F420995

General Info

Members Datasets Scaffolds Average Seq Length
357 232 714 117

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0459287|Ga0501079_0459287_427_819
Length 130
Sequence MQSADALKGRAMKKTTDSLETLRARIAAFAAERDWDQFHNPKNLAMALAGEAGELLEHFQWLTFEQSAQLPAGTRAEVALEAADVLLFLVRLCDKLGIDLAAACEKKLALNAQKYPVEKSRGRATKYDKL

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
144 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
145 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
146 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
205 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
221 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
222 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
223 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
224 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
225 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
226 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
227 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
228 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
229 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
230 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
231 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
232 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.84
Metatranscriptomes 2.52
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0.84
Rhizoplane 2.8
Rhizosphere 89.92
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0459287 3300049741 Bacteria 1000
2 rootH2_10093055 3300003320 Bacteria 1414
3 rootH2_10236374 3300003320 Bacteria 1069
4 rootH1_10121452 3300003323 Bacteria 1295
5 rootH1_10221549 3300003323 Bacteria 1295
6 Ga0070676_10110806 3300005328 Bacteria 1709
7 Ga0070690_100473503 3300005330 Bacteria 932
8 Ga0070670_100012062 3300005331 Bacteria 7394
9 Ga0070670_100016760 3300005331 Bacteria 6288
10 Ga0070670_100023001 3300005331 Bacteria 5362
11 Ga0070677_10056384 3300005333 Bacteria 1607
12 Ga0068869_100019896 3300005334 Bacteria 4596
13 Ga0070666_10914328 3300005335 Bacteria 649
14 Ga0070680_100241429 3300005336 Bacteria 1527
15 Ga0068868_101865312 3300005338 Bacteria 569
16 Ga0070687_100104018 3300005343 Bacteria 1595
17 Ga0070692_11184643 3300005345 Bacteria 543
18 Ga0070668_100002563 3300005347 Bacteria 13363
19 Ga0070669_100058258 3300005353 Bacteria 2834
20 Ga0070669_100105951 3300005353 Bacteria 2128
21 Ga0070675_100375888 3300005354 Bacteria 1264
22 Ga0070671_100157695 3300005355 Bacteria 1918
23 Ga0070671_100229407 3300005355 Bacteria 1575
24 Ga0070671_101985881 3300005355 Bacteria 518
25 Ga0070673_100014659 3300005364 Bacteria 5472
26 Ga0070688_100115404 3300005365 Bacteria 1792
27 Ga0070688_100314527 3300005365 Bacteria 1136
28 Ga0070667_100128889 3300005367 Bacteria 2207
29 Ga0070667_100428593 3300005367 Bacteria 1206
30 Ga0070701_10085981 3300005438 Bacteria 1713
31 Ga0070705_100139732 3300005440 Bacteria 1592
32 Ga0070700_100035911 3300005441 Bacteria 3003
33 Ga0070694_100991114 3300005444 Bacteria 697
34 Ga0070694_101813395 3300005444 Bacteria 520
35 Ga0070708_100108887 3300005445 Bacteria 2545
36 Ga0070678_100056342 3300005456 Bacteria 2874
37 Ga0070662_100224230 3300005457 Bacteria 1501
38 Ga0070681_10073727 3300005458 Bacteria 3375
39 Ga0070681_10252119 3300005458 Bacteria 1677
40 Ga0068867_100025877 3300005459 Bacteria 4209
41 Ga0068867_100037605 3300005459 Bacteria 3518
42 Ga0070685_10046851 3300005466 Bacteria 2484
43 Ga0070698_101952985 3300005471 Bacteria 540
44 Ga0070699_101864097 3300005518 Bacteria 550
45 Ga0070679_100630263 3300005530 Bacteria 1015
46 Ga0070679_101586339 3300005530 Bacteria 602
47 Ga0070684_100944792 3300005535 Bacteria 808
48 Ga0068853_100036535 3300005539 Bacteria 4179
49 Ga0068853_100594887 3300005539 Bacteria 1050
50 Ga0068853_102148802 3300005539 Bacteria 541
51 Ga0070672_100002996 3300005543 Bacteria 10883
52 Ga0070672_100101140 3300005543 Bacteria 2338
53 Ga0070686_100334479 3300005544 Bacteria 1133
54 Ga0070665_100045169 3300005548 Bacteria 4424
55 Ga0070665_101346414 3300005548 Bacteria 723
56 Ga0070704_100688793 3300005549 Bacteria 905
57 Ga0070704_101828403 3300005549 Bacteria 562
58 Ga0068855_100296603 3300005563 Bacteria 1791
59 Ga0070664_101983965 3300005564 Bacteria 552
60 Ga0068857_100044264 3300005577 Bacteria 3948
61 Ga0068854_100199994 3300005578 Bacteria 1570
62 Ga0068852_100314179 3300005616 Bacteria 1520
63 Ga0068852_101096208 3300005616 Bacteria 816
64 Ga0068859_100014700 3300005617 Bacteria 7865
65 Ga0068859_101523116 3300005617 Bacteria 738
66 Ga0068859_101880980 3300005617 Bacteria 661
67 Ga0068859_102316890 3300005617 Unclassified 592
68 Ga0068864_100016251 3300005618 Bacteria 6194
69 Ga0068864_100104378 3300005618 Bacteria 2517
70 Ga0068864_100286633 3300005618 Bacteria 1538
71 Ga0068861_100021984 3300005719 Bacteria 4589
72 Ga0068861_101776811 3300005719 Bacteria 611
73 Ga0068870_10038987 3300005840 Bacteria 2456
74 Ga0068863_100008037 3300005841 Bacteria 10301
75 Ga0068863_100132834 3300005841 Bacteria 2377
76 Ga0068863_100468605 3300005841 Bacteria 1238
77 Ga0068863_102174648 3300005841 Bacteria 565
78 Ga0068858_100056657 3300005842 Bacteria 3622
79 Ga0068858_101250901 3300005842 Bacteria 730
80 Ga0068860_100040190 3300005843 Bacteria 4472
81 Ga0068860_100069675 3300005843 Bacteria 3343
82 Ga0068860_100851764 3300005843 Bacteria 926
83 Ga0068862_100021707 3300005844 Bacteria 5370
84 Ga0081539_10173873 3300005985 Bacteria 1015
85 Ga0075366_10019019 3300006195 Bacteria 3970
86 Ga0097621_100009490 3300006237 Bacteria 7063
87 Ga0068871_100238892 3300006358 Bacteria 1579
88 Ga0075428_100629704 3300006844 Bacteria 1145
89 Ga0075430_101141431 3300006846 Bacteria 642
90 Ga0075431_100474588 3300006847 Bacteria 1244
91 Ga0068865_100156666 3300006881 Bacteria 1733
92 Ga0068865_100727146 3300006881 Bacteria 851
93 Ga0075436_100612552 3300006914 Bacteria 803
94 Ga0097620_100014700 3300006931 Bacteria 7865
95 Ga0097620_101523617 3300006931 Bacteria 738
96 Ga0097620_101881127 3300006931 Bacteria 661
97 Ga0097620_102316149 3300006931 Unclassified 592
98 Ga0105240_10000544 3300009093 Bacteria 69689
99 Ga0105240_10518448 3300009093 Bacteria 1323
100 Ga0105245_10107219 3300009098 Bacteria 2593
101 Ga0105245_10347102 3300009098 Bacteria 1469
102 Ga0105247_10899020 3300009101 Bacteria 684
103 Ga0105243_10065508 3300009148 Bacteria 2919
104 Ga0105243_12055433 3300009148 Unclassified 606
105 Ga0105241_10081925 3300009174 Bacteria 2529
106 Ga0105242_10036305 3300009176 Bacteria 3953
107 Ga0105242_11354833 3300009176 Bacteria 737
108 Ga0105248_10127796 3300009177 Bacteria 2868
109 Ga0105248_10218329 3300009177 Bacteria 2147
110 Ga0105248_12829311 3300009177 Bacteria 553
111 Ga0105237_10294976 3300009545 Bacteria 1624
112 Ga0105237_10772145 3300009545 Bacteria 968
113 Ga0105249_12794255 3300009553 Bacteria 560
114 Ga0105239_10065752 3300010375 Bacteria 3983
115 Ga0157369_10024120 3300013105 Bacteria 6770
116 Ga0157369_10197825 3300013105 Bacteria 2110
117 Ga0157374_10438841 3300013296 Bacteria 1306
118 Ga0157378_10058702 3300013297 Bacteria 3431
119 Ga0157378_10497401 3300013297 Bacteria 1217
120 Ga0157378_10991235 3300013297 Bacteria 874
121 Ga0163162_10018751 3300013306 Bacteria 6782
122 Ga0163162_10176475 3300013306 Bacteria 2262
123 Ga0163162_11045203 3300013306 Bacteria 924
124 Ga0157372_11483081 3300013307 Bacteria 781
125 Ga0157375_10031434 3300013308 Bacteria 5020
126 Ga0157375_10058980 3300013308 Bacteria 3800
127 Ga0163163_10114624 3300014325 Bacteria 2726
128 Ga0163163_10297535 3300014325 Bacteria 1666
129 Ga0163163_10457158 3300014325 Bacteria 1337
130 Ga0157380_10072510 3300014326 Bacteria 2790
131 Ga0157379_10120248 3300014968 Bacteria 2362
132 Ga0157379_10564594 3300014968 Bacteria 1060
133 Ga0157376_11249017 3300014969 Bacteria 772
134 Ga0163161_10153214 3300017792 Bacteria 1753
135 Ga0213872_10406939 3300021361 Bacteria 551
136 Ga0213876_10001819 3300021384 Bacteria 12880
137 Ga0207682_10011622 3300025893 Bacteria 3439
138 Ga0207642_10084657 3300025899 Bacteria 1549
139 Ga0207680_10652121 3300025903 Bacteria 754
140 Ga0207645_10181717 3300025907 Bacteria 1380
141 Ga0207645_10244581 3300025907 Bacteria 1186
142 Ga0207707_10038640 3300025912 Bacteria 4170
143 Ga0207707_10217286 3300025912 Bacteria 1664
144 Ga0207695_10003716 3300025913 Bacteria 21243
145 Ga0207695_10724964 3300025913 Bacteria 874
146 Ga0207671_10266034 3300025914 Bacteria 1350
147 Ga0207681_10085259 3300025923 Bacteria 2241
148 Ga0207650_10056051 3300025925 Bacteria 2927
149 Ga0207650_10181979 3300025925 Bacteria 1675
150 Ga0207650_10250255 3300025925 Bacteria 1434
151 Ga0207659_10015393 3300025926 Bacteria 4955
152 Ga0207687_10818053 3300025927 Bacteria 795
153 Ga0207644_10198293 3300025931 Bacteria 1582
154 Ga0207706_10026379 3300025933 Bacteria 5201
155 Ga0207686_10051019 3300025934 Bacteria 2575
156 Ga0207709_10134751 3300025935 Bacteria 1689
157 Ga0207670_10605177 3300025936 Bacteria 900
158 Ga0207669_10225566 3300025937 Bacteria 1378
159 Ga0207704_10131541 3300025938 Bacteria 1734
160 Ga0207704_10343030 3300025938 Bacteria 1160
161 Ga0207691_10025558 3300025940 Bacteria 5542
162 Ga0207691_10090599 3300025940 Bacteria 2741
163 Ga0207711_10029812 3300025941 Bacteria 4603
164 Ga0207711_11805584 3300025941 Bacteria 555
165 Ga0207689_10005582 3300025942 Bacteria 11215
166 Ga0207679_11785691 3300025945 Bacteria 562
167 Ga0207667_10252552 3300025949 Bacteria 1804
168 Ga0207651_10018577 3300025960 Bacteria 4142
169 Ga0207668_10001739 3300025972 Bacteria 12763
170 Ga0207640_10196623 3300025981 Bacteria 1524
171 Ga0207658_10860941 3300025986 Bacteria 824
172 Ga0207677_11271939 3300026023 Bacteria 675
173 Ga0207703_10060054 3300026035 Bacteria 3107
174 Ga0207703_10164824 3300026035 Bacteria 1944
175 Ga0207639_10192408 3300026041 Bacteria 1743
176 Ga0207641_10006114 3300026088 Bacteria 10189
177 Ga0207641_11196604 3300026088 Bacteria 759
178 Ga0207641_11935582 3300026088 Bacteria 591
179 Ga0207648_10016510 3300026089 Bacteria 6742
180 Ga0207648_10096757 3300026089 Bacteria 2583
181 Ga0207676_10051762 3300026095 Bacteria 3207
182 Ga0207676_10140368 3300026095 Bacteria 2067
183 Ga0207674_10025459 3300026116 Bacteria 6310
184 Ga0207675_100012304 3300026118 Bacteria 7994
185 Ga0207683_10215222 3300026121 Bacteria 1750
186 Ga0207698_10144880 3300026142 Bacteria 2053
187 Ga0207698_10797096 3300026142 Bacteria 947
188 Ga0209969_1000586 3300027360 Bacteria 4878
189 Ga0209967_1001376 3300027364 Bacteria 3126
190 Ga0209996_1000878 3300027395 Bacteria 3538
191 Ga0210000_1012322 3300027462 Bacteria 1270
192 Ga0209995_1001460 3300027471 Bacteria 3649
193 Ga0209999_1003756 3300027543 Bacteria 2722
194 Ga0209982_1014159 3300027552 Bacteria 1204
195 Ga0209983_1001701 3300027665 Bacteria 4860
196 Ga0268266_11135012 3300028379 Bacteria 756
197 Ga0268265_10075574 3300028380 Bacteria 2639
198 Ga0268265_10124256 3300028380 Bacteria 2132
199 Ga0268264_10014680 3300028381 Bacteria 6437
200 Ga0268264_10048958 3300028381 Bacteria 3515
201 Ga0268264_10822498 3300028381 Bacteria 929
202 Ga0265323_10023367 3300028653 Bacteria 2357
203 Ga0265332_10331613 3300031238 Unclassified 628
204 Ga0307408_101102372 3300031548 Bacteria 736
205 Ga0316579_10000680 3300031691 Bacteria 11539
206 Ga0316576_10001385 3300031727 Bacteria 12945
207 Ga0316576_10003713 3300031727 Bacteria 9011
208 Ga0316576_10013218 3300031727 Bacteria 5477
209 Ga0316576_10027427 3300031727 Bacteria 4005
210 Ga0316576_10027936 3300031727 Bacteria 3970
211 Ga0316576_10040956 3300031727 Bacteria 3332
212 Ga0316578_10004300 3300031728 Bacteria 6692
213 Ga0316578_10015232 3300031728 Bacteria 4130
214 Ga0316578_10056859 3300031728 Bacteria 2298
215 Ga0316578_10087861 3300031728 Bacteria 1854
216 Ga0316577_10006328 3300031733 Bacteria 6248
217 Ga0316577_10036803 3300031733 Bacteria 2737
218 Ga0307416_100515667 3300032002 Bacteria 1263
219 Ga0307416_101003713 3300032002 Bacteria 938
220 Ga0307411_11693920 3300032005 Bacteria 585
221 Ga0316583_10006575 3300032133 Bacteria 4178
222 Ga0316585_10036769 3300032137 Bacteria 1552
223 Ga0316585_10071984 3300032137 Bacteria 1122
224 Ga0316585_10243762 3300032137 Unclassified 595
225 Ga0316580_10014422 3300032139 Bacteria 2413
226 Ga0316580_10120681 3300032139 Bacteria 802
227 Ga0316593_10001504 3300032168 Bacteria 5163
228 Ga0316593_10022721 3300032168 Bacteria 1973
229 Ga0316592_1001990 3300033524 Bacteria 3454
230 Ga0316592_1015006 3300033524 Bacteria 1611
231 Ga0316586_1000604 3300033527 Bacteria 3581
232 Ga0316588_1000719 3300033528 Bacteria 4871
233 Ga0316588_1003643 3300033528 Bacteria 2837
234 Ga0316596_1010323 3300033541 Bacteria 2256
235 Ga0316596_1184748 3300033541 Bacteria 578
236 Ga0373955_0865247 3300035172 Bacteria 556
237 Ga0316574_0012858 3300035398 Bacteria 4799
238 Ga0316574_0345405 3300035398 Bacteria 942
239 Ga0316574_0449353 3300035398 Bacteria 807
240 Ga0316574_0657377 3300035398 Bacteria 645
241 Ga0373924_0002604 3300035410 Bacteria 6086
242 Ga0373933_0334058 3300035724 Bacteria 983
243 Ga0373937_0672810 3300036401 Bacteria 981
244 Ga0373937_0859401 3300036401 Bacteria 856
245 Ga0316582_0009953 3300036647 Bacteria 5185
246 Ga0316582_0014823 3300036647 Bacteria 4438
247 Ga0316582_0019203 3300036647 Bacteria 3995
248 Ga0316582_0020918 3300036647 Bacteria 3856
249 Ga0316582_1235899 3300036647 Bacteria 508
250 Ga0316584_0004866 3300036712 Bacteria 8934
251 Ga0316584_0010692 3300036712 Bacteria 6427
252 Ga0316584_0010832 3300036712 Bacteria 6385
253 Ga0316584_0030476 3300036712 Bacteria 3984
254 Ga0316584_0030686 3300036712 Bacteria 3971
255 Ga0316584_0064110 3300036712 Unclassified 2751
256 Ga0316584_0557207 3300036712 Bacteria 799
257 Ga0395905_0172413 3300037471 Bacteria 2032
258 Ga0316581_0058221 3300037588 Bacteria 1185
259 Ga0436364_0798014 3300037853 Bacteria 612
260 Ga0436365_0102759 3300039437 Bacteria 44403
261 Ga0436360_0842129 3300039438 Bacteria 1351
262 Ga0436361_1178024 3300039447 Bacteria 617
263 Ga0451793_1766381 3300041452 Bacteria 840
264 Ga0451807_1790501 3300041486 Bacteria 1254
265 Ga0451853_1420903 3300041512 Bacteria 768
266 Ga0439434_0104390 3300042435 Bacteria 915
267 Ga0451577_0000070 3300042876 Bacteria 238621
268 Ga0451577_0106319 3300042876 Bacteria 2508
269 Ga0451577_0417408 3300042876 Unclassified 1218
270 Ga0451577_1082813 3300042876 Bacteria 718
271 Ga0453684_0009437 3300044712 Bacteria 17068
272 Ga0453684_0042955 3300044712 Bacteria 6084
273 Ga0451576_0218773 3300045051 Bacteria 1989
274 Ga0451576_0965460 3300045051 Bacteria 893
275 Ga0495636_0010671 3300047318 Bacteria 3631
276 Ga0495680_0665291 3300047322 Bacteria 691
277 Ga0496100_0263474 3300048903 Unclassified 1279
278 Ga0496103_0340210 3300048906 Bacteria 965
279 Ga0496106_0002698 3300048909 Bacteria 13163
280 Ga0496106_0583218 3300048909 Bacteria 896
281 Ga0496108_0067149 3300048911 Bacteria 3025
282 Ga0496109_0839037 3300048912 Bacteria 857
283 Ga0496112_1198055 3300048915 Bacteria 676
284 Ga0496114_1122064 3300048917 Bacteria 671
285 Ga0496118_0110898 3300048921 Bacteria 1821
286 Ga0496118_0158506 3300048921 Bacteria 1404
287 Ga0496121_0077873 3300048924 Bacteria 2638
288 Ga0496126_0000538 3300048929 Bacteria 73271
289 Ga0496126_0257886 3300048929 Bacteria 1451
290 Ga0501298_093656 3300049521 Unclassified 676
291 Ga0501033_0197045 3300049570 Bacteria 1440
292 Ga0501034_0929264 3300049571 Bacteria 756
293 Ga0501036_0148538 3300049572 Bacteria 1977
294 Ga0501036_0359630 3300049572 Bacteria 1215
295 Ga0501037_0071744 3300049573 Bacteria 2519
296 Ga0501037_0202671 3300049573 Bacteria 1402
297 Ga0501038_0092079 3300049574 Bacteria 2539
298 Ga0501039_0014336 3300049575 Bacteria 6069
299 Ga0501039_0415509 3300049575 Bacteria 1057
300 Ga0501040_0126428 3300049576 Bacteria 1796
301 Ga0501041_0024612 3300049577 Bacteria 3615
302 Ga0501042_0098732 3300049578 Bacteria 2099
303 Ga0501042_0321126 3300049578 Bacteria 1119
304 Ga0501043_0546728 3300049579 Bacteria 861
305 Ga0501046_0068169 3300049580 Bacteria 2769
306 Ga0501047_0186743 3300049581 Bacteria 1938
307 Ga0501047_0359867 3300049581 Bacteria 1291
308 Ga0501048_0307434 3300049582 Bacteria 1128
309 Ga0501048_0676697 3300049582 Bacteria 741
310 Ga0501048_1326199 3300049582 Bacteria 517
311 Ga0501071_0698241 3300049587 Bacteria 781
312 Ga0501071_1540713 3300049587 Unclassified 513
313 Ga0501072_0096055 3300049588 Bacteria 2355
314 Ga0501072_1111151 3300049588 Unclassified 615
315 Ga0501073_0095394 3300049589 Bacteria 2066
316 Ga0501075_0020698 3300049591 Bacteria 4787
317 Ga0501076_0044309 3300049592 Bacteria 3508
318 Ga0501077_0154927 3300049593 Bacteria 1454
319 Ga0501198_019515 3300049649 Bacteria 1069
320 Ga0501198_064408 3300049649 Bacteria 679
321 Ga0501227_141997 3300049665 Bacteria 659
322 Ga0501243_000154 3300049675 Bacteria 7964
323 Ga0501079_0000195 3300049741 Bacteria 35055
324 Ga0501080_0076742 3300049742 Bacteria 3107
325 Ga0501080_0624627 3300049742 Bacteria 955
326 Ga0501081_0032149 3300049743 Bacteria 3559
327 Ga0501081_1296450 3300049743 Bacteria 552
328 Ga0501083_0000004 3300049744 Bacteria 207886
329 Ga0501083_0053991 3300049744 Bacteria 2697
330 Ga0501283_023875 3300049779 Unclassified 994
331 Ga0501035_0117846 3300049822 Bacteria 2323
332 Ga0501035_0230072 3300049822 Bacteria 1580
333 Ga0501044_0044743 3300049823 Bacteria 4591
334 Ga0501044_0192229 3300049823 Bacteria 2003
335 Ga0501045_0053932 3300049824 Bacteria 2938
336 Ga0501045_0525933 3300049824 Bacteria 878
337 nmdc:mga0k408_30197_c1 3300050493 Bacteria 3089
338 Ga0495595_0220066 3300053084 Bacteria 947
339 Ga0500568_0000009 3300053139 Bacteria 270298
340 Ga0501084_0101478 3300054114 Bacteria 2416
341 Ga0590074_082970 3300059423 Bacteria 613
342 Ga0590077_137392 3300059426 Bacteria 582
343 Ga0501082_0036702 3300060353 Bacteria 4222
344 Ga0501082_0698077 3300060353 Bacteria 888
345 2501074256 2501025501 Bacteria 7768574
346 2501408024 2501025504 Bacteria 8008976
347 2511095768 2510917014 Bacteria 8296963
348 2511103479 2510917015 Bacteria 7950052
349 2513554263 2513237082 Bacteria 8640282
350 2513562541 2513237083 Bacteria 8410967
351 2516021562 2515154189 Bacteria 9629850
352 2788437190 2786546940 Bacteria 6396474
353 2856288558 2856287931 Bacteria 7223934
354 2857367014 2857357740 Bacteria 9937880
355 2883095243 2883087390 Bacteria 9532701
356 8003959749 8003955200 Bacteria 8601927
357 8004215282 8004212874 Bacteria 2861420
358 Ga0501079_0459287
359 rootH2_10093055
360 rootH2_10236374
361 rootH1_10121452
362 rootH1_10221549
363 Ga0070676_10110806
364 Ga0070690_100473503
365 Ga0070670_100012062
366 Ga0070670_100016760
367 Ga0070670_100023001
368 Ga0070677_10056384
369 Ga0068869_100019896
370 Ga0070666_10914328
371 Ga0070680_100241429
372 Ga0068868_101865312
373 Ga0070687_100104018
374 Ga0070692_11184643
375 Ga0070668_100002563
376 Ga0070669_100058258
377 Ga0070669_100105951
378 Ga0070675_100375888
379 Ga0070671_100157695
380 Ga0070671_100229407
381 Ga0070671_101985881
382 Ga0070673_100014659
383 Ga0070688_100115404
384 Ga0070688_100314527
385 Ga0070667_100128889
386 Ga0070667_100428593
387 Ga0070701_10085981
388 Ga0070705_100139732
389 Ga0070700_100035911
390 Ga0070694_100991114
391 Ga0070694_101813395
392 Ga0070708_100108887
393 Ga0070678_100056342
394 Ga0070662_100224230
395 Ga0070681_10073727
396 Ga0070681_10252119
397 Ga0068867_100025877
398 Ga0068867_100037605
399 Ga0070685_10046851
400 Ga0070698_101952985
401 Ga0070699_101864097
402 Ga0070679_100630263
403 Ga0070679_101586339
404 Ga0070684_100944792
405 Ga0068853_100036535
406 Ga0068853_100594887
407 Ga0068853_102148802
408 Ga0070672_100002996
409 Ga0070672_100101140
410 Ga0070686_100334479
411 Ga0070665_100045169
412 Ga0070665_101346414
413 Ga0070704_100688793
414 Ga0070704_101828403
415 Ga0068855_100296603
416 Ga0070664_101983965
417 Ga0068857_100044264
418 Ga0068854_100199994
419 Ga0068852_100314179
420 Ga0068852_101096208
421 Ga0068859_100014700
422 Ga0068859_101523116
423 Ga0068859_101880980
424 Ga0068859_102316890
425 Ga0068864_100016251
426 Ga0068864_100104378
427 Ga0068864_100286633
428 Ga0068861_100021984
429 Ga0068861_101776811
430 Ga0068870_10038987
431 Ga0068863_100008037
432 Ga0068863_100132834
433 Ga0068863_100468605
434 Ga0068863_102174648
435 Ga0068858_100056657
436 Ga0068858_101250901
437 Ga0068860_100040190
438 Ga0068860_100069675
439 Ga0068860_100851764
440 Ga0068862_100021707
441 Ga0081539_10173873
442 Ga0075366_10019019
443 Ga0097621_100009490
444 Ga0068871_100238892
445 Ga0075428_100629704
446 Ga0075430_101141431
447 Ga0075431_100474588
448 Ga0068865_100156666
449 Ga0068865_100727146
450 Ga0075436_100612552
451 Ga0097620_100014700
452 Ga0097620_101523617
453 Ga0097620_101881127
454 Ga0097620_102316149
455 Ga0105240_10000544
456 Ga0105240_10518448
457 Ga0105245_10107219
458 Ga0105245_10347102
459 Ga0105247_10899020
460 Ga0105243_10065508
461 Ga0105243_12055433
462 Ga0105241_10081925
463 Ga0105242_10036305
464 Ga0105242_11354833
465 Ga0105248_10127796
466 Ga0105248_10218329
467 Ga0105248_12829311
468 Ga0105237_10294976
469 Ga0105237_10772145
470 Ga0105249_12794255
471 Ga0105239_10065752
472 Ga0157369_10024120
473 Ga0157369_10197825
474 Ga0157374_10438841
475 Ga0157378_10058702
476 Ga0157378_10497401
477 Ga0157378_10991235
478 Ga0163162_10018751
479 Ga0163162_10176475
480 Ga0163162_11045203
481 Ga0157372_11483081
482 Ga0157375_10031434
483 Ga0157375_10058980
484 Ga0163163_10114624
485 Ga0163163_10297535
486 Ga0163163_10457158
487 Ga0157380_10072510
488 Ga0157379_10120248
489 Ga0157379_10564594
490 Ga0157376_11249017
491 Ga0163161_10153214
492 Ga0213872_10406939
493 Ga0213876_10001819
494 Ga0207682_10011622
495 Ga0207642_10084657
496 Ga0207680_10652121
497 Ga0207645_10181717
498 Ga0207645_10244581
499 Ga0207707_10038640
500 Ga0207707_10217286
501 Ga0207695_10003716
502 Ga0207695_10724964
503 Ga0207671_10266034
504 Ga0207681_10085259
505 Ga0207650_10056051
506 Ga0207650_10181979
507 Ga0207650_10250255
508 Ga0207659_10015393
509 Ga0207687_10818053
510 Ga0207644_10198293
511 Ga0207706_10026379
512 Ga0207686_10051019
513 Ga0207709_10134751
514 Ga0207670_10605177
515 Ga0207669_10225566
516 Ga0207704_10131541
517 Ga0207704_10343030
518 Ga0207691_10025558
519 Ga0207691_10090599
520 Ga0207711_10029812
521 Ga0207711_11805584
522 Ga0207689_10005582
523 Ga0207679_11785691
524 Ga0207667_10252552
525 Ga0207651_10018577
526 Ga0207668_10001739
527 Ga0207640_10196623
528 Ga0207658_10860941
529 Ga0207677_11271939
530 Ga0207703_10060054
531 Ga0207703_10164824
532 Ga0207639_10192408
533 Ga0207641_10006114
534 Ga0207641_11196604
535 Ga0207641_11935582
536 Ga0207648_10016510
537 Ga0207648_10096757
538 Ga0207676_10051762
539 Ga0207676_10140368
540 Ga0207674_10025459
541 Ga0207675_100012304
542 Ga0207683_10215222
543 Ga0207698_10144880
544 Ga0207698_10797096
545 Ga0209969_1000586
546 Ga0209967_1001376
547 Ga0209996_1000878
548 Ga0210000_1012322
549 Ga0209995_1001460
550 Ga0209999_1003756
551 Ga0209982_1014159
552 Ga0209983_1001701
553 Ga0268266_11135012
554 Ga0268265_10075574
555 Ga0268265_10124256
556 Ga0268264_10014680
557 Ga0268264_10048958
558 Ga0268264_10822498
559 Ga0265323_10023367
560 Ga0265332_10331613
561 Ga0307408_101102372
562 Ga0316579_10000680
563 Ga0316576_10001385
564 Ga0316576_10003713
565 Ga0316576_10013218
566 Ga0316576_10027427
567 Ga0316576_10027936
568 Ga0316576_10040956
569 Ga0316578_10004300
570 Ga0316578_10015232
571 Ga0316578_10056859
572 Ga0316578_10087861
573 Ga0316577_10006328
574 Ga0316577_10036803
575 Ga0307416_100515667
576 Ga0307416_101003713
577 Ga0307411_11693920
578 Ga0316583_10006575
579 Ga0316585_10036769
580 Ga0316585_10071984
581 Ga0316585_10243762
582 Ga0316580_10014422
583 Ga0316580_10120681
584 Ga0316593_10001504
585 Ga0316593_10022721
586 Ga0316592_1001990
587 Ga0316592_1015006
588 Ga0316586_1000604
589 Ga0316588_1000719
590 Ga0316588_1003643
591 Ga0316596_1010323
592 Ga0316596_1184748
593 Ga0373955_0865247
594 Ga0316574_0012858
595 Ga0316574_0345405
596 Ga0316574_0449353
597 Ga0316574_0657377
598 Ga0373924_0002604
599 Ga0373933_0334058
600 Ga0373937_0672810
601 Ga0373937_0859401
602 Ga0316582_0009953
603 Ga0316582_0014823
604 Ga0316582_0019203
605 Ga0316582_0020918
606 Ga0316582_1235899
607 Ga0316584_0004866
608 Ga0316584_0010692
609 Ga0316584_0010832
610 Ga0316584_0030476
611 Ga0316584_0030686
612 Ga0316584_0064110
613 Ga0316584_0557207
614 Ga0395905_0172413
615 Ga0316581_0058221
616 Ga0436364_0798014
617 Ga0436365_0102759
618 Ga0436360_0842129
619 Ga0436361_1178024
620 Ga0451793_1766381
621 Ga0451807_1790501
622 Ga0451853_1420903
623 Ga0439434_0104390
624 Ga0451577_0000070
625 Ga0451577_0106319
626 Ga0451577_0417408
627 Ga0451577_1082813
628 Ga0453684_0009437
629 Ga0453684_0042955
630 Ga0451576_0218773
631 Ga0451576_0965460
632 Ga0495636_0010671
633 Ga0495680_0665291
634 Ga0496100_0263474
635 Ga0496103_0340210
636 Ga0496106_0002698
637 Ga0496106_0583218
638 Ga0496108_0067149
639 Ga0496109_0839037
640 Ga0496112_1198055
641 Ga0496114_1122064
642 Ga0496118_0110898
643 Ga0496118_0158506
644 Ga0496121_0077873
645 Ga0496126_0000538
646 Ga0496126_0257886
647 Ga0501298_093656
648 Ga0501033_0197045
649 Ga0501034_0929264
650 Ga0501036_0148538
651 Ga0501036_0359630
652 Ga0501037_0071744
653 Ga0501037_0202671
654 Ga0501038_0092079
655 Ga0501039_0014336
656 Ga0501039_0415509
657 Ga0501040_0126428
658 Ga0501041_0024612
659 Ga0501042_0098732
660 Ga0501042_0321126
661 Ga0501043_0546728
662 Ga0501046_0068169
663 Ga0501047_0186743
664 Ga0501047_0359867
665 Ga0501048_0307434
666 Ga0501048_0676697
667 Ga0501048_1326199
668 Ga0501071_0698241
669 Ga0501071_1540713
670 Ga0501072_0096055
671 Ga0501072_1111151
672 Ga0501073_0095394
673 Ga0501075_0020698
674 Ga0501076_0044309
675 Ga0501077_0154927
676 Ga0501198_019515
677 Ga0501198_064408
678 Ga0501227_141997
679 Ga0501243_000154
680 Ga0501079_0000195
681 Ga0501080_0076742
682 Ga0501080_0624627
683 Ga0501081_0032149
684 Ga0501081_1296450
685 Ga0501083_0000004
686 Ga0501083_0053991
687 Ga0501283_023875
688 Ga0501035_0117846
689 Ga0501035_0230072
690 Ga0501044_0044743
691 Ga0501044_0192229
692 Ga0501045_0053932
693 Ga0501045_0525933
694 nmdc:mga0k408_30197_c1
695 Ga0495595_0220066
696 Ga0500568_0000009
697 Ga0501084_0101478
698 Ga0590074_082970
699 Ga0590077_137392
700 Ga0501082_0036702
701 Ga0501082_0698077
702 2501074256
703 2501408024
704 2511095768
705 2511103479
706 2513554263
707 2513562541
708 2516021562
709 2788437190
710 2856288558
711 2857367014
712 2883095243
713 8003959749
714 8004215282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12643

MazG-like

MazG-like family

47

130

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mu5-assembly1.cif.gz_C human dctpp1 bound to triptolide 0.8924 3 107
2oie-assembly1.cif.gz_C crystal structure of rs21-c6 core segment rscut 0.8919 3 97
7mu5-assembly1.cif.gz_E human dctpp1 bound to triptolide 0.8897 3 107
7mu5-assembly2.cif.gz_H human dctpp1 bound to triptolide 0.8885 3 107
7mu5-assembly2.cif.gz_F human dctpp1 bound to triptolide 0.888 3 107
ID Description Score Start End Superfamily
2oieC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8919 3 97 1.10.287.1080
2oigB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8854 3 98 1.10.287.1080
2oigD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8828 3 100 1.10.287.1080
af_C6T106_4_117_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8696 3 112 1.10.287.1080
2oieA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8695 1 98 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A0A6QG95-F1-model_v4 deleted 0.9792 13 113
AF-A0A412ULK5-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9763 12 110 GO:0009143
GO:0047429
AF-A0A3L6JHM1-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9759 15 109 GO:0009143
GO:0047429
AF-A0A640VXS4-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9754 11 110 GO:0009143
GO:0047429
AF-A0A7V0SDV8-F1-model_v4 Nucleotide pyrophosphohydrolase 0.9691 8 110 GO:0009143
GO:0047429

Map