F420933

General Info

Members Datasets Scaffolds Average Seq Length
357 213 714 131

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0313197|Ga0466960_0313197_63_530
Length 155
Sequence MSSGALRGQREHHPPLSKEEVVSKTATRLSKVGVVVIPVTDQERAIEFYVDTLGFEKRADVPFGNGYRWVEVAPAGADTTIAIVPPPEGQEAGDRQTGIGLQTDDIDAVHADLKARGVDVDDEVSRMGDPVPPLFWFRDPDGNVLMVVDVSGGPA

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 2.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 15.41
Rhizosphere 81.79
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0313197 3300044901 Bacteria 887
2 JGI24737J22298_10210600 3300001990 Bacteria 573
3 Ga0058862_12520568 3300004803 Unclassified 502
4 Ga0070658_11514259 3300005327 Bacteria 582
5 Ga0070676_10368383 3300005328 Unclassified 992
6 Ga0070683_100530979 3300005329 Bacteria 1124
7 Ga0070690_100314883 3300005330 Bacteria 1126
8 Ga0070690_100855545 3300005330 Bacteria 709
9 Ga0068869_100230338 3300005334 Bacteria 1472
10 Ga0070680_100232528 3300005336 Unclassified 1557
11 Ga0070682_100049080 3300005337 Bacteria 2631
12 Ga0068868_100054383 3300005338 Bacteria 3154
13 Ga0068868_100874647 3300005338 Bacteria 815
14 Ga0070660_100465621 3300005339 Bacteria 1050
15 Ga0070689_100063023 3300005340 Bacteria 2885
16 Ga0070687_100652094 3300005343 Bacteria 730
17 Ga0070661_101228692 3300005344 Bacteria 627
18 Ga0070692_10567662 3300005345 Unclassified 746
19 Ga0070668_100163618 3300005347 Bacteria 1807
20 Ga0070668_100780141 3300005347 Bacteria 848
21 Ga0070669_100500700 3300005353 Bacteria 1008
22 Ga0070671_100260174 3300005355 Bacteria 1475
23 Ga0070671_100574602 3300005355 Bacteria 973
24 Ga0070674_100529565 3300005356 Bacteria 986
25 Ga0070673_100558387 3300005364 Bacteria 1041
26 Ga0070688_100049988 3300005365 Bacteria 2603
27 Ga0070688_101277910 3300005365 Bacteria 592
28 Ga0070659_100278349 3300005366 Unclassified 1391
29 Ga0070659_101062059 3300005366 Bacteria 713
30 Ga0070659_101066937 3300005366 Bacteria 711
31 Ga0070667_101033869 3300005367 Bacteria 767
32 Ga0070714_100093013 3300005435 Bacteria 2644
33 Ga0070714_100185430 3300005435 Bacteria 1896
34 Ga0070714_100608336 3300005435 Bacteria 1050
35 Ga0070714_101310206 3300005435 Bacteria 707
36 Ga0070713_100435043 3300005436 Bacteria 1230
37 Ga0070701_10053743 3300005438 Bacteria 2097
38 Ga0070711_100018936 3300005439 Bacteria 4406
39 Ga0070711_101221071 3300005439 Bacteria 651
40 Ga0070705_100239031 3300005440 Bacteria 1268
41 Ga0070705_100285277 3300005440 Bacteria 1176
42 Ga0070700_100699797 3300005441 Bacteria 806
43 Ga0070694_101535827 3300005444 Bacteria 564
44 Ga0070663_101152205 3300005455 Bacteria 680
45 Ga0070681_10976612 3300005458 Unclassified 766
46 Ga0068867_101121976 3300005459 Bacteria 719
47 Ga0070685_10126719 3300005466 Bacteria 1591
48 Ga0070679_100111602 3300005530 Bacteria 2721
49 Ga0070679_100308754 3300005530 Bacteria 1532
50 Ga0070684_100026820 3300005535 Bacteria 4857
51 Ga0070684_100343918 3300005535 Bacteria 1371
52 Ga0070684_100465741 3300005535 Bacteria 1169
53 Ga0070684_101316333 3300005535 Bacteria 680
54 Ga0068853_100701121 3300005539 Bacteria 966
55 Ga0070693_100530108 3300005547 Bacteria 840
56 Ga0070704_100660539 3300005549 Unclassified 924
57 Ga0070664_100431642 3300005564 Bacteria 1208
58 Ga0068857_101067974 3300005577 Bacteria 779
59 Ga0070702_100498626 3300005615 Bacteria 894
60 Ga0068852_100271860 3300005616 Bacteria 1631
61 Ga0068864_101685179 3300005618 Bacteria 639
62 Ga0068866_10112205 3300005718 Bacteria 1523
63 Ga0068866_10389892 3300005718 Bacteria 895
64 Ga0068861_100126338 3300005719 Bacteria 2069
65 Ga0068861_101179328 3300005719 Bacteria 739
66 Ga0068851_10214297 3300005834 Bacteria 1080
67 Ga0068870_10188921 3300005840 Bacteria 1241
68 Ga0068863_101237512 3300005841 Bacteria 753
69 Ga0068858_100339950 3300005842 Bacteria 1437
70 Ga0068860_100277615 3300005843 Bacteria 1637
71 Ga0068862_100777112 3300005844 Unclassified 934
72 Ga0081455_10070915 3300005937 Bacteria 2891
73 Ga0081455_10204077 3300005937 Bacteria 1478
74 Ga0081455_10305220 3300005937 Bacteria 1140
75 Ga0075365_11164787 3300006038 Bacteria 542
76 Ga0075433_10122491 3300006852 Bacteria 2310
77 Ga0105240_12413948 3300009093 Unclassified 544
78 Ga0111539_10423993 3300009094 Unclassified 1549
79 Ga0111539_11391057 3300009094 Bacteria 814
80 Ga0105245_10205817 3300009098 Bacteria 1892
81 Ga0105245_10206410 3300009098 Bacteria 1889
82 Ga0105245_10296428 3300009098 Bacteria 1585
83 Ga0105245_11046348 3300009098 Bacteria 861
84 Ga0105245_11316124 3300009098 Bacteria 772
85 Ga0105247_10898508 3300009101 Bacteria 684
86 Ga0105243_10009350 3300009148 Bacteria 7472
87 Ga0105243_10299234 3300009148 Unclassified 1457
88 Ga0105243_10559715 3300009148 Bacteria 1094
89 Ga0105242_10203716 3300009176 Bacteria 1759
90 Ga0105242_10249181 3300009176 Bacteria 1600
91 Ga0105248_10561768 3300009177 Bacteria 1287
92 Ga0105238_10658933 3300009551 Bacteria 1057
93 Ga0105238_10843226 3300009551 Bacteria 933
94 Ga0105238_12015635 3300009551 Unclassified 611
95 Ga0105238_12572717 3300009551 Bacteria 545
96 Ga0105249_10046411 3300009553 Bacteria 3953
97 Ga0105249_11747060 3300009553 Bacteria 695
98 Ga0105249_13141946 3300009553 Bacteria 531
99 Ga0105239_11028099 3300010375 Unclassified 948
100 Ga0157321_1027492 3300012487 Bacteria 561
101 Ga0157371_10917091 3300013102 Bacteria 665
102 Ga0157369_10714750 3300013105 Bacteria 1031
103 Ga0157374_10852927 3300013296 Bacteria 928
104 Ga0157378_11290201 3300013297 Bacteria 771
105 Ga0157378_11379775 3300013297 Bacteria 747
106 Ga0163162_10398343 3300013306 Bacteria 1509
107 Ga0163162_10772754 3300013306 Bacteria 1079
108 Ga0157372_10082178 3300013307 Bacteria 3647
109 Ga0157372_10149854 3300013307 Bacteria 2691
110 Ga0157372_10300469 3300013307 Bacteria 1867
111 Ga0157372_10516103 3300013307 Bacteria 1393
112 Ga0157372_10716723 3300013307 Bacteria 1164
113 Ga0157375_10089041 3300013308 Bacteria 3142
114 Ga0157375_10223560 3300013308 Bacteria 2041
115 Ga0157375_11063885 3300013308 Bacteria 946
116 Ga0163163_10365035 3300014325 Bacteria 1501
117 Ga0163163_11444133 3300014325 Bacteria 749
118 Ga0157380_10278944 3300014326 Bacteria 1528
119 Ga0157380_10669687 3300014326 Bacteria 1038
120 Ga0157380_13165411 3300014326 Bacteria 525
121 Ga0182008_10448835 3300014497 Bacteria 701
122 Ga0157379_10056485 3300014968 Bacteria 3507
123 Ga0157379_10341253 3300014968 Bacteria 1370
124 Ga0197907_10526356 3300020069 Bacteria 798
125 Ga0206351_10966868 3300020077 Bacteria 1060
126 Ga0206350_10146702 3300020080 Bacteria 935
127 Ga0206354_11215039 3300020081 Bacteria 514
128 Ga0206353_10286486 3300020082 Bacteria 586
129 Ga0206353_10389026 3300020082 Unclassified 681
130 Ga0206353_11738982 3300020082 Bacteria 750
131 Ga0213875_10000050 3300021388 Bacteria 143822
132 Ga0224712_10119992 3300022467 Bacteria 1138
133 Ga0207692_10287933 3300025898 Bacteria 996
134 Ga0207642_10018765 3300025899 Bacteria 2663
135 Ga0207710_10348828 3300025900 Bacteria 754
136 Ga0207688_10031678 3300025901 Bacteria 2921
137 Ga0207688_11034159 3300025901 Bacteria 519
138 Ga0207680_10414847 3300025903 Unclassified 953
139 Ga0207647_10349435 3300025904 Bacteria 837
140 Ga0207647_10538356 3300025904 Bacteria 649
141 Ga0207693_10346866 3300025915 Bacteria 1162
142 Ga0207663_10442949 3300025916 Bacteria 1001
143 Ga0207660_10220494 3300025917 Unclassified 1488
144 Ga0207662_10106408 3300025918 Bacteria 1744
145 Ga0207657_10291803 3300025919 Bacteria 1293
146 Ga0207652_11139606 3300025921 Bacteria 681
147 Ga0207694_10729724 3300025924 Bacteria 836
148 Ga0207687_10093163 3300025927 Bacteria 2202
149 Ga0207687_10426288 3300025927 Bacteria 1096
150 Ga0207687_11082904 3300025927 Bacteria 688
151 Ga0207687_11235080 3300025927 Unclassified 642
152 Ga0207700_10272931 3300025928 Bacteria 1452
153 Ga0207700_10790494 3300025928 Bacteria 849
154 Ga0207664_10486268 3300025929 Bacteria 1104
155 Ga0207664_11116845 3300025929 Bacteria 704
156 Ga0207644_10473561 3300025931 Bacteria 1031
157 Ga0207644_11077430 3300025931 Bacteria 675
158 Ga0207690_10039368 3300025932 Bacteria 3084
159 Ga0207690_10562562 3300025932 Bacteria 928
160 Ga0207690_11479531 3300025932 Bacteria 568
161 Ga0207706_10093280 3300025933 Bacteria 2648
162 Ga0207706_10281537 3300025933 Bacteria 1450
163 Ga0207706_10493630 3300025933 Bacteria 1057
164 Ga0207686_10107870 3300025934 Bacteria 1872
165 Ga0207709_10108690 3300025935 Bacteria 1850
166 Ga0207709_10523396 3300025935 Unclassified 929
167 Ga0207670_10477772 3300025936 Bacteria 1009
168 Ga0207669_10826579 3300025937 Bacteria 770
169 Ga0207704_10493959 3300025938 Bacteria 985
170 Ga0207691_10781358 3300025940 Bacteria 803
171 Ga0207711_10881150 3300025941 Bacteria 832
172 Ga0207689_10104019 3300025942 Bacteria 2333
173 Ga0207661_10688585 3300025944 Bacteria 940
174 Ga0207661_10806358 3300025944 Bacteria 864
175 Ga0207661_11526326 3300025944 Bacteria 612
176 Ga0207679_10162433 3300025945 Bacteria 1830
177 Ga0207712_10028934 3300025961 Bacteria 3712
178 Ga0207712_10318880 3300025961 Bacteria 1282
179 Ga0207668_10126259 3300025972 Bacteria 1946
180 Ga0207668_11136596 3300025972 Bacteria 701
181 Ga0207640_10599149 3300025981 Unclassified 932
182 Ga0207658_10942037 3300025986 Bacteria 787
183 Ga0207677_12101421 3300026023 Bacteria 525
184 Ga0207703_10198559 3300026035 Bacteria 1781
185 Ga0207678_11591530 3300026067 Unclassified 576
186 Ga0207678_11676045 3300026067 Bacteria 559
187 Ga0207708_10165406 3300026075 Bacteria 1749
188 Ga0207702_10229200 3300026078 Bacteria 1735
189 Ga0207648_10114719 3300026089 Bacteria 2367
190 Ga0207676_10269986 3300026095 Bacteria 1540
191 Ga0207674_10482088 3300026116 Bacteria 1199
192 Ga0207675_100011119 3300026118 Bacteria 8433
193 Ga0207675_100093731 3300026118 Bacteria 2825
194 Ga0207683_10924047 3300026121 Bacteria 810
195 Ga0207683_11957557 3300026121 Unclassified 535
196 Ga0207698_10114426 3300026142 Bacteria 2269
197 Ga0207698_11230389 3300026142 Bacteria 763
198 Ga0207428_11126133 3300027907 Bacteria 548
199 Ga0268266_10476832 3300028379 Bacteria 1189
200 Ga0268265_10850584 3300028380 Bacteria 892
201 Ga0268264_10556838 3300028381 Bacteria 1125
202 Ga0265338_10020735 3300028800 Bacteria 6896
203 Ga0265338_10031994 3300028800 Bacteria 5143
204 Ga0265332_10029234 3300031238 Bacteria 2410
205 Ga0265328_10179254 3300031239 Bacteria 801
206 Ga0265327_10005484 3300031251 Bacteria 10576
207 Ga0265327_10050915 3300031251 Bacteria 2164
208 Ga0307408_101765989 3300031548 Unclassified 591
209 Ga0307407_10327114 3300031903 Bacteria 1078
210 Ga0307409_102417209 3300031995 Bacteria 554
211 Ga0307416_101961568 3300032002 Bacteria 688
212 Ga0307415_100509205 3300032126 Bacteria 1054
213 Ga0373932_0350000 3300035112 Unclassified 562
214 Ga0373960_0230274 3300035121 Bacteria 666
215 Ga0373946_0027120 3300035171 Bacteria 2264
216 Ga0373955_0121882 3300035172 Bacteria 1517
217 Ga0373924_0067936 3300035410 Bacteria 1500
218 Ga0373933_0137026 3300035724 Bacteria 1543
219 Ga0373937_0106563 3300036401 Bacteria 2605
220 Ga0373937_1168088 3300036401 Bacteria 718
221 Ga0373925_0057966 3300037068 Bacteria 2903
222 Ga0395899_0070848 3300037312 Bacteria 2551
223 Ga0395900_0533091 3300037418 Unclassified 1121
224 Ga0395898_0040305 3300037466 Bacteria 4619
225 Ga0395898_0634413 3300037466 Bacteria 1011
226 Ga0436364_0538307 3300037853 Bacteria 2508
227 Ga0436364_0750607 3300037853 Bacteria 104121
228 Ga0395901_0002311 3300038443 Bacteria 19439
229 Ga0395901_0003233 3300038443 Bacteria 16385
230 Ga0395901_0498990 3300038443 Unclassified 1239
231 Ga0395901_1690936 3300038443 Bacteria 584
232 Ga0466972_0342475 3300044658 Bacteria 699
233 Ga0466965_0077740 3300044683 Bacteria 1676
234 Ga0466961_0052708 3300044693 Bacteria 2597
235 Ga0466963_0002609 3300044694 Bacteria 10112
236 Ga0466963_0020148 3300044694 Bacteria 4192
237 Ga0466963_0033563 3300044694 Bacteria 3334
238 Ga0466963_0036121 3300044694 Bacteria 3221
239 Ga0466963_0325286 3300044694 Unclassified 1082
240 Ga0466963_0956994 3300044694 Bacteria 603
241 Ga0466963_1092779 3300044694 Bacteria 561
242 Ga0466964_0012976 3300044706 Bacteria 3156
243 Ga0466964_0360229 3300044706 Unclassified 750
244 Ga0466964_0426376 3300044706 Bacteria 698
245 Ga0466971_0254844 3300044719 Bacteria 836
246 Ga0466971_0561578 3300044719 Bacteria 567
247 Ga0466968_0085583 3300044735 Bacteria 1391
248 Ga0466968_0116453 3300044735 Bacteria 1206
249 Ga0466970_0620028 3300044765 Bacteria 628
250 Ga0466957_0023695 3300044842 Bacteria 3630
251 Ga0466957_0957062 3300044842 Unclassified 614
252 Ga0466960_0001316 3300044901 Bacteria 9011
253 Ga0466960_0124599 3300044901 Bacteria 1353
254 Ga0466960_0252567 3300044901 Bacteria 980
255 Ga0466960_0381969 3300044901 Unclassified 808
256 Ga0466959_0143972 3300045049 Bacteria 1683
257 Ga0466958_0036621 3300045836 Bacteria 2938
258 Ga0466958_0360016 3300045836 Bacteria 937
259 Ga0466967_0005114 3300045976 Bacteria 9013
260 Ga0466967_0013461 3300045976 Bacteria 6322
261 Ga0466967_0018435 3300045976 Bacteria 5577
262 Ga0466967_0024805 3300045976 Bacteria 4935
263 Ga0466967_0038967 3300045976 Bacteria 4081
264 Ga0466967_0164164 3300045976 Bacteria 2087
265 Ga0466967_0200645 3300045976 Bacteria 1889
266 Ga0466967_0281369 3300045976 Bacteria 1596
267 Ga0466967_0494343 3300045976 Bacteria 1200
268 Ga0466967_1569412 3300045976 Bacteria 656
269 Ga0466967_1850028 3300045976 Unclassified 601
270 Ga0495641_0016347 3300046461 Bacteria 3913
271 Ga0495651_0719267 3300046462 Bacteria 621
272 Ga0495585_0400240 3300046492 Bacteria 661
273 Ga0495608_0008395 3300046511 Bacteria 7236
274 Ga0495618_0401038 3300046514 Bacteria 839
275 Ga0495628_0504830 3300046516 Bacteria 873
276 Ga0495637_0207046 3300046520 Bacteria 719
277 Ga0495587_0305884 3300046536 Bacteria 889
278 Ga0495609_0133080 3300046538 Bacteria 1064
279 Ga0495635_0619635 3300046663 Bacteria 706
280 Ga0495588_0404347 3300046674 Bacteria 717
281 Ga0495657_0337323 3300046675 Bacteria 894
282 Ga0495676_0116331 3300047321 Bacteria 1953
283 Ga0495680_0016018 3300047322 Bacteria 6450
284 Ga0495680_0095814 3300047322 Bacteria 2218
285 Ga0495684_0416228 3300047471 Bacteria 940
286 Ga0496100_0099505 3300048903 Bacteria 2001
287 Ga0496100_0247806 3300048903 Bacteria 1317
288 Ga0496100_0353139 3300048903 Unclassified 1111
289 Ga0496101_0044590 3300048904 Bacteria 3174
290 Ga0496101_0272264 3300048904 Bacteria 1322
291 Ga0496101_0562948 3300048904 Viruses 901
292 Ga0496101_1059094 3300048904 Unclassified 637
293 Ga0496102_0422337 3300048905 Bacteria 1252
294 Ga0496102_0479535 3300048905 Bacteria 1165
295 Ga0496102_1238270 3300048905 Bacteria 666
296 Ga0496103_0043751 3300048906 Bacteria 2758
297 Ga0496103_0681669 3300048906 Bacteria 652
298 Ga0496104_0029155 3300048907 Bacteria 5118
299 Ga0496104_0125335 3300048907 Bacteria 2466
300 Ga0496104_0279751 3300048907 Bacteria 1582
301 Ga0496104_0529331 3300048907 Bacteria 1090
302 Ga0496105_0023166 3300048908 Bacteria 5034
303 Ga0496105_0080761 3300048908 Bacteria 2686
304 Ga0496105_0331414 3300048908 Bacteria 1218
305 Ga0496106_0073302 3300048909 Bacteria 2619
306 Ga0496106_0153299 3300048909 Bacteria 1818
307 Ga0496106_0191228 3300048909 Bacteria 1627
308 Ga0496106_0712940 3300048909 Bacteria 799
309 Ga0496107_0052947 3300048910 Bacteria 2928
310 Ga0496107_0153473 3300048910 Bacteria 1704
311 Ga0496107_0403503 3300048910 Bacteria 1016
312 Ga0496108_0030954 3300048911 Bacteria 4435
313 Ga0496108_0153381 3300048911 Bacteria 1988
314 Ga0496108_0201895 3300048911 Bacteria 1725
315 Ga0496109_0018070 3300048912 Bacteria 6190
316 Ga0496109_0099046 3300048912 Bacteria 2703
317 Ga0496109_0120684 3300048912 Bacteria 2442
318 Ga0496109_0255845 3300048912 Bacteria 1649
319 Ga0496109_0628350 3300048912 Bacteria 1010
320 Ga0496109_0790394 3300048912 Bacteria 887
321 Ga0496109_1010585 3300048912 Bacteria 769
322 Ga0496110_0038717 3300048913 Bacteria 4150
323 Ga0496110_0063643 3300048913 Bacteria 3259
324 Ga0496110_0318556 3300048913 Bacteria 1416
325 Ga0496110_0799333 3300048913 Bacteria 847
326 Ga0496111_0075218 3300048914 Bacteria 2460
327 Ga0496111_0088840 3300048914 Bacteria 2263
328 Ga0496111_0399729 3300048914 Bacteria 1015
329 Ga0496112_0024308 3300048915 Bacteria 5800
330 Ga0496112_0028754 3300048915 Bacteria 5369
331 Ga0496112_0106960 3300048915 Bacteria 2767
332 Ga0496112_0549906 3300048915 Bacteria 1088
333 Ga0496112_0779712 3300048915 Bacteria 881
334 Ga0496112_1558968 3300048915 Bacteria 574
335 Ga0496113_0014932 3300048916 Bacteria 5315
336 Ga0496113_0093738 3300048916 Bacteria 2318
337 Ga0496113_0211529 3300048916 Bacteria 1544
338 Ga0496114_0387738 3300048917 Bacteria 1237
339 Ga0496115_0445989 3300048918 Bacteria 1046
340 Ga0496115_0858279 3300048918 Viruses 703
341 Ga0496119_0000580 3300048922 Bacteria 49345
342 Ga0496119_0130806 3300048922 Bacteria 1368
343 Ga0496120_0060708 3300048923 Unclassified 2114
344 Ga0496121_0017150 3300048924 Bacteria 7417
345 Ga0496121_0049895 3300048924 Bacteria 3542
346 Ga0496125_0103424 3300048928 Bacteria 2090
347 Ga0501047_0053837 3300049581 Bacteria 3893
348 Ga0501069_0015992 3300049585 Bacteria 4024
349 Ga0501071_0426220 3300049587 Bacteria 1014
350 Ga0501072_0225377 3300049588 Bacteria 1494
351 Ga0501077_0714043 3300049593 Bacteria 644
352 nmdc:mga08y16_111761_c1 3300050511 Bacteria 2844
353 nmdc:mga0a205_188085_c1 3300050515 Bacteria 1957
354 Ga0495601_0098843 3300053077 Bacteria 1884
355 Ga0501084_1207856 3300054114 Bacteria 634
356 Ga0587082_127045 3300059504 Unclassified 582
357 Ga0466962_0357699 3300061719 Bacteria 727
358 Ga0466960_0313197
359 JGI24737J22298_10210600
360 Ga0058862_12520568
361 Ga0070658_11514259
362 Ga0070676_10368383
363 Ga0070683_100530979
364 Ga0070690_100314883
365 Ga0070690_100855545
366 Ga0068869_100230338
367 Ga0070680_100232528
368 Ga0070682_100049080
369 Ga0068868_100054383
370 Ga0068868_100874647
371 Ga0070660_100465621
372 Ga0070689_100063023
373 Ga0070687_100652094
374 Ga0070661_101228692
375 Ga0070692_10567662
376 Ga0070668_100163618
377 Ga0070668_100780141
378 Ga0070669_100500700
379 Ga0070671_100260174
380 Ga0070671_100574602
381 Ga0070674_100529565
382 Ga0070673_100558387
383 Ga0070688_100049988
384 Ga0070688_101277910
385 Ga0070659_100278349
386 Ga0070659_101062059
387 Ga0070659_101066937
388 Ga0070667_101033869
389 Ga0070714_100093013
390 Ga0070714_100185430
391 Ga0070714_100608336
392 Ga0070714_101310206
393 Ga0070713_100435043
394 Ga0070701_10053743
395 Ga0070711_100018936
396 Ga0070711_101221071
397 Ga0070705_100239031
398 Ga0070705_100285277
399 Ga0070700_100699797
400 Ga0070694_101535827
401 Ga0070663_101152205
402 Ga0070681_10976612
403 Ga0068867_101121976
404 Ga0070685_10126719
405 Ga0070679_100111602
406 Ga0070679_100308754
407 Ga0070684_100026820
408 Ga0070684_100343918
409 Ga0070684_100465741
410 Ga0070684_101316333
411 Ga0068853_100701121
412 Ga0070693_100530108
413 Ga0070704_100660539
414 Ga0070664_100431642
415 Ga0068857_101067974
416 Ga0070702_100498626
417 Ga0068852_100271860
418 Ga0068864_101685179
419 Ga0068866_10112205
420 Ga0068866_10389892
421 Ga0068861_100126338
422 Ga0068861_101179328
423 Ga0068851_10214297
424 Ga0068870_10188921
425 Ga0068863_101237512
426 Ga0068858_100339950
427 Ga0068860_100277615
428 Ga0068862_100777112
429 Ga0081455_10070915
430 Ga0081455_10204077
431 Ga0081455_10305220
432 Ga0075365_11164787
433 Ga0075433_10122491
434 Ga0105240_12413948
435 Ga0111539_10423993
436 Ga0111539_11391057
437 Ga0105245_10205817
438 Ga0105245_10206410
439 Ga0105245_10296428
440 Ga0105245_11046348
441 Ga0105245_11316124
442 Ga0105247_10898508
443 Ga0105243_10009350
444 Ga0105243_10299234
445 Ga0105243_10559715
446 Ga0105242_10203716
447 Ga0105242_10249181
448 Ga0105248_10561768
449 Ga0105238_10658933
450 Ga0105238_10843226
451 Ga0105238_12015635
452 Ga0105238_12572717
453 Ga0105249_10046411
454 Ga0105249_11747060
455 Ga0105249_13141946
456 Ga0105239_11028099
457 Ga0157321_1027492
458 Ga0157371_10917091
459 Ga0157369_10714750
460 Ga0157374_10852927
461 Ga0157378_11290201
462 Ga0157378_11379775
463 Ga0163162_10398343
464 Ga0163162_10772754
465 Ga0157372_10082178
466 Ga0157372_10149854
467 Ga0157372_10300469
468 Ga0157372_10516103
469 Ga0157372_10716723
470 Ga0157375_10089041
471 Ga0157375_10223560
472 Ga0157375_11063885
473 Ga0163163_10365035
474 Ga0163163_11444133
475 Ga0157380_10278944
476 Ga0157380_10669687
477 Ga0157380_13165411
478 Ga0182008_10448835
479 Ga0157379_10056485
480 Ga0157379_10341253
481 Ga0197907_10526356
482 Ga0206351_10966868
483 Ga0206350_10146702
484 Ga0206354_11215039
485 Ga0206353_10286486
486 Ga0206353_10389026
487 Ga0206353_11738982
488 Ga0213875_10000050
489 Ga0224712_10119992
490 Ga0207692_10287933
491 Ga0207642_10018765
492 Ga0207710_10348828
493 Ga0207688_10031678
494 Ga0207688_11034159
495 Ga0207680_10414847
496 Ga0207647_10349435
497 Ga0207647_10538356
498 Ga0207693_10346866
499 Ga0207663_10442949
500 Ga0207660_10220494
501 Ga0207662_10106408
502 Ga0207657_10291803
503 Ga0207652_11139606
504 Ga0207694_10729724
505 Ga0207687_10093163
506 Ga0207687_10426288
507 Ga0207687_11082904
508 Ga0207687_11235080
509 Ga0207700_10272931
510 Ga0207700_10790494
511 Ga0207664_10486268
512 Ga0207664_11116845
513 Ga0207644_10473561
514 Ga0207644_11077430
515 Ga0207690_10039368
516 Ga0207690_10562562
517 Ga0207690_11479531
518 Ga0207706_10093280
519 Ga0207706_10281537
520 Ga0207706_10493630
521 Ga0207686_10107870
522 Ga0207709_10108690
523 Ga0207709_10523396
524 Ga0207670_10477772
525 Ga0207669_10826579
526 Ga0207704_10493959
527 Ga0207691_10781358
528 Ga0207711_10881150
529 Ga0207689_10104019
530 Ga0207661_10688585
531 Ga0207661_10806358
532 Ga0207661_11526326
533 Ga0207679_10162433
534 Ga0207712_10028934
535 Ga0207712_10318880
536 Ga0207668_10126259
537 Ga0207668_11136596
538 Ga0207640_10599149
539 Ga0207658_10942037
540 Ga0207677_12101421
541 Ga0207703_10198559
542 Ga0207678_11591530
543 Ga0207678_11676045
544 Ga0207708_10165406
545 Ga0207702_10229200
546 Ga0207648_10114719
547 Ga0207676_10269986
548 Ga0207674_10482088
549 Ga0207675_100011119
550 Ga0207675_100093731
551 Ga0207683_10924047
552 Ga0207683_11957557
553 Ga0207698_10114426
554 Ga0207698_11230389
555 Ga0207428_11126133
556 Ga0268266_10476832
557 Ga0268265_10850584
558 Ga0268264_10556838
559 Ga0265338_10020735
560 Ga0265338_10031994
561 Ga0265332_10029234
562 Ga0265328_10179254
563 Ga0265327_10005484
564 Ga0265327_10050915
565 Ga0307408_101765989
566 Ga0307407_10327114
567 Ga0307409_102417209
568 Ga0307416_101961568
569 Ga0307415_100509205
570 Ga0373932_0350000
571 Ga0373960_0230274
572 Ga0373946_0027120
573 Ga0373955_0121882
574 Ga0373924_0067936
575 Ga0373933_0137026
576 Ga0373937_0106563
577 Ga0373937_1168088
578 Ga0373925_0057966
579 Ga0395899_0070848
580 Ga0395900_0533091
581 Ga0395898_0040305
582 Ga0395898_0634413
583 Ga0436364_0538307
584 Ga0436364_0750607
585 Ga0395901_0002311
586 Ga0395901_0003233
587 Ga0395901_0498990
588 Ga0395901_1690936
589 Ga0466972_0342475
590 Ga0466965_0077740
591 Ga0466961_0052708
592 Ga0466963_0002609
593 Ga0466963_0020148
594 Ga0466963_0033563
595 Ga0466963_0036121
596 Ga0466963_0325286
597 Ga0466963_0956994
598 Ga0466963_1092779
599 Ga0466964_0012976
600 Ga0466964_0360229
601 Ga0466964_0426376
602 Ga0466971_0254844
603 Ga0466971_0561578
604 Ga0466968_0085583
605 Ga0466968_0116453
606 Ga0466970_0620028
607 Ga0466957_0023695
608 Ga0466957_0957062
609 Ga0466960_0001316
610 Ga0466960_0124599
611 Ga0466960_0252567
612 Ga0466960_0381969
613 Ga0466959_0143972
614 Ga0466958_0036621
615 Ga0466958_0360016
616 Ga0466967_0005114
617 Ga0466967_0013461
618 Ga0466967_0018435
619 Ga0466967_0024805
620 Ga0466967_0038967
621 Ga0466967_0164164
622 Ga0466967_0200645
623 Ga0466967_0281369
624 Ga0466967_0494343
625 Ga0466967_1569412
626 Ga0466967_1850028
627 Ga0495641_0016347
628 Ga0495651_0719267
629 Ga0495585_0400240
630 Ga0495608_0008395
631 Ga0495618_0401038
632 Ga0495628_0504830
633 Ga0495637_0207046
634 Ga0495587_0305884
635 Ga0495609_0133080
636 Ga0495635_0619635
637 Ga0495588_0404347
638 Ga0495657_0337323
639 Ga0495676_0116331
640 Ga0495680_0016018
641 Ga0495680_0095814
642 Ga0495684_0416228
643 Ga0496100_0099505
644 Ga0496100_0247806
645 Ga0496100_0353139
646 Ga0496101_0044590
647 Ga0496101_0272264
648 Ga0496101_0562948
649 Ga0496101_1059094
650 Ga0496102_0422337
651 Ga0496102_0479535
652 Ga0496102_1238270
653 Ga0496103_0043751
654 Ga0496103_0681669
655 Ga0496104_0029155
656 Ga0496104_0125335
657 Ga0496104_0279751
658 Ga0496104_0529331
659 Ga0496105_0023166
660 Ga0496105_0080761
661 Ga0496105_0331414
662 Ga0496106_0073302
663 Ga0496106_0153299
664 Ga0496106_0191228
665 Ga0496106_0712940
666 Ga0496107_0052947
667 Ga0496107_0153473
668 Ga0496107_0403503
669 Ga0496108_0030954
670 Ga0496108_0153381
671 Ga0496108_0201895
672 Ga0496109_0018070
673 Ga0496109_0099046
674 Ga0496109_0120684
675 Ga0496109_0255845
676 Ga0496109_0628350
677 Ga0496109_0790394
678 Ga0496109_1010585
679 Ga0496110_0038717
680 Ga0496110_0063643
681 Ga0496110_0318556
682 Ga0496110_0799333
683 Ga0496111_0075218
684 Ga0496111_0088840
685 Ga0496111_0399729
686 Ga0496112_0024308
687 Ga0496112_0028754
688 Ga0496112_0106960
689 Ga0496112_0549906
690 Ga0496112_0779712
691 Ga0496112_1558968
692 Ga0496113_0014932
693 Ga0496113_0093738
694 Ga0496113_0211529
695 Ga0496114_0387738
696 Ga0496115_0445989
697 Ga0496115_0858279
698 Ga0496119_0000580
699 Ga0496119_0130806
700 Ga0496120_0060708
701 Ga0496121_0017150
702 Ga0496121_0049895
703 Ga0496125_0103424
704 Ga0501047_0053837
705 Ga0501069_0015992
706 Ga0501071_0426220
707 Ga0501072_0225377
708 Ga0501077_0714043
709 nmdc:mga08y16_111761_c1
710 nmdc:mga0a205_188085_c1
711 Ga0495601_0098843
712 Ga0501084_1207856
713 Ga0587082_127045
714 Ga0466962_0357699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

147

0.95

PF18029

Glyoxalase_6

Glyoxalase-like domain

34

148

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.9128 8 129
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.9071 6 130
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.893 6 130
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8886 6 127
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8864 10 127
ID Description Score Start End Superfamily
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9061 8 129 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8919 8 129 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8886 10 127 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.887 8 130 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8739 10 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A557ZF00-F1-model_v4 deleted 0.9696 6 129
AF-A0A2V7TVF1-F1-model_v4 Glyoxalase 0.9684 6 130
AF-A0A538LU44-F1-model_v4 Glyoxalase 0.9662 6 85
AF-A0A557ZF00-F1-model_v4 deleted 0.9615 6 129
AF-A0A538MJK8-F1-model_v4 Glyoxalase 0.9609 5 128

Map