F420905

General Info

Members Datasets Scaffolds Average Seq Length
357 232 714 98

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0327411|Ga0395900_0327411_470_763
Length 97
Sequence MTAFNAVRFKVKPGRNNDFLAAHERVDRDWQGLRHVNIIQTGDQHFCIIGEWDDMDAMVAARPRMISTLDTFRDMLEEVGDGVVTDPVSGPVVLSLK

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 0
Rhizoplane 9.24
Rhizosphere 85.99
Stem 0
Stem Tuber 0
Unclassified 18.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0327411 3300037418 Unclassified 1511
2 SwRhRL3b_contig_525998 2162886006 Unclassified 2097
3 MRS1b_contig_7753149 2162886011 Bacteria 810
4 JGI24737J22298_10001493 3300001990 Bacteria 8345
5 JGI24735J21928_10091918 3300002067 Bacteria 870
6 JGI24738J21930_10002738 3300002075 Bacteria 4535
7 Ga0065704_10146641 3300005289 Bacteria 1465
8 Ga0065707_10081836 3300005295 Bacteria 34923
9 Ga0070658_10029578 3300005327 Bacteria 4401
10 Ga0070676_10009172 3300005328 Bacteria 5349
11 Ga0070683_100007205 3300005329 Bacteria 9382
12 Ga0070683_101457795 3300005329 Unclassified 658
13 Ga0070690_100217463 3300005330 Bacteria 1337
14 Ga0070670_101251758 3300005331 Bacteria 679
15 Ga0068869_100012286 3300005334 Bacteria 5654
16 Ga0070666_10011295 3300005335 Bacteria 5605
17 Ga0070666_10681189 3300005335 Bacteria 753
18 Ga0068868_100122279 3300005338 Bacteria 2124
19 Ga0070660_100000252 3300005339 Bacteria 35229
20 Ga0070660_100417826 3300005339 Bacteria 1110
21 Ga0070689_100396719 3300005340 Unclassified 1165
22 Ga0070661_100000033 3300005344 Bacteria 111757
23 Ga0070668_100000555 3300005347 Bacteria 24962
24 Ga0070668_100670833 3300005347 Bacteria 912
25 Ga0070675_100058555 3300005354 Bacteria 3178
26 Ga0070671_100009380 3300005355 Bacteria 7858
27 Ga0070671_100276870 3300005355 Bacteria 1427
28 Ga0070671_101924320 3300005355 Bacteria 526
29 Ga0070674_100175256 3300005356 Bacteria 1638
30 Ga0070674_100235524 3300005356 Bacteria 1431
31 Ga0070673_100283341 3300005364 Bacteria 1454
32 Ga0070673_100414162 3300005364 Bacteria 1207
33 Ga0070673_101887345 3300005364 Bacteria 566
34 Ga0070659_100000371 3300005366 Bacteria 33844
35 Ga0070667_100047929 3300005367 Bacteria 3596
36 Ga0070667_100065013 3300005367 Bacteria 3097
37 Ga0070709_10065979 3300005434 Bacteria 2319
38 Ga0070714_100012876 3300005435 Bacteria 6687
39 Ga0070714_100749915 3300005435 Bacteria 944
40 Ga0070713_100150071 3300005436 Bacteria 2072
41 Ga0070713_101545556 3300005436 Unclassified 644
42 Ga0070713_102208807 3300005436 Unclassified 533
43 Ga0070710_10248496 3300005437 Bacteria 1142
44 Ga0070711_100265356 3300005439 Bacteria 1353
45 Ga0070711_100876551 3300005439 Bacteria 765
46 Ga0070705_100276232 3300005440 Bacteria 1192
47 Ga0070705_101097690 3300005440 Unclassified 651
48 Ga0070700_101188005 3300005441 Bacteria 636
49 Ga0070663_100037077 3300005455 Bacteria 3391
50 Ga0070663_100585342 3300005455 Unclassified 937
51 Ga0070663_100812987 3300005455 Bacteria 802
52 Ga0070678_100028632 3300005456 Bacteria 3803
53 Ga0070662_100000210 3300005457 Bacteria 34131
54 Ga0070662_101852075 3300005457 Bacteria 521
55 Ga0068867_100016269 3300005459 Bacteria 5283
56 Ga0070679_100632511 3300005530 Bacteria 1013
57 Ga0070684_100443478 3300005535 Bacteria 1199
58 Ga0070684_100801718 3300005535 Unclassified 880
59 Ga0068853_100001319 3300005539 Bacteria 17832
60 Ga0068853_101079013 3300005539 Unclassified 774
61 Ga0070672_100148626 3300005543 Bacteria 1937
62 Ga0070672_100620338 3300005543 Bacteria 943
63 Ga0070693_100035876 3300005547 Bacteria 2753
64 Ga0070665_100004940 3300005548 Bacteria 13826
65 Ga0068855_100018087 3300005563 Bacteria 8470
66 Ga0070664_100000127 3300005564 Bacteria 51101
67 Ga0068857_100035342 3300005577 Bacteria 4426
68 Ga0068857_101747997 3300005577 Bacteria 608
69 Ga0068857_102432710 3300005577 Unclassified 514
70 Ga0068854_100009987 3300005578 Bacteria 6144
71 Ga0068856_100002018 3300005614 Bacteria 21143
72 Ga0068856_100074471 3300005614 Bacteria 3362
73 Ga0068856_100487119 3300005614 Unclassified 1254
74 Ga0070702_100021865 3300005615 Bacteria 3373
75 Ga0070702_100491384 3300005615 Bacteria 899
76 Ga0068852_100004588 3300005616 Bacteria 9782
77 Ga0068852_100372024 3300005616 Bacteria 1400
78 Ga0068864_100074494 3300005618 Bacteria 2962
79 Ga0068864_102668843 3300005618 Bacteria 505
80 Ga0068861_100097850 3300005719 Bacteria 2328
81 Ga0068861_102501179 3300005719 Bacteria 520
82 Ga0068870_10017806 3300005840 Bacteria 3419
83 Ga0068863_100160797 3300005841 Bacteria 2152
84 Ga0068863_100601719 3300005841 Bacteria 1088
85 Ga0068858_100126877 3300005842 Bacteria 2390
86 Ga0068860_100733028 3300005843 Bacteria 999
87 Ga0068860_100981249 3300005843 Bacteria 862
88 Ga0068860_101091697 3300005843 Bacteria 817
89 Ga0081455_10455229 3300005937 Bacteria 873
90 Ga0070717_10157801 3300006028 Bacteria 1966
91 Ga0070717_10702668 3300006028 Unclassified 919
92 Ga0075365_10027863 3300006038 Bacteria 3598
93 Ga0075365_10281528 3300006038 Bacteria 1170
94 Ga0070716_101313514 3300006173 Bacteria 585
95 Ga0070716_101665908 3300006173 Unclassified 525
96 Ga0070712_100114675 3300006175 Bacteria 2018
97 Ga0070712_100438343 3300006175 Bacteria 1086
98 Ga0097621_100109039 3300006237 Bacteria 2338
99 Ga0068871_100122526 3300006358 Bacteria 2198
100 Ga0075428_100132325 3300006844 Unclassified 2712
101 Ga0075428_100186399 3300006844 Bacteria 2245
102 Ga0075428_100356229 3300006844 Bacteria 1570
103 Ga0075428_100923258 3300006844 Unclassified 925
104 Ga0075431_100395649 3300006847 Bacteria 1383
105 Ga0075431_100591027 3300006847 Unclassified 1095
106 Ga0075433_10009084 3300006852 Bacteria 7938
107 Ga0075434_100006208 3300006871 Bacteria 10947
108 Ga0075429_100477001 3300006880 Bacteria 1093
109 Ga0075429_100530797 3300006880 Unclassified 1031
110 Ga0068865_100313053 3300006881 Bacteria 1260
111 Ga0068865_100580157 3300006881 Bacteria 945
112 Ga0075435_100135446 3300007076 Bacteria 2063
113 Ga0111539_10014102 3300009094 Bacteria 9989
114 Ga0111539_10251382 3300009094 Bacteria 2058
115 Ga0111539_11024340 3300009094 Unclassified 960
116 Ga0111539_11651063 3300009094 Bacteria 743
117 Ga0111539_12015974 3300009094 Unclassified 669
118 Ga0105245_10038677 3300009098 Bacteria 4245
119 Ga0105245_10607113 3300009098 Bacteria 1121
120 Ga0105247_10266186 3300009101 Viruses 1177
121 Ga0105247_10523066 3300009101 Bacteria 868
122 Ga0105247_10696105 3300009101 Bacteria 764
123 Ga0114129_10160907 3300009147 Bacteria 3066
124 Ga0114129_10408733 3300009147 Bacteria 1788
125 Ga0114129_10771594 3300009147 Bacteria 1229
126 Ga0114129_10894660 3300009147 Unclassified 1125
127 Ga0105243_10023370 3300009148 Bacteria 4707
128 Ga0105241_10024685 3300009174 Bacteria 4465
129 Ga0105242_10011528 3300009176 Bacteria 6798
130 Ga0105248_10064140 3300009177 Bacteria 4124
131 Ga0105248_10076916 3300009177 Bacteria 3751
132 Ga0105248_11018798 3300009177 Unclassified 935
133 Ga0105238_10134915 3300009551 Bacteria 2446
134 Ga0105238_11716019 3300009551 Unclassified 659
135 Ga0105249_12100611 3300009553 Unclassified 638
136 Ga0105239_10169967 3300010375 Bacteria 2437
137 Ga0105239_10181106 3300010375 Bacteria 2358
138 Ga0105239_12207063 3300010375 Bacteria 640
139 Ga0105246_10006331 3300011119 Bacteria 7227
140 Ga0105246_11799026 3300011119 Bacteria 585
141 Ga0157341_1001610 3300012494 Bacteria 1395
142 Ga0157371_10006337 3300013102 Bacteria 9789
143 Ga0157371_10851693 3300013102 Unclassified 689
144 Ga0157369_10391824 3300013105 Bacteria 1441
145 Ga0157369_11047906 3300013105 Unclassified 834
146 Ga0157374_10779936 3300013296 Unclassified 971
147 Ga0157378_10698742 3300013297 Bacteria 1033
148 Ga0157378_11923213 3300013297 Bacteria 641
149 Ga0163162_10477407 3300013306 Bacteria 1378
150 Ga0157375_11619453 3300013308 Unclassified 766
151 Ga0157375_11873754 3300013308 Bacteria 712
152 Ga0163163_10920103 3300014325 Bacteria 938
153 Ga0163163_12096597 3300014325 Unclassified 625
154 Ga0157380_10123298 3300014326 Bacteria 2198
155 Ga0157380_10358051 3300014326 Bacteria 1368
156 Ga0157380_12801185 3300014326 Unclassified 554
157 Ga0157379_10432409 3300014968 Unclassified 1213
158 Ga0157379_10549114 3300014968 Bacteria 1075
159 Ga0157379_10580617 3300014968 Bacteria 1045
160 Ga0157379_11520843 3300014968 Bacteria 651
161 Ga0157376_10104802 3300014969 Bacteria 2479
162 Ga0163161_11516118 3300017792 Unclassified 589
163 Ga0209130_1030880 3300025284 Bacteria 1103
164 Ga0207692_10276487 3300025898 Bacteria 1014
165 Ga0207710_10284327 3300025900 Bacteria 833
166 Ga0207688_10088098 3300025901 Bacteria 1780
167 Ga0207680_10015522 3300025903 Bacteria 3976
168 Ga0207647_10004837 3300025904 Bacteria 9961
169 Ga0207699_10378561 3300025906 Bacteria 1004
170 Ga0207645_10021588 3300025907 Bacteria 4197
171 Ga0207643_11109025 3300025908 Unclassified 510
172 Ga0207705_10000451 3300025909 Bacteria 35403
173 Ga0207654_10027497 3300025911 Bacteria 3091
174 Ga0207693_10136216 3300025915 Bacteria 1931
175 Ga0207663_10267740 3300025916 Bacteria 1264
176 Ga0207657_10000672 3300025919 Bacteria 36472
177 Ga0207649_10000014 3300025920 Bacteria 255001
178 Ga0207694_10218828 3300025924 Bacteria 1553
179 Ga0207650_10616186 3300025925 Bacteria 913
180 Ga0207659_10081482 3300025926 Bacteria 2393
181 Ga0207687_10330538 3300025927 Bacteria 1236
182 Ga0207687_10404796 3300025927 Bacteria 1123
183 Ga0207700_10588025 3300025928 Bacteria 990
184 Ga0207700_11741337 3300025928 Unclassified 549
185 Ga0207664_10060135 3300025929 Bacteria 3028
186 Ga0207644_10040689 3300025931 Bacteria 3286
187 Ga0207690_10008779 3300025932 Bacteria 5999
188 Ga0207706_10000605 3300025933 Bacteria 38154
189 Ga0207686_10017888 3300025934 Bacteria 4003
190 Ga0207709_10025492 3300025935 Bacteria 3386
191 Ga0207670_10937195 3300025936 Bacteria 726
192 Ga0207669_10051850 3300025937 Bacteria 2461
193 Ga0207704_10023955 3300025938 Unclassified 3300
194 Ga0207704_10877218 3300025938 Bacteria 753
195 Ga0207665_10040005 3300025939 Bacteria 3127
196 Ga0207665_11071819 3300025939 Bacteria 642
197 Ga0207691_10445618 3300025940 Bacteria 1102
198 Ga0207711_10031495 3300025941 Bacteria 4478
199 Ga0207711_10278822 3300025941 Bacteria 1539
200 Ga0207711_10700161 3300025941 Unclassified 945
201 Ga0207711_11929082 3300025941 Bacteria 533
202 Ga0207689_10037428 3300025942 Bacteria 4024
203 Ga0207661_10002668 3300025944 Bacteria 12274
204 Ga0207661_11731676 3300025944 Unclassified 570
205 Ga0207679_10001103 3300025945 Bacteria 17200
206 Ga0207667_10003277 3300025949 Bacteria 19989
207 Ga0207651_10116345 3300025960 Bacteria 2018
208 Ga0207651_10364056 3300025960 Bacteria 1221
209 Ga0207651_11146465 3300025960 Unclassified 697
210 Ga0207712_11678453 3300025961 Unclassified 569
211 Ga0207668_10000067 3300025972 Bacteria 83712
212 Ga0207668_10630103 3300025972 Bacteria 937
213 Ga0207640_10008053 3300025981 Bacteria 5827
214 Ga0207658_10070046 3300025986 Bacteria 2652
215 Ga0207658_10075923 3300025986 Bacteria 2558
216 Ga0207677_10089480 3300026023 Bacteria 2235
217 Ga0207703_10105034 3300026035 Bacteria 2401
218 Ga0207703_10636551 3300026035 Bacteria 1011
219 Ga0207639_10328970 3300026041 Bacteria 1359
220 Ga0207639_11290417 3300026041 Unclassified 685
221 Ga0207678_10015284 3300026067 Bacteria 6751
222 Ga0207702_10001559 3300026078 Bacteria 22684
223 Ga0207702_10441128 3300026078 Bacteria 1262
224 Ga0207641_10927370 3300026088 Bacteria 865
225 Ga0207648_10007502 3300026089 Bacteria 10714
226 Ga0207676_10095536 3300026095 Bacteria 2451
227 Ga0207674_10118631 3300026116 Bacteria 2616
228 Ga0207674_10360166 3300026116 Unclassified 1406
229 Ga0207675_101129594 3300026118 Unclassified 804
230 Ga0207683_10045926 3300026121 Bacteria 3821
231 Ga0207698_10022894 3300026142 Bacteria 4355
232 Ga0207428_10015284 3300027907 Bacteria 6643
233 Ga0207428_10154206 3300027907 Bacteria 1747
234 Ga0207428_10825354 3300027907 Bacteria 658
235 Ga0268266_10000221 3300028379 Bacteria 99332
236 Ga0268266_10008896 3300028379 Bacteria 8890
237 Ga0268265_10007604 3300028380 Bacteria 7310
238 Ga0265318_10204105 3300028577 Bacteria 722
239 Ga0307517_10000102 3300028786 Bacteria 123775
240 Ga0265320_10081874 3300031240 Bacteria 1506
241 Ga0265340_10009129 3300031247 Bacteria 5331
242 Ga0265340_10047211 3300031247 Bacteria 2098
243 Ga0307408_101818283 3300031548 Bacteria 583
244 Ga0265342_10184039 3300031712 Bacteria 1143
245 Ga0307410_10340854 3300031852 Bacteria 1195
246 Ga0307409_100749997 3300031995 Bacteria 980
247 Ga0307416_101463973 3300032002 Bacteria 789
248 Ga0307411_11797747 3300032005 Bacteria 569
249 Ga0373948_0045888 3300034817 Unclassified 927
250 Ga0373938_0022777 3300034957 Bacteria 1282
251 Ga0373929_0163051 3300035085 Bacteria 605
252 Ga0373940_0016170 3300035088 Bacteria 1846
253 Ga0373940_0100258 3300035088 Bacteria 878
254 Ga0373951_0166742 3300035091 Bacteria 626
255 Ga0373952_0067384 3300035092 Bacteria 888
256 Ga0373941_0025540 3300035115 Bacteria 1707
257 Ga0373960_0013023 3300035121 Bacteria 2078
258 Ga0373960_0030722 3300035121 Bacteria 1498
259 Ga0373961_0015839 3300035241 Bacteria 1934
260 Ga0373961_0064841 3300035241 Bacteria 1117
261 Ga0373931_0005021 3300035691 Bacteria 6086
262 Ga0373931_0005673 3300035691 Bacteria 5794
263 Ga0373931_0034619 3300035691 Bacteria 2622
264 Ga0373927_0673155 3300035695 Unclassified 684
265 Ga0436365_1191303 3300039437 Bacteria 645
266 Ga0436360_1077255 3300039438 Bacteria 1106
267 Ga0439457_079074 3300042014 Bacteria 755
268 Ga0466963_0062025 3300044694 Bacteria 2500
269 Ga0466971_0438966 3300044719 Bacteria 639
270 Ga0466957_0005123 3300044842 Bacteria 7323
271 Ga0466967_0311651 3300045976 Bacteria 1516
272 Ga0495603_0449553 3300046455 Bacteria 738
273 Ga0495629_0509668 3300046459 Unclassified 811
274 Ga0495651_0106446 3300046462 Bacteria 2079
275 Ga0495653_0738937 3300046463 Unclassified 595
276 Ga0495628_0387064 3300046516 Unclassified 1023
277 Ga0495628_0685619 3300046516 Unclassified 725
278 Ga0495628_1142062 3300046516 Unclassified 531
279 Ga0495645_0326180 3300046543 Bacteria 995
280 Ga0495667_0284431 3300046559 Bacteria 1050
281 Ga0495667_0448101 3300046559 Bacteria 811
282 Ga0495599_0069257 3300046678 Bacteria 2202
283 Ga0495613_0000323 3300046689 Bacteria 43294
284 Ga0495613_0862613 3300046689 Bacteria 588
285 Ga0495600_0328514 3300046809 Bacteria 961
286 Ga0495600_0545395 3300046809 Unclassified 709
287 Ga0495604_0846218 3300047317 Unclassified 574
288 Ga0495674_0461864 3300047319 Bacteria 1019
289 Ga0495680_0385661 3300047322 Bacteria 970
290 Ga0495602_0036870 3300048088 Unclassified 4545
291 Ga0496100_1224010 3300048903 Bacteria 592
292 Ga0496100_1486378 3300048903 Unclassified 535
293 Ga0496101_0441207 3300048904 Bacteria 1027
294 Ga0496101_1605863 3300048904 Bacteria 505
295 Ga0496102_0515086 3300048905 Bacteria 1119
296 Ga0496102_0635851 3300048905 Bacteria 990
297 Ga0496102_0670976 3300048905 Bacteria 960
298 Ga0496103_0206823 3300048906 Bacteria 1262
299 Ga0496103_0883478 3300048906 Unclassified 561
300 Ga0496104_0118645 3300048907 Bacteria 2540
301 Ga0496104_0359965 3300048907 Bacteria 1367
302 Ga0496105_0162229 3300048908 Bacteria 1835
303 Ga0496105_0232796 3300048908 Unclassified 1497
304 Ga0496105_0581348 3300048908 Unclassified 871
305 Ga0496105_1383360 3300048908 Unclassified 510
306 Ga0496105_1387482 3300048908 Bacteria 509
307 Ga0496106_0372222 3300048909 Bacteria 1148
308 Ga0496106_0417896 3300048909 Bacteria 1078
309 Ga0496107_0323837 3300048910 Bacteria 1147
310 Ga0496109_0615969 3300048912 Bacteria 1022
311 Ga0496109_0789987 3300048912 Bacteria 887
312 Ga0496110_0761925 3300048913 Unclassified 871
313 Ga0496111_0121514 3300048914 Unclassified 1929
314 Ga0496112_0000018 3300048915 Bacteria 188820
315 Ga0496112_0098059 3300048915 Bacteria 2901
316 Ga0496112_0526166 3300048915 Bacteria 1117
317 Ga0496112_0704157 3300048915 Bacteria 938
318 Ga0496114_0688410 3300048917 Bacteria 897
319 Ga0496114_1504823 3300048917 Bacteria 561
320 Ga0496115_0145646 3300048918 Bacteria 1955
321 Ga0496115_0283349 3300048918 Bacteria 1360
322 Ga0496115_0572115 3300048918 Unclassified 901
323 Ga0496115_0688124 3300048918 Bacteria 805
324 Ga0496118_0403369 3300048921 Bacteria 709
325 Ga0501033_1064738 3300049570 Bacteria 539
326 Ga0501034_0203672 3300049571 Bacteria 1936
327 nmdc:mga0yw44_6887_c1 3300050492 Bacteria 5536
328 nmdc:mga05p37_501458_c1 3300050507 Bacteria 1393
329 nmdc:mga05p37_534536_c1 3300050507 Bacteria 1338
330 nmdc:mga09592_469230_c1 3300050508 Unclassified 1085
331 nmdc:mga09592_819816_c1 3300050508 Bacteria 786
332 nmdc:mga0qj67_267266_c1 3300050509 Bacteria 1387
333 nmdc:mga06r32_33067_c1 3300050510 Bacteria 4870
334 nmdc:mga08y16_1006534_c1 3300050511 Bacteria 813
335 nmdc:mga08y16_110442_c1 3300050511 Bacteria 2863
336 nmdc:mga08y16_14543_c1 3300050511 Bacteria 8277
337 nmdc:mga08y16_911891_c1 3300050511 Bacteria 864
338 nmdc:mga0n895_18867_c1 3300050512 Bacteria 6395
339 nmdc:mga0rr50_144178_c1 3300050513 Bacteria 1919
340 nmdc:mga0a205_12885_c1 3300050515 Bacteria 7756
341 Ga0495601_0075951 3300053077 Bacteria 2151
342 Ga0495601_1040017 3300053077 Bacteria 514
343 Ga0495612_0148296 3300053078 Unclassified 1020
344 Ga0495595_0081743 3300053084 Bacteria 1540
345 Ga0495619_0246092 3300053085 Unclassified 1239
346 Ga0495619_0705069 3300053085 Unclassified 686
347 Ga0500643_004378 3300053087 Bacteria 6411
348 Ga0500641_0001458 3300053096 Bacteria 8434
349 Ga0500556_0087090 3300053104 Bacteria 1188
350 Ga0500655_121084 3300053133 Bacteria 555
351 Ga0500568_0025506 3300053139 Bacteria 2493
352 Ga0500604_0081875 3300053151 Bacteria 1044
353 Ga0500616_0008483 3300053153 Bacteria 6374
354 Ga0500622_0002490 3300053156 Bacteria 13253
355 Ga0500622_0016295 3300053156 Bacteria 3971
356 Ga0500645_000184 3300053730 Bacteria 48312
357 Ga0466962_0201668 3300061719 Unclassified 972
358 Ga0395900_0327411
359 SwRhRL3b_contig_525998
360 MRS1b_contig_7753149
361 JGI24737J22298_10001493
362 JGI24735J21928_10091918
363 JGI24738J21930_10002738
364 Ga0065704_10146641
365 Ga0065707_10081836
366 Ga0070658_10029578
367 Ga0070676_10009172
368 Ga0070683_100007205
369 Ga0070683_101457795
370 Ga0070690_100217463
371 Ga0070670_101251758
372 Ga0068869_100012286
373 Ga0070666_10011295
374 Ga0070666_10681189
375 Ga0068868_100122279
376 Ga0070660_100000252
377 Ga0070660_100417826
378 Ga0070689_100396719
379 Ga0070661_100000033
380 Ga0070668_100000555
381 Ga0070668_100670833
382 Ga0070675_100058555
383 Ga0070671_100009380
384 Ga0070671_100276870
385 Ga0070671_101924320
386 Ga0070674_100175256
387 Ga0070674_100235524
388 Ga0070673_100283341
389 Ga0070673_100414162
390 Ga0070673_101887345
391 Ga0070659_100000371
392 Ga0070667_100047929
393 Ga0070667_100065013
394 Ga0070709_10065979
395 Ga0070714_100012876
396 Ga0070714_100749915
397 Ga0070713_100150071
398 Ga0070713_101545556
399 Ga0070713_102208807
400 Ga0070710_10248496
401 Ga0070711_100265356
402 Ga0070711_100876551
403 Ga0070705_100276232
404 Ga0070705_101097690
405 Ga0070700_101188005
406 Ga0070663_100037077
407 Ga0070663_100585342
408 Ga0070663_100812987
409 Ga0070678_100028632
410 Ga0070662_100000210
411 Ga0070662_101852075
412 Ga0068867_100016269
413 Ga0070679_100632511
414 Ga0070684_100443478
415 Ga0070684_100801718
416 Ga0068853_100001319
417 Ga0068853_101079013
418 Ga0070672_100148626
419 Ga0070672_100620338
420 Ga0070693_100035876
421 Ga0070665_100004940
422 Ga0068855_100018087
423 Ga0070664_100000127
424 Ga0068857_100035342
425 Ga0068857_101747997
426 Ga0068857_102432710
427 Ga0068854_100009987
428 Ga0068856_100002018
429 Ga0068856_100074471
430 Ga0068856_100487119
431 Ga0070702_100021865
432 Ga0070702_100491384
433 Ga0068852_100004588
434 Ga0068852_100372024
435 Ga0068864_100074494
436 Ga0068864_102668843
437 Ga0068861_100097850
438 Ga0068861_102501179
439 Ga0068870_10017806
440 Ga0068863_100160797
441 Ga0068863_100601719
442 Ga0068858_100126877
443 Ga0068860_100733028
444 Ga0068860_100981249
445 Ga0068860_101091697
446 Ga0081455_10455229
447 Ga0070717_10157801
448 Ga0070717_10702668
449 Ga0075365_10027863
450 Ga0075365_10281528
451 Ga0070716_101313514
452 Ga0070716_101665908
453 Ga0070712_100114675
454 Ga0070712_100438343
455 Ga0097621_100109039
456 Ga0068871_100122526
457 Ga0075428_100132325
458 Ga0075428_100186399
459 Ga0075428_100356229
460 Ga0075428_100923258
461 Ga0075431_100395649
462 Ga0075431_100591027
463 Ga0075433_10009084
464 Ga0075434_100006208
465 Ga0075429_100477001
466 Ga0075429_100530797
467 Ga0068865_100313053
468 Ga0068865_100580157
469 Ga0075435_100135446
470 Ga0111539_10014102
471 Ga0111539_10251382
472 Ga0111539_11024340
473 Ga0111539_11651063
474 Ga0111539_12015974
475 Ga0105245_10038677
476 Ga0105245_10607113
477 Ga0105247_10266186
478 Ga0105247_10523066
479 Ga0105247_10696105
480 Ga0114129_10160907
481 Ga0114129_10408733
482 Ga0114129_10771594
483 Ga0114129_10894660
484 Ga0105243_10023370
485 Ga0105241_10024685
486 Ga0105242_10011528
487 Ga0105248_10064140
488 Ga0105248_10076916
489 Ga0105248_11018798
490 Ga0105238_10134915
491 Ga0105238_11716019
492 Ga0105249_12100611
493 Ga0105239_10169967
494 Ga0105239_10181106
495 Ga0105239_12207063
496 Ga0105246_10006331
497 Ga0105246_11799026
498 Ga0157341_1001610
499 Ga0157371_10006337
500 Ga0157371_10851693
501 Ga0157369_10391824
502 Ga0157369_11047906
503 Ga0157374_10779936
504 Ga0157378_10698742
505 Ga0157378_11923213
506 Ga0163162_10477407
507 Ga0157375_11619453
508 Ga0157375_11873754
509 Ga0163163_10920103
510 Ga0163163_12096597
511 Ga0157380_10123298
512 Ga0157380_10358051
513 Ga0157380_12801185
514 Ga0157379_10432409
515 Ga0157379_10549114
516 Ga0157379_10580617
517 Ga0157379_11520843
518 Ga0157376_10104802
519 Ga0163161_11516118
520 Ga0209130_1030880
521 Ga0207692_10276487
522 Ga0207710_10284327
523 Ga0207688_10088098
524 Ga0207680_10015522
525 Ga0207647_10004837
526 Ga0207699_10378561
527 Ga0207645_10021588
528 Ga0207643_11109025
529 Ga0207705_10000451
530 Ga0207654_10027497
531 Ga0207693_10136216
532 Ga0207663_10267740
533 Ga0207657_10000672
534 Ga0207649_10000014
535 Ga0207694_10218828
536 Ga0207650_10616186
537 Ga0207659_10081482
538 Ga0207687_10330538
539 Ga0207687_10404796
540 Ga0207700_10588025
541 Ga0207700_11741337
542 Ga0207664_10060135
543 Ga0207644_10040689
544 Ga0207690_10008779
545 Ga0207706_10000605
546 Ga0207686_10017888
547 Ga0207709_10025492
548 Ga0207670_10937195
549 Ga0207669_10051850
550 Ga0207704_10023955
551 Ga0207704_10877218
552 Ga0207665_10040005
553 Ga0207665_11071819
554 Ga0207691_10445618
555 Ga0207711_10031495
556 Ga0207711_10278822
557 Ga0207711_10700161
558 Ga0207711_11929082
559 Ga0207689_10037428
560 Ga0207661_10002668
561 Ga0207661_11731676
562 Ga0207679_10001103
563 Ga0207667_10003277
564 Ga0207651_10116345
565 Ga0207651_10364056
566 Ga0207651_11146465
567 Ga0207712_11678453
568 Ga0207668_10000067
569 Ga0207668_10630103
570 Ga0207640_10008053
571 Ga0207658_10070046
572 Ga0207658_10075923
573 Ga0207677_10089480
574 Ga0207703_10105034
575 Ga0207703_10636551
576 Ga0207639_10328970
577 Ga0207639_11290417
578 Ga0207678_10015284
579 Ga0207702_10001559
580 Ga0207702_10441128
581 Ga0207641_10927370
582 Ga0207648_10007502
583 Ga0207676_10095536
584 Ga0207674_10118631
585 Ga0207674_10360166
586 Ga0207675_101129594
587 Ga0207683_10045926
588 Ga0207698_10022894
589 Ga0207428_10015284
590 Ga0207428_10154206
591 Ga0207428_10825354
592 Ga0268266_10000221
593 Ga0268266_10008896
594 Ga0268265_10007604
595 Ga0265318_10204105
596 Ga0307517_10000102
597 Ga0265320_10081874
598 Ga0265340_10009129
599 Ga0265340_10047211
600 Ga0307408_101818283
601 Ga0265342_10184039
602 Ga0307410_10340854
603 Ga0307409_100749997
604 Ga0307416_101463973
605 Ga0307411_11797747
606 Ga0373948_0045888
607 Ga0373938_0022777
608 Ga0373929_0163051
609 Ga0373940_0016170
610 Ga0373940_0100258
611 Ga0373951_0166742
612 Ga0373952_0067384
613 Ga0373941_0025540
614 Ga0373960_0013023
615 Ga0373960_0030722
616 Ga0373961_0015839
617 Ga0373961_0064841
618 Ga0373931_0005021
619 Ga0373931_0005673
620 Ga0373931_0034619
621 Ga0373927_0673155
622 Ga0436365_1191303
623 Ga0436360_1077255
624 Ga0439457_079074
625 Ga0466963_0062025
626 Ga0466971_0438966
627 Ga0466957_0005123
628 Ga0466967_0311651
629 Ga0495603_0449553
630 Ga0495629_0509668
631 Ga0495651_0106446
632 Ga0495653_0738937
633 Ga0495628_0387064
634 Ga0495628_0685619
635 Ga0495628_1142062
636 Ga0495645_0326180
637 Ga0495667_0284431
638 Ga0495667_0448101
639 Ga0495599_0069257
640 Ga0495613_0000323
641 Ga0495613_0862613
642 Ga0495600_0328514
643 Ga0495600_0545395
644 Ga0495604_0846218
645 Ga0495674_0461864
646 Ga0495680_0385661
647 Ga0495602_0036870
648 Ga0496100_1224010
649 Ga0496100_1486378
650 Ga0496101_0441207
651 Ga0496101_1605863
652 Ga0496102_0515086
653 Ga0496102_0635851
654 Ga0496102_0670976
655 Ga0496103_0206823
656 Ga0496103_0883478
657 Ga0496104_0118645
658 Ga0496104_0359965
659 Ga0496105_0162229
660 Ga0496105_0232796
661 Ga0496105_0581348
662 Ga0496105_1383360
663 Ga0496105_1387482
664 Ga0496106_0372222
665 Ga0496106_0417896
666 Ga0496107_0323837
667 Ga0496109_0615969
668 Ga0496109_0789987
669 Ga0496110_0761925
670 Ga0496111_0121514
671 Ga0496112_0000018
672 Ga0496112_0098059
673 Ga0496112_0526166
674 Ga0496112_0704157
675 Ga0496114_0688410
676 Ga0496114_1504823
677 Ga0496115_0145646
678 Ga0496115_0283349
679 Ga0496115_0572115
680 Ga0496115_0688124
681 Ga0496118_0403369
682 Ga0501033_1064738
683 Ga0501034_0203672
684 nmdc:mga0yw44_6887_c1
685 nmdc:mga05p37_501458_c1
686 nmdc:mga05p37_534536_c1
687 nmdc:mga09592_469230_c1
688 nmdc:mga09592_819816_c1
689 nmdc:mga0qj67_267266_c1
690 nmdc:mga06r32_33067_c1
691 nmdc:mga08y16_1006534_c1
692 nmdc:mga08y16_110442_c1
693 nmdc:mga08y16_14543_c1
694 nmdc:mga08y16_911891_c1
695 nmdc:mga0n895_18867_c1
696 nmdc:mga0rr50_144178_c1
697 nmdc:mga0a205_12885_c1
698 Ga0495601_0075951
699 Ga0495601_1040017
700 Ga0495612_0148296
701 Ga0495595_0081743
702 Ga0495619_0246092
703 Ga0495619_0705069
704 Ga0500643_004378
705 Ga0500641_0001458
706 Ga0500556_0087090
707 Ga0500655_121084
708 Ga0500568_0025506
709 Ga0500604_0081875
710 Ga0500616_0008483
711 Ga0500622_0002490
712 Ga0500622_0016295
713 Ga0500645_000184
714 Ga0466962_0201668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.8089 1 91
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.8049 1 94
6fxd-assembly1.cif.gz_A-2 crystal structure of mupz from pseudomonas fluorescens 0.7992 2 77
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.7981 2 96
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.7973 1 94
ID Description Score Start End Superfamily
af_P9WLA3_114_212_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8084 2 71 3.30.70.100
3fgvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8051 3 94 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.805 3 91 3.30.70.100
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.796 2 90 3.30.70.100
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7903 1 90 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7Z9M6G9-F1-model_v4 ABM domain-containing protein 0.9808 1 76
AF-A0A2E1J092-F1-model_v4 DUF718 domain-containing protein 0.9776 2 94
AF-A0A2D6ZRM9-F1-model_v4 ABM domain-containing protein 0.9764 2 93
AF-A0A7Z9SEC6-F1-model_v4 DUF718 domain-containing protein 0.9713 2 95
AF-Q3AIY5-F1-model_v4 deleted 0.9708 2 94

Map