmdc:mga0n895_1787024_c1
705 nmdc:mga0rr50_742450_c1
706 nmdc:mga0a205_1066143_c1
707 nmdc:mga0a205_656568_c1
708 Ga0495601_0680356
709 Ga0495619_0250139
710 Ga0590075_015557
711 Ga0590077_023159
712 Ga0501082_0025128
713 Ga0466962_0416376
714 Ga0530510_0303636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

22

150

0.94

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

21

151

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8966 1 133
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8838 1 133
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8709 3 126
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.8668 3 130
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8571 1 132
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9462 76 130 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8907 7 137 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8803 7 133 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8734 7 133 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8695 3 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V8ESD5-F1-model_v4 VOC family protein 0.9839 30 135
AF-A0A2V7ZPD4-F1-model_v4 VOC family protein 0.9761 1 67
AF-A0A537JRP0-F1-model_v4 VOC family protein 0.9743 1 105
AF-A0A7Y5RDN0-F1-model_v4 VOC family protein 0.9717 1 135
AF-Q2SAS0-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9702 1 134

Map