F420756

General Info

Members Datasets Scaffolds Average Seq Length
357 177 714 167

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100111969|Ga0070707_1001119694
Length 187
Sequence MPTLSIRRGTPRDVPVIFRLIRGLAEYERLAHEMVATTGQIRRHGFGRRRYFETLICRRGRAPVGFALYFFTYSTFLGRPSLYLEDLFVLPEERGRGAGRALLGELARIAKRRGCGRMEWAVLDWNTPSIRFYQKLGARLRRQWILTRLTGAPLNRLARRAASRSPRAAYPSIGAGARPGKQKPATR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.28
Rhizosphere 99.72
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100111969 3300005468 Unclassified 2647
2 Ga0070690_100171160 3300005330 Bacteria 1495
3 Ga0070690_100589842 3300005330 Bacteria 842
4 Ga0068869_100010122 3300005334 Bacteria 6136
5 Ga0070689_100123587 3300005340 Bacteria 2069
6 Ga0070668_100048407 3300005347 Bacteria 3269
7 Ga0070671_100297089 3300005355 Bacteria 1375
8 Ga0070673_100199964 3300005364 Bacteria 1721
9 Ga0070667_100041049 3300005367 Bacteria 3882
10 Ga0070703_10174352 3300005406 Bacteria 826
11 Ga0070705_100009940 3300005440 Bacteria 4748
12 Ga0070694_100019514 3300005444 Bacteria 4312
13 Ga0070694_100176241 3300005444 Archaea 1578
14 Ga0070694_100354590 3300005444 Bacteria 1137
15 Ga0070694_100380415 3300005444 Bacteria 1101
16 Ga0070708_100003691 3300005445 Bacteria 12007
17 Ga0070708_100006350 3300005445 Bacteria 9412
18 Ga0070708_100285523 3300005445 Bacteria 1553
19 Ga0070708_100397974 3300005445 Unclassified 1299
20 Ga0070708_101126239 3300005445 Bacteria 735
21 Ga0070663_100534162 3300005455 Bacteria 978
22 Ga0070678_100211199 3300005456 Bacteria 1608
23 Ga0070706_100112053 3300005467 Bacteria 2539
24 Ga0070706_100181640 3300005467 Bacteria 1964
25 Ga0070707_100009948 3300005468 Bacteria 8851
26 Ga0070707_100094065 3300005468 Unclassified 2902
27 Ga0070707_100117911 3300005468 Bacteria 2576
28 Ga0070698_100017413 3300005471 Bacteria 7574
29 Ga0070698_100048409 3300005471 Bacteria 4343
30 Ga0070698_100435589 3300005471 Archaea 1246
31 Ga0070698_100506806 3300005471 Bacteria 1145
32 Ga0070699_100003613 3300005518 Bacteria 13672
33 Ga0070699_100063657 3300005518 Bacteria 3198
34 Ga0070699_100096258 3300005518 Bacteria 2593
35 Ga0070699_100192686 3300005518 Bacteria 1811
36 Ga0070697_100004301 3300005536 Bacteria 10922
37 Ga0070697_100039773 3300005536 Bacteria 3803
38 Ga0070697_100074968 3300005536 Unclassified 2780
39 Ga0070697_100089927 3300005536 Bacteria 2537
40 Ga0070697_100286683 3300005536 Bacteria 1414
41 Ga0070697_100776864 3300005536 Bacteria 847
42 Ga0070695_100000470 3300005545 Bacteria 20908
43 Ga0070695_100381235 3300005545 Bacteria 1064
44 Ga0070696_100031718 3300005546 Bacteria 3623
45 Ga0070696_100628937 3300005546 Bacteria 868
46 Ga0070696_100748279 3300005546 Archaea 801
47 Ga0070704_100020832 3300005549 Bacteria 4238
48 Ga0070704_100038440 3300005549 Bacteria 3279
49 Ga0070704_100046212 3300005549 Bacteria 3034
50 Ga0070704_100277687 3300005549 Bacteria 1386
51 Ga0068857_100021821 3300005577 Bacteria 5636
52 Ga0068857_100043436 3300005577 Bacteria 3987
53 Ga0068854_100084809 3300005578 Bacteria 2345
54 Ga0070702_100165562 3300005615 Bacteria 1433
55 Ga0070702_100710353 3300005615 Bacteria 767
56 Ga0068859_100838809 3300005617 Bacteria 1005
57 Ga0068864_100791429 3300005618 Bacteria 931
58 Ga0068866_10576121 3300005718 Bacteria 756
59 Ga0068861_100000716 3300005719 Bacteria 19819
60 Ga0068863_100092091 3300005841 Bacteria 2875
61 Ga0068858_100141050 3300005842 Bacteria 2262
62 Ga0068860_100003693 3300005843 Bacteria 15764
63 Ga0068860_100146423 3300005843 Bacteria 2273
64 Ga0068862_100035543 3300005844 Bacteria 4221
65 Ga0068862_100321485 3300005844 Bacteria 1428
66 Ga0068862_100699267 3300005844 Bacteria 982
67 Ga0081539_10000454 3300005985 Bacteria 87230
68 Ga0070716_100437258 3300006173 Bacteria 950
69 Ga0068871_100320837 3300006358 Bacteria 1364
70 Ga0075428_100006550 3300006844 Bacteria 12949
71 Ga0075428_100040921 3300006844 Bacteria 5097
72 Ga0075428_100094358 3300006844 Bacteria 3262
73 Ga0075430_100007018 3300006846 Bacteria 9497
74 Ga0075430_100017673 3300006846 Bacteria 6072
75 Ga0075430_100073317 3300006846 Bacteria 2871
76 Ga0075430_100080874 3300006846 Bacteria 2722
77 Ga0075431_100002433 3300006847 Bacteria 17914
78 Ga0075431_100006440 3300006847 Bacteria 11655
79 Ga0075431_100040537 3300006847 Bacteria 4800
80 Ga0075431_100077265 3300006847 Bacteria 3436
81 Ga0075431_100195657 3300006847 Unclassified 2070
82 Ga0075431_100284429 3300006847 Bacteria 1674
83 Ga0075431_100286638 3300006847 Bacteria 1667
84 Ga0075431_100288852 3300006847 Bacteria 1659
85 Ga0075431_101165342 3300006847 Bacteria 734
86 Ga0075431_101620084 3300006847 Bacteria 605
87 Ga0075433_10000340 3300006852 Bacteria 29026
88 Ga0075433_10008230 3300006852 Bacteria 8310
89 Ga0075433_10232635 3300006852 Bacteria 1636
90 Ga0075433_10466871 3300006852 Bacteria 1112
91 Ga0075433_11064132 3300006852 Bacteria 704
92 Ga0075434_100000683 3300006871 Bacteria 26422
93 Ga0075434_100044443 3300006871 Bacteria 4407
94 Ga0075434_100111516 3300006871 Bacteria 2746
95 Ga0075434_100168494 3300006871 Bacteria 2210
96 Ga0075434_100311268 3300006871 Bacteria 1595
97 Ga0075434_100458798 3300006871 Unclassified 1295
98 Ga0075429_100002255 3300006880 Bacteria 16144
99 Ga0075429_100002568 3300006880 Bacteria 15302
100 Ga0075429_100010978 3300006880 Bacteria 7838
101 Ga0075429_100054126 3300006880 Bacteria 3491
102 Ga0075436_100004882 3300006914 Bacteria 9213
103 Ga0075436_100058564 3300006914 Bacteria 2660
104 Ga0075436_100064064 3300006914 Bacteria 2541
105 Ga0075436_100802941 3300006914 Bacteria 701
106 Ga0097620_100838776 3300006931 Bacteria 1005
107 Ga0075435_100034956 3300007076 Bacteria 3986
108 Ga0075435_100082778 3300007076 Bacteria 2638
109 Ga0075435_100085970 3300007076 Bacteria 2589
110 Ga0075435_100189047 3300007076 Bacteria 1742
111 Ga0099794_10011568 3300007265 Bacteria 3781
112 Ga0099794_10182134 3300007265 Bacteria 1072
113 Ga0111539_10000304 3300009094 Bacteria 59789
114 Ga0111539_10072764 3300009094 Bacteria 4053
115 Ga0111539_10540371 3300009094 Bacteria 1358
116 Ga0105245_10239546 3300009098 Unclassified 1758
117 Ga0105247_10723546 3300009101 Bacteria 751
118 Ga0114129_10000441 3300009147 Bacteria 49260
119 Ga0114129_10003561 3300009147 Bacteria 21925
120 Ga0114129_10008013 3300009147 Bacteria 15042
121 Ga0114129_10010932 3300009147 Bacteria 12935
122 Ga0114129_10011520 3300009147 Bacteria 12592
123 Ga0114129_10039843 3300009147 Bacteria 6627
124 Ga0114129_10067478 3300009147 Bacteria 4989
125 Ga0114129_10165554 3300009147 Bacteria 3018
126 Ga0114129_10290860 3300009147 Unclassified 2180
127 Ga0114129_10778783 3300009147 Unclassified 1222
128 Ga0114129_10897646 3300009147 Bacteria 1123
129 Ga0105243_10218042 3300009148 Bacteria 1684
130 Ga0105248_10030421 3300009177 Bacteria 6028
131 Ga0105249_10201341 3300009553 Bacteria 1949
132 Ga0105249_10556447 3300009553 Bacteria 1198
133 Ga0105249_10667609 3300009553 Unclassified 1098
134 Ga0157378_10061883 3300013297 Bacteria 3342
135 Ga0157378_10263371 3300013297 Bacteria 1655
136 Ga0157375_10357495 3300013308 Bacteria 1626
137 Ga0157375_10429263 3300013308 Unclassified 1487
138 Ga0163163_10015172 3300014325 Bacteria 7114
139 Ga0157379_10270636 3300014968 Bacteria 1545
140 Ga0207710_10374689 3300025900 Bacteria 728
141 Ga0207643_10018982 3300025908 Bacteria 3765
142 Ga0207684_10000279 3300025910 Bacteria 74399
143 Ga0207684_10079477 3300025910 Bacteria 2790
144 Ga0207684_10089450 3300025910 Bacteria 2623
145 Ga0207646_10003199 3300025922 Bacteria 18705
146 Ga0207646_10055728 3300025922 Unclassified 3534
147 Ga0207646_10138743 3300025922 Bacteria 2189
148 Ga0207681_10041028 3300025923 Bacteria 3083
149 Ga0207644_10497743 3300025931 Bacteria 1005
150 Ga0207706_10975096 3300025933 Unclassified 713
151 Ga0207711_10328007 3300025941 Bacteria 1415
152 Ga0207689_10000889 3300025942 Bacteria 28731
153 Ga0207651_10154283 3300025960 Bacteria 1792
154 Ga0207712_10389553 3300025961 Bacteria 1168
155 Ga0207668_10047360 3300025972 Bacteria 2943
156 Ga0207640_10132594 3300025981 Bacteria 1803
157 Ga0207658_10360422 3300025986 Bacteria 1268
158 Ga0207703_10015395 3300026035 Bacteria 5966
159 Ga0207678_10128627 3300026067 Bacteria 2160
160 Ga0207708_10087121 3300026075 Bacteria 2404
161 Ga0207641_11445779 3300026088 Bacteria 689
162 Ga0207648_10002230 3300026089 Bacteria 20980
163 Ga0207648_10447507 3300026089 Bacteria 1176
164 Ga0207676_10009251 3300026095 Bacteria 7010
165 Ga0207674_10016849 3300026116 Bacteria 7985
166 Ga0207674_10088482 3300026116 Bacteria 3090
167 Ga0207675_100000855 3300026118 Bacteria 30355
168 Ga0209998_10065950 3300027717 Unclassified 859
169 Ga0207428_10000009 3300027907 Bacteria 410565
170 Ga0268265_10198587 3300028380 Unclassified 1738
171 Ga0268265_11375464 3300028380 Bacteria 707
172 Ga0268264_10081007 3300028381 Bacteria 2773
173 Ga0268264_10333311 3300028381 Bacteria 1439
174 Ga0265319_1010728 3300028563 Bacteria 3809
175 Ga0265318_10000376 3300028577 Bacteria 34941
176 Ga0265318_10007693 3300028577 Bacteria 4850
177 Ga0265338_10249795 3300028800 Bacteria 1309
178 Ga0265338_10367092 3300028800 Bacteria 1031
179 Ga0265330_10007937 3300031235 Bacteria 5142
180 Ga0265332_10005630 3300031238 Bacteria 5765
181 Ga0265328_10024747 3300031239 Bacteria 2265
182 Ga0265320_10001265 3300031240 Bacteria 18544
183 Ga0265320_10250305 3300031240 Bacteria 786
184 Ga0265325_10001744 3300031241 Bacteria 15091
185 Ga0265325_10034922 3300031241 Bacteria 2672
186 Ga0265329_10000989 3300031242 Bacteria 14190
187 Ga0265340_10004031 3300031247 Bacteria 8250
188 Ga0265339_10004395 3300031249 Bacteria 9614
189 Ga0265331_10002322 3300031250 Bacteria 12965
190 Ga0265316_10002436 3300031344 Bacteria 19334
191 Ga0265316_10006643 3300031344 Bacteria 11017
192 Ga0307408_100026132 3300031548 Bacteria 4005
193 Ga0307408_100924889 3300031548 Unclassified 800
194 Ga0307408_101000655 3300031548 Bacteria 770
195 Ga0265313_10000551 3300031595 Bacteria 39034
196 Ga0265313_10002850 3300031595 Bacteria 14503
197 Ga0265314_10005700 3300031711 Bacteria 11175
198 Ga0265342_10000271 3300031712 Bacteria 58265
199 Ga0307405_10046597 3300031731 Bacteria 2665
200 Ga0307405_10381159 3300031731 Bacteria 1098
201 Ga0307410_10226499 3300031852 Bacteria 1441
202 Ga0307410_10305178 3300031852 Bacteria 1257
203 Ga0307407_10398809 3300031903 Bacteria 986
204 Ga0307412_10170675 3300031911 Bacteria 1626
205 Ga0307412_11462770 3300031911 Bacteria 620
206 Ga0307409_101148688 3300031995 Bacteria 799
207 Ga0307416_100124248 3300032002 Bacteria 2308
208 Ga0307414_10464765 3300032004 Bacteria 1113
209 Ga0307411_10472177 3300032005 Bacteria 1054
210 Ga0307415_100049250 3300032126 Bacteria 2848
211 Ga0373950_0034566 3300034818 Unclassified 948
212 Ga0373940_0214779 3300035088 Bacteria 637
213 Ga0373949_0212490 3300035090 Bacteria 585
214 Ga0373932_0109761 3300035112 Unclassified 908
215 Ga0373939_0006855 3300035114 Unclassified 2755
216 Ga0373954_0362162 3300035118 Unclassified 716
217 Ga0373955_0005123 3300035172 Bacteria 5859
218 Ga0373962_0127904 3300035242 Unclassified 815
219 Ga0373931_0017265 3300035691 Bacteria 3566
220 Ga0373931_0100245 3300035691 Unclassified 1628
221 Ga0373937_0000275 3300036401 Bacteria 49353
222 Ga0395905_0920551 3300037471 Unclassified 777
223 Ga0439441_079775 3300042001 Unclassified 711
224 Ga0439460_0068922 3300042461 Bacteria 1092
225 Ga0451577_0056245 3300042876 Bacteria 3509
226 Ga0453683_0028590 3300044673 Bacteria 3529
227 Ga0466960_0203036 3300044901 Unclassified 1084
228 Ga0451576_0222872 3300045051 Bacteria 1969
229 Ga0495651_0051130 3300046462 Unclassified 3187
230 Ga0495653_0099185 3300046463 Bacteria 2114
231 Ga0495580_0004743 3300046472 Bacteria 11381
232 Ga0495648_0010776 3300046524 Bacteria 6942
233 Ga0495652_0034754 3300046529 Unclassified 4392
234 Ga0495587_0017231 3300046536 Bacteria 4490
235 Ga0495659_0008522 3300046664 Bacteria 3263
236 Ga0495657_0516088 3300046675 Bacteria 696
237 Ga0495646_0170578 3300046680 Bacteria 1199
238 Ga0495604_0012986 3300047317 Bacteria 6639
239 Ga0495680_0156138 3300047322 Bacteria 1660
240 Ga0495680_0571929 3300047322 Bacteria 759
241 Ga0495675_0005293 3300047444 Bacteria 7858
242 Ga0495602_0000190 3300048088 Bacteria 58100
243 Ga0496103_0286402 3300048906 Bacteria 1060
244 Ga0501033_0341235 3300049570 Bacteria 1050
245 Ga0501036_0313917 3300049572 Bacteria 1310
246 Ga0501038_0066659 3300049574 Bacteria 3065
247 Ga0501038_0788327 3300049574 Bacteria 707
248 Ga0501039_0299679 3300049575 Bacteria 1264
249 Ga0501039_0345748 3300049575 Bacteria 1169
250 Ga0501039_0999599 3300049575 Bacteria 650
251 Ga0501040_0016209 3300049576 Bacteria 4927
252 Ga0501040_0079429 3300049576 Bacteria 2271
253 Ga0501040_0082936 3300049576 Bacteria 2223
254 Ga0501040_0104921 3300049576 Bacteria 1974
255 Ga0501041_0041987 3300049577 Bacteria 2778
256 Ga0501041_0113204 3300049577 Bacteria 1684
257 Ga0501041_0240591 3300049577 Bacteria 1137
258 Ga0501042_0114829 3300049578 Bacteria 1939
259 Ga0501046_0018124 3300049580 Bacteria 5863
260 Ga0501046_0046515 3300049580 Bacteria 3444
261 Ga0501048_0073882 3300049582 Bacteria 2406
262 Ga0501048_0372035 3300049582 Bacteria 1020
263 Ga0501067_0035864 3300049583 Bacteria 2754
264 Ga0501068_0059726 3300049584 Bacteria 2315
265 Ga0501069_0031183 3300049585 Bacteria 2930
266 Ga0501071_0047955 3300049587 Bacteria 3070
267 Ga0501071_0399074 3300049587 Unclassified 1050
268 Ga0501072_0149617 3300049588 Bacteria 1861
269 Ga0501073_0135642 3300049589 Bacteria 1706
270 Ga0501073_0502761 3300049589 Bacteria 838
271 Ga0501074_0033041 3300049590 Bacteria 3750
272 Ga0501075_0000940 3300049591 Bacteria 18537
273 Ga0501075_0075608 3300049591 Bacteria 2547
274 Ga0501075_0084564 3300049591 Bacteria 2403
275 Ga0501075_0672071 3300049591 Bacteria 789
276 Ga0501076_0014283 3300049592 Bacteria 5977
277 Ga0501077_0009726 3300049593 Bacteria 5978
278 Ga0501077_0050677 3300049593 Bacteria 2638
279 Ga0501077_0229986 3300049593 Bacteria 1179
280 Ga0501077_0794296 3300049593 Bacteria 608
281 Ga0501079_0001970 3300049741 Bacteria 14720
282 Ga0501079_0064469 3300049741 Bacteria 2826
283 Ga0501080_0102153 3300049742 Bacteria 2660
284 Ga0501080_0425126 3300049742 Unclassified 1193
285 Ga0501081_0001364 3300049743 Bacteria 14920
286 Ga0501081_0041607 3300049743 Bacteria 3148
287 Ga0501081_0115097 3300049743 Bacteria 1911
288 Ga0501081_0789748 3300049743 Bacteria 714
289 Ga0501083_0203383 3300049744 Bacteria 1291
290 Ga0501035_0232450 3300049822 Bacteria 1571
291 Ga0501035_0474924 3300049822 Bacteria 1032
292 Ga0501045_0005050 3300049824 Bacteria 9137
293 nmdc:mga05p37_118460_c1 3300050507 Bacteria 3254
294 nmdc:mga05p37_17271_c1 3300050507 Bacteria 8704
295 nmdc:mga05p37_20618_c1 3300050507 Bacteria 7976
296 nmdc:mga05p37_28060_c1 3300050507 Bacteria 6859
297 nmdc:mga05p37_30052_c1 3300050507 Bacteria 6630
298 nmdc:mga05p37_3103_c1 3300050507 Bacteria 19305
299 nmdc:mga05p37_419328_c1 3300050507 Unclassified 1558
300 nmdc:mga05p37_701932_c1 3300050507 Bacteria 1124
301 nmdc:mga05p37_722641_c1 3300050507 Bacteria 1103
302 nmdc:mga05p37_730190_c1 3300050507 Bacteria 1095
303 nmdc:mga05p37_765_c1 3300050507 Bacteria 35730
304 nmdc:mga05p37_956742_c1 3300050507 Unclassified 916
305 nmdc:mga09592_15513_c1 3300050508 Bacteria 6228
306 nmdc:mga09592_17929_c1 3300050508 Bacteria 5800
307 nmdc:mga09592_65600_c1 3300050508 Bacteria 3076
308 nmdc:mga09592_6830_c1 3300050508 Bacteria 9289
309 nmdc:mga09592_9587_c1 3300050508 Bacteria 7866
310 nmdc:mga0qj67_25975_c1 3300050509 Bacteria 2372
311 nmdc:mga0qj67_2632_c1 3300050509 Bacteria 12859
312 nmdc:mga06r32_1056325_c1 3300050510 Bacteria 763
313 nmdc:mga06r32_11107_c1 3300050510 Bacteria 8106
314 nmdc:mga06r32_111287_c1 3300050510 Bacteria 2695
315 nmdc:mga06r32_173957_c1 3300050510 Unclassified 2137
316 nmdc:mga06r32_4611_c1 3300050510 Bacteria 12358
317 nmdc:mga06r32_4762_c1 3300050510 Bacteria 12200
318 nmdc:mga06r32_57207_c1 3300050510 Bacteria 3745
319 nmdc:mga06r32_6706_c1 3300050510 Bacteria 10347
320 nmdc:mga08y16_207784_c1 3300050511 Unclassified 2028
321 nmdc:mga08y16_35405_c1 3300050511 Bacteria 5243
322 nmdc:mga0n895_1014228_c1 3300050512 Bacteria 811
323 nmdc:mga0n895_203630_c1 3300050512 Bacteria 2010
324 nmdc:mga0n895_268227_c1 3300050512 Bacteria 1732
325 nmdc:mga0n895_307123_c1 3300050512 Bacteria 1608
326 nmdc:mga0n895_392338_c1 3300050512 Bacteria 1404
327 nmdc:mga0n895_649_c1 3300050512 Bacteria 24262
328 nmdc:mga0n895_73392_c1 3300050512 Bacteria 3397
329 nmdc:mga0n895_7875_c1 3300050512 Bacteria 9187
330 nmdc:mga0rr50_103136_c1 3300050513 Bacteria 2245
331 nmdc:mga0rr50_208040_c1 3300050513 Bacteria 1611
332 nmdc:mga0rr50_232161_c1 3300050513 Bacteria 1527
333 nmdc:mga0rr50_6532_c1 3300050513 Bacteria 7111
334 nmdc:mga0rr50_71469_c1 3300050513 Bacteria 2648
335 nmdc:mga0rr50_981_c1 3300050513 Bacteria 15501
336 nmdc:mga08x19_190301_c1 3300050514 Bacteria 1404
337 nmdc:mga08x19_223739_c1 3300050514 Bacteria 1294
338 nmdc:mga08x19_400739_c1 3300050514 Bacteria 962
339 nmdc:mga08x19_6228_c1 3300050514 Bacteria 7060
340 nmdc:mga0a205_101047_c1 3300050515 Bacteria 2782
341 nmdc:mga0a205_179118_c1 3300050515 Bacteria 2014
342 nmdc:mga0a205_214893_c1 3300050515 Bacteria 1810
343 nmdc:mga0a205_241_c1 3300050515 Bacteria 38813
344 nmdc:mga0a205_2678_c1 3300050515 Bacteria 15751
345 nmdc:mga0a205_35057_c1 3300050515 Bacteria 4818
346 nmdc:mga0a205_617423_c1 3300050515 Bacteria 937
347 Ga0495619_0682366 3300053085 Bacteria 699
348 Ga0501084_0467337 3300054114 Bacteria 1066
349 Ga0501084_0581155 3300054114 Unclassified 947
350 Ga0501082_0002803 3300060353 Bacteria 15216
351 Ga0501082_0130090 3300060353 Bacteria 2184
352 Ga0501082_0217420 3300060353 Bacteria 1663
353 Ga0501082_0379546 3300060353 Bacteria 1233
354 Ga0530510_0000152 3300061734 Bacteria 41201
355 Ga0530510_0004725 3300061734 Bacteria 9423
356 Ga0530510_0236087 3300061734 Bacteria 1361
357 Ga0530510_0756013 3300061734 Bacteria 741
358 Ga0070707_100111969
359 Ga0070690_100171160
360 Ga0070690_100589842
361 Ga0068869_100010122
362 Ga0070689_100123587
363 Ga0070668_100048407
364 Ga0070671_100297089
365 Ga0070673_100199964
366 Ga0070667_100041049
367 Ga0070703_10174352
368 Ga0070705_100009940
369 Ga0070694_100019514
370 Ga0070694_100176241
371 Ga0070694_100354590
372 Ga0070694_100380415
373 Ga0070708_100003691
374 Ga0070708_100006350
375 Ga0070708_100285523
376 Ga0070708_100397974
377 Ga0070708_101126239
378 Ga0070663_100534162
379 Ga0070678_100211199
380 Ga0070706_100112053
381 Ga0070706_100181640
382 Ga0070707_100009948
383 Ga0070707_100094065
384 Ga0070707_100117911
385 Ga0070698_100017413
386 Ga0070698_100048409
387 Ga0070698_100435589
388 Ga0070698_100506806
389 Ga0070699_100003613
390 Ga0070699_100063657
391 Ga0070699_100096258
392 Ga0070699_100192686
393 Ga0070697_100004301
394 Ga0070697_100039773
395 Ga0070697_100074968
396 Ga0070697_100089927
397 Ga0070697_100286683
398 Ga0070697_100776864
399 Ga0070695_100000470
400 Ga0070695_100381235
401 Ga0070696_100031718
402 Ga0070696_100628937
403 Ga0070696_100748279
404 Ga0070704_100020832
405 Ga0070704_100038440
406 Ga0070704_100046212
407 Ga0070704_100277687
408 Ga0068857_100021821
409 Ga0068857_100043436
410 Ga0068854_100084809
411 Ga0070702_100165562
412 Ga0070702_100710353
413 Ga0068859_100838809
414 Ga0068864_100791429
415 Ga0068866_10576121
416 Ga0068861_100000716
417 Ga0068863_100092091
418 Ga0068858_100141050
419 Ga0068860_100003693
420 Ga0068860_100146423
421 Ga0068862_100035543
422 Ga0068862_100321485
423 Ga0068862_100699267
424 Ga0081539_10000454
425 Ga0070716_100437258
426 Ga0068871_100320837
427 Ga0075428_100006550
428 Ga0075428_100040921
429 Ga0075428_100094358
430 Ga0075430_100007018
431 Ga0075430_100017673
432 Ga0075430_100073317
433 Ga0075430_100080874
434 Ga0075431_100002433
435 Ga0075431_100006440
436 Ga0075431_100040537
437 Ga0075431_100077265
438 Ga0075431_100195657
439 Ga0075431_100284429
440 Ga0075431_100286638
441 Ga0075431_100288852
442 Ga0075431_101165342
443 Ga0075431_101620084
444 Ga0075433_10000340
445 Ga0075433_10008230
446 Ga0075433_10232635
447 Ga0075433_10466871
448 Ga0075433_11064132
449 Ga0075434_100000683
450 Ga0075434_100044443
451 Ga0075434_100111516
452 Ga0075434_100168494
453 Ga0075434_100311268
454 Ga0075434_100458798
455 Ga0075429_100002255
456 Ga0075429_100002568
457 Ga0075429_100010978
458 Ga0075429_100054126
459 Ga0075436_100004882
460 Ga0075436_100058564
461 Ga0075436_100064064
462 Ga0075436_100802941
463 Ga0097620_100838776
464 Ga0075435_100034956
465 Ga0075435_100082778
466 Ga0075435_100085970
467 Ga0075435_100189047
468 Ga0099794_10011568
469 Ga0099794_10182134
470 Ga0111539_10000304
471 Ga0111539_10072764
472 Ga0111539_10540371
473 Ga0105245_10239546
474 Ga0105247_10723546
475 Ga0114129_10000441
476 Ga0114129_10003561
477 Ga0114129_10008013
478 Ga0114129_10010932
479 Ga0114129_10011520
480 Ga0114129_10039843
481 Ga0114129_10067478
482 Ga0114129_10165554
483 Ga0114129_10290860
484 Ga0114129_10778783
485 Ga0114129_10897646
486 Ga0105243_10218042
487 Ga0105248_10030421
488 Ga0105249_10201341
489 Ga0105249_10556447
490 Ga0105249_10667609
491 Ga0157378_10061883
492 Ga0157378_10263371
493 Ga0157375_10357495
494 Ga0157375_10429263
495 Ga0163163_10015172
496 Ga0157379_10270636
497 Ga0207710_10374689
498 Ga0207643_10018982
499 Ga0207684_10000279
500 Ga0207684_10079477
501 Ga0207684_10089450
502 Ga0207646_10003199
503 Ga0207646_10055728
504 Ga0207646_10138743
505 Ga0207681_10041028
506 Ga0207644_10497743
507 Ga0207706_10975096
508 Ga0207711_10328007
509 Ga0207689_10000889
510 Ga0207651_10154283
511 Ga0207712_10389553
512 Ga0207668_10047360
513 Ga0207640_10132594
514 Ga0207658_10360422
515 Ga0207703_10015395
516 Ga0207678_10128627
517 Ga0207708_10087121
518 Ga0207641_11445779
519 Ga0207648_10002230
520 Ga0207648_10447507
521 Ga0207676_10009251
522 Ga0207674_10016849
523 Ga0207674_10088482
524 Ga0207675_100000855
525 Ga0209998_10065950
526 Ga0207428_10000009
527 Ga0268265_10198587
528 Ga0268265_11375464
529 Ga0268264_10081007
530 Ga0268264_10333311
531 Ga0265319_1010728
532 Ga0265318_10000376
533 Ga0265318_10007693
534 Ga0265338_10249795
535 Ga0265338_10367092
536 Ga0265330_10007937
537 Ga0265332_10005630
538 Ga0265328_10024747
539 Ga0265320_10001265
540 Ga0265320_10250305
541 Ga0265325_10001744
542 Ga0265325_10034922
543 Ga0265329_10000989
544 Ga0265340_10004031
545 Ga0265339_10004395
546 Ga0265331_10002322
547 Ga0265316_10002436
548 Ga0265316_10006643
549 Ga0307408_100026132
550 Ga0307408_100924889
551 Ga0307408_101000655
552 Ga0265313_10000551
553 Ga0265313_10002850
554 Ga0265314_10005700
555 Ga0265342_10000271
556 Ga0307405_10046597
557 Ga0307405_10381159
558 Ga0307410_10226499
559 Ga0307410_10305178
560 Ga0307407_10398809
561 Ga0307412_10170675
562 Ga0307412_11462770
563 Ga0307409_101148688
564 Ga0307416_100124248
565 Ga0307414_10464765
566 Ga0307411_10472177
567 Ga0307415_100049250
568 Ga0373950_0034566
569 Ga0373940_0214779
570 Ga0373949_0212490
571 Ga0373932_0109761
572 Ga0373939_0006855
573 Ga0373954_0362162
574 Ga0373955_0005123
575 Ga0373962_0127904
576 Ga0373931_0017265
577 Ga0373931_0100245
578 Ga0373937_0000275
579 Ga0395905_0920551
580 Ga0439441_079775
581 Ga0439460_0068922
582 Ga0451577_0056245
583 Ga0453683_0028590
584 Ga0466960_0203036
585 Ga0451576_0222872
586 Ga0495651_0051130
587 Ga0495653_0099185
588 Ga0495580_0004743
589 Ga0495648_0010776
590 Ga0495652_0034754
591 Ga0495587_0017231
592 Ga0495659_0008522
593 Ga0495657_0516088
594 Ga0495646_0170578
595 Ga0495604_0012986
596 Ga0495680_0156138
597 Ga0495680_0571929
598 Ga0495675_0005293
599 Ga0495602_0000190
600 Ga0496103_0286402
601 Ga0501033_0341235
602 Ga0501036_0313917
603 Ga0501038_0066659
604 Ga0501038_0788327
605 Ga0501039_0299679
606 Ga0501039_0345748
607 Ga0501039_0999599
608 Ga0501040_0016209
609 Ga0501040_0079429
610 Ga0501040_0082936
611 Ga0501040_0104921
612 Ga0501041_0041987
613 Ga0501041_0113204
614 Ga0501041_0240591
615 Ga0501042_0114829
616 Ga0501046_0018124
617 Ga0501046_0046515
618 Ga0501048_0073882
619 Ga0501048_0372035
620 Ga0501067_0035864
621 Ga0501068_0059726
622 Ga0501069_0031183
623 Ga0501071_0047955
624 Ga0501071_0399074
625 Ga0501072_0149617
626 Ga0501073_0135642
627 Ga0501073_0502761
628 Ga0501074_0033041
629 Ga0501075_0000940
630 Ga0501075_0075608
631 Ga0501075_0084564
632 Ga0501075_0672071
633 Ga0501076_0014283
634 Ga0501077_0009726
635 Ga0501077_0050677
636 Ga0501077_0229986
637 Ga0501077_0794296
638 Ga0501079_0001970
639 Ga0501079_0064469
640 Ga0501080_0102153
641 Ga0501080_0425126
642 Ga0501081_0001364
643 Ga0501081_0041607
644 Ga0501081_0115097
645 Ga0501081_0789748
646 Ga0501083_0203383
647 Ga0501035_0232450
648 Ga0501035_0474924
649 Ga0501045_0005050
650 nmdc:mga05p37_118460_c1
651 nmdc:mga05p37_17271_c1
652 nmdc:mga05p37_20618_c1
653 nmdc:mga05p37_28060_c1
654 nmdc:mga05p37_30052_c1
655 nmdc:mga05p37_3103_c1
656 nmdc:mga05p37_419328_c1
657 nmdc:mga05p37_701932_c1
658 nmdc:mga05p37_722641_c1
659 nmdc:mga05p37_730190_c1
660 nmdc:mga05p37_765_c1
661 nmdc:mga05p37_956742_c1
662 nmdc:mga09592_15513_c1
663 nmdc:mga09592_17929_c1
664 nmdc:mga09592_65600_c1
665 nmdc:mga09592_6830_c1
666 nmdc:mga09592_9587_c1
667 nmdc:mga0qj67_25975_c1
668 nmdc:mga0qj67_2632_c1
669 nmdc:mga06r32_1056325_c1
670 nmdc:mga06r32_11107_c1
671 nmdc:mga06r32_111287_c1
672 nmdc:mga06r32_173957_c1
673 nmdc:mga06r32_4611_c1
674 nmdc:mga06r32_4762_c1
675 nmdc:mga06r32_57207_c1
676 nmdc:mga06r32_6706_c1
677 nmdc:mga08y16_207784_c1
678 nmdc:mga08y16_35405_c1
679 nmdc:mga0n895_1014228_c1
680 nmdc:mga0n895_203630_c1
681 nmdc:mga0n895_268227_c1
682 nmdc:mga0n895_307123_c1
683 nmdc:mga0n895_392338_c1
684 nmdc:mga0n895_649_c1
685 nmdc:mga0n895_73392_c1
686 nmdc:mga0n895_7875_c1
687 nmdc:mga0rr50_103136_c1
688 nmdc:mga0rr50_208040_c1
689 nmdc:mga0rr50_232161_c1
690 nmdc:mga0rr50_6532_c1
691 nmdc:mga0rr50_71469_c1
692 nmdc:mga0rr50_981_c1
693 nmdc:mga08x19_190301_c1
694 nmdc:mga08x19_223739_c1
695 nmdc:mga08x19_400739_c1
696 nmdc:mga08x19_6228_c1
697 nmdc:mga0a205_101047_c1
698 nmdc:mga0a205_179118_c1
699 nmdc:mga0a205_214893_c1
700 nmdc:mga0a205_241_c1
701 nmdc:mga0a205_2678_c1
702 nmdc:mga0a205_35057_c1
703 nmdc:mga0a205_617423_c1
704 Ga0495619_0682366
705 Ga0501084_0467337
706 Ga0501084_0581155
707 Ga0501082_0002803
708 Ga0501082_0130090
709 Ga0501082_0217420
710 Ga0501082_0379546
711 Ga0530510_0000152
712 Ga0530510_0004725
713 Ga0530510_0236087
714 Ga0530510_0756013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

73

145

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

17

138

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

50

137

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9707 6 163
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9514 7 163
7zkt-assembly1.cif.gz_B moss spermine/spermidine acetyl transferase (ppssat) in complex with coa and lysine 0.9355 6 160
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9334 7 163
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.9229 53 142
ID Description Score Start End Superfamily
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9754 4 164 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9514 7 163 3.40.630.30
af_B6SUK9_20_214_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9491 11 162 3.40.630.30
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9464 4 164 3.40.630.30
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9421 6 164 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A353VC08-F1-model_v4 N-acetyltransferase 0.983 6 163 GO:0008080
AF-A0A837VEI5-F1-model_v4 deleted 0.9816 6 165
AF-A0A6S6NBX0-F1-model_v4 deleted 0.9808 5 164
AF-B2Q1E6-F1-model_v4 deleted 0.9808 6 162
AF-A0A3M3S116-F1-model_v4 Acetyltransferase, GNAT protein 0.98 6 164 GO:0008080

Map