F420750

General Info

Members Datasets Scaffolds Average Seq Length
357 317 180 127

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100860906|Ga0070708_1008609062
Length 137
Sequence MVIDTSAMIAIALDEPEAAPFEQLIANDPVRLISAATVLEVAMALETRLGEAAGRELDLWLLKAGIDMIAVDADQVDVARRAWRRFGKGRHPAGLNYGDCFSYALAFTRQEPLLFKGNDFSKTDIGRVDPATPTGPA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
6 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
7 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
8 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
9 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
10 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
11 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
12 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
13 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
14 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
15 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
16 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
17 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
18 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
19 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
20 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
21 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
22 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
23 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
24 2643221610 Ensifer sp. Root74 Isolate Unclassified
25 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
26 2643221675 Ensifer sp. Root1298 Isolate Unclassified
27 2643221680 Ensifer sp. Root1312 Isolate Unclassified
28 2643221726 Ensifer sp. Root954 Isolate Unclassified
29 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
30 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
31 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
32 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
33 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
34 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
35 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
36 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
37 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
38 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
39 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
40 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
41 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
42 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
43 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
44 2904699407
45 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
46 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
47 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
48 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
49 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
50 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
51 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
52 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
53 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
54 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
55 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
56 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
57 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
58 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
59 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
60 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
61 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
62 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
63 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
64 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
65 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
66 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
67 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
68 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
69 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
70 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
71 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
72 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
73 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
74 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
75 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
76 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
77 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
78 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
79 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
80 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
81 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
82 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
83 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
84 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
85 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
86 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
87 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
88 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
89 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
90 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
91 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
92 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
93 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
94 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
95 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
96 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
97 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
98 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
99 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
100 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
101 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
102 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
103 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
104 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
105 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
106 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
107 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
108 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
109 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
110 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
111 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
112 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
113 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
114 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
115 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
116 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
117 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
118 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
119 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
120 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
121 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
122 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
123 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
124 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
125 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
126 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
127 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
128 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
129 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
130 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
131 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
132 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
133 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
134 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
135 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
136 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
137 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
138 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
139 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
140 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
141 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
142 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
143 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
144 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
145 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
146 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
147 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
148 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
149 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
150 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
151 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
152 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
153 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
154 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
155 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
156 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
157 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
158 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
159 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
160 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
161 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
162 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
163 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
164 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
165 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
166 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
167 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
168 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
169 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
170 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
173 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
174 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
175 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
176 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
179 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
180 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
181 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
182 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
183 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
184 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
185 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
186 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
187 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
188 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
189 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
190 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
191 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
193 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
194 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
195 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
196 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
197 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
198 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
199 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
200 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
201 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
202 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
203 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
204 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
205 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
206 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
207 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
208 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
209 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
214 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
246 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
288 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
289 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
290 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
291 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
292 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
295 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
298 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
301 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
302 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
305 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
306 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
307 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
308 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
309 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
310 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
311 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
312 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
313 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
314 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
315 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
316 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
317 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.56
Metatranscriptomes 0
Isolates 49.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.61
Nodule 43.98
Rhizoplane 0
Rhizosphere 31.09
Stem 0
Stem Tuber 0
Unclassified 12.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000661 3300002737 Bacteria 24376
2 JGI25152J39213_1001578 3300002773 Bacteria 9561
3 JGI25151J46595_10020104 3300003187 Bacteria 2822
4 JGI25165J46597_1000604 3300003214 Bacteria 30711
5 JGI25153J46596_10086985 3300003215 Bacteria 764
6 rootL2_10185589 3300003322 Bacteria 4134
7 rootH1_10255606 3300003323 Bacteria 1001
8 Ga0055524_1000446 3300003775 Bacteria 34169
9 Ga0070683_101651056 3300005329 Bacteria 616
10 Ga0070690_100467673 3300005330 Bacteria 938
11 Ga0070670_100392433 3300005331 Bacteria 1224
12 Ga0068869_100949337 3300005334 Bacteria 746
13 Ga0070668_100055025 3300005347 Bacteria 3070
14 Ga0070671_101569323 3300005355 Bacteria 583
15 Ga0070667_100850337 3300005367 Bacteria 848
16 Ga0070700_101318835 3300005441 Bacteria 607
17 Ga0070708_100860906 3300005445 Unclassified 851
18 Ga0068867_100714975 3300005459 Unclassified 885
19 Ga0070698_100489040 3300005471 Bacteria 1168
20 Ga0070698_100966909 3300005471 Bacteria 798
21 Ga0068853_101406095 3300005539 Bacteria 675
22 Ga0070665_100080970 3300005548 Bacteria 3253
23 Ga0068857_100654304 3300005577 Unclassified 996
24 Ga0068856_100499156 3300005614 Bacteria 1238
25 Ga0075432_10125338 3300006058 Bacteria 968
26 Ga0075366_10348791 3300006195 Bacteria 908
27 Ga0075428_100144394 3300006844 Bacteria 2587
28 Ga0079104_1069473 3300006946 Bacteria 742
29 Ga0111539_10108245 3300009094 Bacteria 3261
30 Ga0111539_10456723 3300009094 Bacteria 1488
31 Ga0105237_11727740 3300009545 Bacteria 633
32 Ga0105249_10724301 3300009553 Unclassified 1056
33 Ga0105239_10361323 3300010375 Bacteria 1640
34 Ga0105239_10966425 3300010375 Bacteria 979
35 Ga0171463_1002 3300013249 Bacteria 1274851
36 Ga0157380_10096152 3300014326 Unclassified 2455
37 Ga0157380_10135760 3300014326 Bacteria 2105
38 Ga0157380_10814522 3300014326 Bacteria 952
39 Ga0183362_10719 3300015683 Bacteria 739
40 Ga0183365_11217 3300015684 Bacteria 927
41 Ga0183363_1220 3300015690 Bacteria 10884
42 Ga0213873_10103518 3300021358 Bacteria 821
43 Ga0213872_10053411 3300021361 Bacteria 1833
44 Ga0213874_10080218 3300021377 Bacteria 1056
45 Ga0213876_10003484 3300021384 Bacteria 8990
46 Ga0213875_10004846 3300021388 Bacteria 7309
47 Ga0213875_10012530 3300021388 Bacteria 4184
48 Ga0213871_10028827 3300021441 Bacteria 1435
49 Ga0209437_100330 3300025233 Bacteria 59093
50 Ga0209129_1000082 3300025258 Bacteria 183436
51 Ga0209233_1000304 3300025261 Bacteria 59093
52 Ga0209673_1046366 3300025273 Bacteria 1187
53 Ga0209675_1054392 3300025291 Bacteria 813
54 Ga0209025_1000172 3300025294 Bacteria 160407
55 Ga0209564_1056496 3300025295 Bacteria 912
56 Ga0209564_1067313 3300025295 Bacteria 764
57 Ga0209758_1032553 3300025297 Bacteria 2113
58 Ga0209256_1000286 3300025299 Bacteria 88880
59 Ga0209256_1030586 3300025299 Bacteria 1485
60 Ga0209256_1051400 3300025299 Bacteria 994
61 Ga0209051_1022794 3300025303 Bacteria 2625
62 Ga0207707_10844931 3300025912 Bacteria 760
63 Ga0207646_10021942 3300025922 Bacteria 5889
64 Ga0207681_10671305 3300025923 Bacteria 860
65 Ga0207659_11612911 3300025926 Unclassified 554
66 Ga0207712_11289250 3300025961 Bacteria 653
67 Ga0207668_10386591 3300025972 Bacteria 1179
68 Ga0207658_10060937 3300025986 Unclassified 2818
69 Ga0207648_10333159 3300026089 Bacteria 1365
70 Ga0207675_100333895 3300026118 Bacteria 1482
71 Ga0209281_1001059 3300027111 Bacteria 20700
72 Ga0207428_10049542 3300027907 Bacteria 3365
73 Ga0268266_10792697 3300028379 Bacteria 915
74 Ga0268264_10434759 3300028381 Bacteria 1268
75 Ga0307515_10013157 3300028794 Bacteria 15484
76 Ga0307515_10023501 3300028794 Bacteria 10797
77 Ga0307515_10180164 3300028794 Bacteria 2066
78 Ga0307513_10222703 3300031456 Bacteria 1706
79 Ga0307509_10477829 3300031507 Bacteria 935
80 Ga0307413_11183818 3300031824 Bacteria 664
81 Ga0307406_10630505 3300031901 Bacteria 887
82 Ga0307416_100622342 3300032002 Bacteria 1162
83 Ga0307416_102230060 3300032002 Bacteria 649
84 Ga0307415_101876918 3300032126 Unclassified 581
85 Ga0395900_0541164 3300037418 Bacteria 1110
86 Ga0395905_0005673 3300037471 Bacteria 12694
87 Ga0395905_0111855 3300037471 Bacteria 2564
88 Ga0395905_0981100 3300037471 Bacteria 748
89 Ga0436364_0537342 3300037853 Bacteria 24339
90 Ga0436364_0798105 3300037853 Bacteria 1879
91 Ga0436364_1125759 3300037853 Bacteria 1375
92 Ga0395901_0706599 3300038443 Bacteria 1005
93 Ga0436365_0518832 3300039437 Bacteria 1395
94 Ga0436360_0197657 3300039438 Bacteria 820
95 Ga0436360_0292716 3300039438 Bacteria 3435
96 Ga0436360_0382486 3300039438 Bacteria 694
97 Ga0436360_0483369 3300039438 Bacteria 859
98 Ga0436360_0550444 3300039438 Unclassified 1230
99 Ga0436361_0466547 3300039447 Bacteria 2700
100 Ga0436361_0616956 3300039447 Bacteria 2342
101 Ga0436363_0206766 3300039450 Bacteria 545
102 Ga0436363_0959216 3300039450 Bacteria 635
103 Ga0436362_0280117 3300039453 Bacteria 1225
104 Ga0436362_0639017 3300039453 Bacteria 2978
105 Ga0436362_1016148 3300039453 Bacteria 2038
106 Ga0436362_1277148 3300039453 Bacteria 1600
107 Ga0439443_096428 3300042003 Unclassified 563
108 Ga0450910_093643 3300042147 Unclassified 534
109 Ga0439458_0130609 3300042157 Bacteria 665
110 Ga0466961_0989295 3300044693 Bacteria 500
111 Ga0466960_0026067 3300044901 Bacteria 2651
112 Ga0495606_0151829 3300046507 Bacteria 1359
113 Ga0495628_0317495 3300046516 Unclassified 1150
114 Ga0495643_0109491 3300046522 Bacteria 1406
115 Ga0495643_0114460 3300046522 Bacteria 1368
116 Ga0495670_0154269 3300046691 Bacteria 1205
117 Ga0495660_0419638 3300046810 Bacteria 583
118 Ga0496116_0477758 3300048919 Bacteria 525
119 Ga0496117_0152643 3300048920 Bacteria 1365
120 Ga0496121_0049066 3300048924 Bacteria 3584
121 Ga0496121_0332827 3300048924 Bacteria 1018
122 Ga0496122_0238371 3300048925 Bacteria 1028
123 Ga0496124_0391766 3300048927 Bacteria 967
124 Ga0496126_0027117 3300048929 Bacteria 5478
125 Ga0501031_0368160 3300049568 Bacteria 930
126 Ga0501032_0048669 3300049569 Bacteria 2862
127 Ga0501034_0030728 3300049571 Bacteria 5459
128 Ga0501034_0168737 3300049571 Bacteria 2156
129 Ga0501034_0818806 3300049571 Bacteria 823
130 Ga0501036_0089299 3300049572 Bacteria 2604
131 Ga0501036_0362505 3300049572 Bacteria 1210
132 Ga0501037_0040177 3300049573 Bacteria 3443
133 Ga0501038_0040846 3300049574 Bacteria 4048
134 Ga0501039_0128080 3300049575 Bacteria 1992
135 Ga0501040_0167358 3300049576 Bacteria 1556
136 Ga0501042_0066695 3300049578 Bacteria 2573
137 Ga0501046_0571533 3300049580 Bacteria 804
138 Ga0501047_0027146 3300049581 Bacteria 5515
139 Ga0501048_0478468 3300049582 Bacteria 893
140 Ga0501048_0638566 3300049582 Archaea 764
141 Ga0501068_0158071 3300049584 Bacteria 1428
142 Ga0501073_0067846 3300049589 Bacteria 2486
143 Ga0501073_0098642 3300049589 Bacteria 2029
144 Ga0501075_1054462 3300049591 Bacteria 617
145 Ga0501076_0811160 3300049592 Bacteria 772
146 Ga0501080_0259497 3300049742 Bacteria 1584
147 Ga0501080_0356333 3300049742 Bacteria 1320
148 Ga0501080_0477056 3300049742 Bacteria 1116
149 Ga0501081_1497063 3300049743 Bacteria 513
150 Ga0501083_0016522 3300049744 Bacteria 5163
151 Ga0501035_0069393 3300049822 Bacteria 3125
152 Ga0501035_0280061 3300049822 Bacteria 1409
153 Ga0501044_0345575 3300049823 Bacteria 1408
154 nmdc:mga0k408_196067_c1 3300050493 Bacteria 1205
155 nmdc:mga0k408_348036_c1 3300050493 Bacteria 883
156 nmdc:mga07m45_210059_c1 3300050496 Bacteria 1132
157 nmdc:mga09592_318488_c1 3300050508 Bacteria 1347
158 nmdc:mga08y16_527802_c1 3300050511 Bacteria 1197
159 Ga0500566_0180514 3300053094 Bacteria 1083
160 Ga0500640_099450 3300053095 Bacteria 1204
161 Ga0500556_0237274 3300053104 Bacteria 719
162 Ga0500569_111203 3300053109 Bacteria 906
163 Ga0500572_017777 3300053111 Bacteria 1831
164 Ga0500607_010830 3300053121 Bacteria 5407
165 Ga0500614_029772 3300053123 Bacteria 1327
166 Ga0500559_0050886 3300053136 Bacteria 1828
167 Ga0500564_040364 3300053138 Bacteria 2149
168 Ga0500590_024679 3300053148 Bacteria 3120
169 Ga0500616_0000108 3300053153 Bacteria 152917
170 Ga0500616_0170134 3300053153 Bacteria 990
171 Ga0500619_070418 3300053154 Bacteria 1162
172 Ga0500620_001402 3300053155 Bacteria 4424
173 Ga0500622_0037698 3300053156 Bacteria 2524
174 Ga0500624_032167 3300053157 Bacteria 907
175 Ga0500627_0168304 3300053158 Bacteria 988
176 Ga0500638_093907 3300053162 Bacteria 1408
177 Ga0500636_0003031 3300053177 Bacteria 9417
178 Ga0500636_0003245 3300053177 Bacteria 9113
179 Ga0500567_201756 3300053723 Bacteria 662
180 Ga0500601_016097 3300053737 Bacteria 852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0811160 Ga0501076_0811160_406_744 111
2 iso_pu_bacteria 2842509118 2842512449 123
3 iso_pu_bacteria 2508501122 2509112530 124
4 iso_pu_bacteria 2508501128 2509148928 124
5 iso_pu_bacteria 2510917030 2511193417 124
6 iso_pu_bacteria 2511231052 2511500678 124
7 iso_pu_bacteria 2513237086 2513585757 124
8 iso_pu_bacteria 2513237091 2513616830 124
9 iso_pu_bacteria 2513237140 2513880756 124
10 iso_pu_bacteria 2513237143 2513903750 124
11 iso_pu_bacteria 2513237351 2514592667 124
12 iso_pu_bacteria 2516653046 2516891953 124
13 iso_pu_bacteria 2524023205 2524443426 124
14 iso_pu_bacteria 2524023228 2524541800 124
15 iso_pu_bacteria 2528768022 2528856491 124
16 iso_pu_bacteria 2551306084 2551676538 124
17 iso_pu_bacteria 2551306085 2551686930 124
18 iso_pu_bacteria 2551306086 2551695772 124
19 iso_pu_bacteria 2551306087 2551699845 124
20 iso_pu_bacteria 2551306089 2551709881 124
21 iso_pu_bacteria 2551306090 2551723495 124
22 iso_pu_bacteria 2551306091 2551728080 124
23 iso_pu_bacteria 2551306092 2551738955 124
24 iso_pu_bacteria 2551306093 2551742077 124
25 iso_pu_bacteria 2643221610 2644068016 124
26 iso_pu_bacteria 2643221623 2644130256 124
27 iso_pu_bacteria 2643221675 2644418879 124
28 iso_pu_bacteria 2643221680 2644452306 124
29 iso_pu_bacteria 2643221726 2644687050 124
30 iso_pu_bacteria 2852387548 2852393178 124
31 iso_pu_bacteria 2858800743 2858804063 124
32 iso_pu_bacteria 2876808645 2876814912 124
33 iso_pu_bacteria 2876808645 2876816821 124
34 iso_pu_bacteria 2879110137 2879116645 124
35 iso_pu_bacteria 2879110137 2879118147 124
36 iso_pu_bacteria 2885383462 2885392961 124
37 iso_pu_bacteria 2904699407 2904699623 124
38 iso_pu_bacteria 2915986958 2915989365 124
39 iso_pu_bacteria 2915993759 2915999534 124
40 iso_pu_bacteria 2916068649 2916069527 124
41 iso_pu_bacteria 2920822456 2920827557 124
42 iso_pu_bacteria 2921201388 2921205690 124
43 iso_pu_bacteria 2921257292 2921258004 124
44 iso_pu_bacteria 2924158325 2924161350 124
45 iso_pu_bacteria 2924193448 2924199768 124
46 iso_pu_bacteria 2935703347 2935713054 124
47 iso_pu_bacteria 2935992306 2936001801 124
48 iso_pu_bacteria 2937002841 2937009409 124
49 iso_pu_bacteria 2937009748 2937016018 124
50 iso_pu_bacteria 2937016420 2937022459 124
51 iso_pu_bacteria 2937023124 2937026799 124
52 iso_pu_bacteria 2937042894 2937043586 124
53 iso_pu_bacteria 2937049772 2937053811 124
54 iso_pu_bacteria 2937056579 2937060895 124
55 iso_pu_bacteria 2937063883 2937070684 124
56 iso_pu_bacteria 2937071275 2937078344 124
57 iso_pu_bacteria 2937091812 2937094628 124
58 iso_pu_bacteria 2937098957 2937100006 124
59 iso_pu_bacteria 2937106411 2937109651 124
60 iso_pu_bacteria 2937113482 2937117023 124
61 iso_pu_bacteria 2937119839 2937125647 124
62 iso_pu_bacteria 2937126314 2937132369 124
63 iso_pu_bacteria 2937848649 2937851225 124
64 iso_pu_bacteria 2957382221 2957388124 124
65 iso_pu_bacteria 2957388812 2957392620 124
66 iso_pu_bacteria 2957395598 2957398490 124
67 iso_pu_bacteria 2957402308 2957408180 124
68 iso_pu_bacteria 2957408893 2957414623 124
69 iso_pu_bacteria 2957415311 2957415664 124
70 iso_pu_bacteria 2957422303 2957427211 124
71 iso_pu_bacteria 2957430029 2957433802 124
72 iso_pu_bacteria 2957443900 2957446388 124
73 iso_pu_bacteria 2957450854 2957457271 124
74 iso_pu_bacteria 2957457609 2957458179 124
75 iso_pu_bacteria 2957464669 2957470714 124
76 iso_pu_bacteria 2957471148 2957474778 124
77 iso_pu_bacteria 2957478035 2957484398 124
78 iso_pu_bacteria 2957484790 2957488383 124
79 iso_pu_bacteria 2957491536 2957495463 124
80 iso_pu_bacteria 2957498199 2957502237 124
81 iso_pu_bacteria 2957505466 2957509326 124
82 iso_pu_bacteria 2960584000 2960586278 124
83 iso_pu_bacteria 2960597568 2960603161 124
84 iso_pu_bacteria 2960603979 2960604449 124
85 iso_pu_bacteria 2960617483 2960621111 124
86 iso_pu_bacteria 2960637947 2960638267 124
87 iso_pu_bacteria 2960645483 2960650354 124
88 iso_pu_bacteria 2960652885 2960653638 124
89 iso_pu_bacteria 2960660292 2960664714 124
90 iso_pu_bacteria 2960667422 2960668330 124
91 iso_pu_bacteria 2960674078 2960675895 124
92 iso_pu_bacteria 2964607997 2964615237 124
93 iso_pu_bacteria 2964615318 2964616692 124
94 iso_pu_bacteria 2964621998 2964622648 124
95 iso_pu_bacteria 2964628898 2964633618 124
96 iso_pu_bacteria 2964636051 2964638224 124
97 iso_pu_bacteria 2964643177 2964649571 124
98 iso_pu_bacteria 2964649959 2964653540 124
99 iso_pu_bacteria 2964656573 2964657609 124
100 iso_pu_bacteria 2964663802 2964670445 124
101 iso_pu_bacteria 2964670856 2964677988 124
102 iso_pu_bacteria 2964678106 2964681367 124
103 iso_pu_bacteria 2964685014 2964685487 124
104 iso_pu_bacteria 2964691889 2964692253 124
105 iso_pu_bacteria 2964698721 2964699877 124
106 iso_pu_bacteria 2964705432 2964712578 124
107 iso_pu_bacteria 2964712639 2964715714 124
108 iso_pu_bacteria 2964719344 2964725162 124
109 iso_pu_bacteria 2967664464 2967667949 124
110 iso_pu_bacteria 2967671571 2967672069 124
111 iso_pu_bacteria 2967678726 2967683315 124
112 iso_pu_bacteria 2967693043 2967696616 124
113 iso_pu_bacteria 2967699805 2967702379 124
114 iso_pu_bacteria 2967706974 2967711764 124
115 iso_pu_bacteria 2967714385 2967718192 124
116 iso_pu_bacteria 2967721400 2967725994 124
117 iso_pu_bacteria 2967735183 2967738212 124
118 iso_pu_bacteria 2967742019 2967744775 124
119 iso_pu_bacteria 2967748971 2967755100 124
120 iso_pu_bacteria 2967755722 2967756691 124
121 iso_pu_bacteria 2967762386 2967767072 124
122 iso_pu_bacteria 2967769361 2967775343 124
123 iso_pu_bacteria 2967775926 2967779902 124
124 iso_pu_bacteria 2970019648 2970024803 124
125 iso_pu_bacteria 2970033650 2970037615 124
126 iso_pu_bacteria 2970040964 2970045283 124
127 iso_pu_bacteria 2970047711 2970054093 124
128 iso_pu_bacteria 2970054988 2970058787 124
129 iso_pu_bacteria 2970061556 2970063764 124
130 iso_pu_bacteria 2970068827 2970072801 124
131 iso_pu_bacteria 2970076120 2970081525 124
132 iso_pu_bacteria 2970082768 2970086246 124
133 iso_pu_bacteria 2970088815 2970095362 124
134 iso_pu_bacteria 2970095765 2970096216 124
135 iso_pu_bacteria 2970102677 2970106386 124
136 iso_pu_bacteria 2970109326 2970113569 124
137 iso_pu_bacteria 2970116247 2970120315 124
138 iso_pu_bacteria 2970129317 2970132906 124
139 iso_pu_bacteria 2970136068 2970139858 124
140 iso_pu_bacteria 2970149975 2970153706 124
141 iso_pu_bacteria 2970156795 2970161645 124
142 iso_pu_bacteria 2970164137 2970170281 124
143 iso_pu_bacteria 2970170962 2970177502 124
144 iso_pu_bacteria 2970184632 2970190938 124
145 iso_pu_bacteria 2970191845 2970195855 124
146 iso_pu_bacteria 2977523885 2977530391 124
147 iso_pu_bacteria 2977537788 2977544020 124
148 iso_pu_bacteria 2977551784 2977555726 124
149 iso_pu_bacteria 2977558990 2977559510 124
150 iso_pu_bacteria 2977565890 2977572291 124
151 iso_pu_bacteria 2977572785 2977577610 124
152 iso_pu_bacteria 2977579622 2977583966 124
153 iso_pu_bacteria 2977922695 2977924865 124
154 iso_pu_bacteria 2989771324 2989775527 124
155 iso_pu_bacteria 3004211236 3004212366 124
156 iso_pu_bacteria 3004218560 3004224279 124
157 iso_pu_bacteria 643348564 643597347 124
158 iso_pu_bacteria 648276728 648741459 124
159 iso_pu_bacteria 8003992118 8003992571 124
160 iso_pu_bacteria 8006973647 8006984048 124
161 iso_pu_bacteria 8016511872 8016511949 124
162 iso_pu_bacteria 8017057580 8017066513 124
163 iso_pu_bacteria 8019576017 8019586526 124
164 iso_pu_bacteria 8019586578 8019597547 124
165 iso_pu_bacteria 8019597564 8019607708 124
166 iso_pu_bacteria 8019608314 8019619078 124
167 iso_pu_bacteria 8057529695 8057535940 124
168 3300050493 nmdc:mga0k408_196067_c1 nmdc:mga0k408_196067_c1_249_644 125
169 iso_pu_bacteria 8023680758 8023682496 125
170 iso_pu_bacteria 2844533157 2844537365 126
171 3300003323 rootH1_10255606 rootH1_102556062 128
172 3300003775 Ga0055524_1000446 Ga0055524_100044614 128
173 3300006946 Ga0079104_1069473 Ga0079104_10694731 128
174 3300009545 Ga0105237_11727740 Ga0105237_117277402 128
175 3300013249 Ga0171463_1002 Ga0171463_1002831 128
176 3300015683 Ga0183362_10719 Ga0183362_107191 128
177 3300015684 Ga0183365_11217 Ga0183365_112172 128
178 3300015690 Ga0183363_1220 Ga0183363_12204 128
179 3300021358 Ga0213873_10103518 Ga0213873_101035182 128
180 3300021361 Ga0213872_10053411 Ga0213872_100534114 128
181 3300021377 Ga0213874_10080218 Ga0213874_100802183 128
182 3300021384 Ga0213876_10003484 Ga0213876_100034848 128
183 3300021388 Ga0213875_10004846 Ga0213875_100048464 128
184 3300021441 Ga0213871_10028827 Ga0213871_100288271 128
185 3300025291 Ga0209675_1054392 Ga0209675_10543922 128
186 3300025295 Ga0209564_1056496 Ga0209564_10564961 128
187 3300025299 Ga0209256_1000286 Ga0209256_100028675 128
188 3300027111 Ga0209281_1001059 Ga0209281_100105912 128
189 3300028794 Ga0307515_10013157 Ga0307515_100131573 128
190 3300028794 Ga0307515_10180164 Ga0307515_101801643 128
191 3300031456 Ga0307513_10222703 Ga0307513_102227032 128
192 3300031824 Ga0307413_11183818 Ga0307413_111838181 128
193 3300031901 Ga0307406_10630505 Ga0307406_106305052 128
194 3300032002 Ga0307416_100622342 Ga0307416_1006223422 128
195 3300032002 Ga0307416_102230060 Ga0307416_1022300601 128
196 3300037471 Ga0395905_0981100 Ga0395905_0981100_306_692 128
197 3300037853 Ga0436364_0798105 Ga0436364_0798105_792_1178 128
198 3300037853 Ga0436364_1125759 Ga0436364_1125759_638_1024 128
199 3300039437 Ga0436365_0518832 Ga0436365_0518832_686_1072 128
200 3300039438 Ga0436360_0197657 Ga0436360_0197657_152_538 128
201 3300039438 Ga0436360_0292716 Ga0436360_0292716_976_1362 128
202 3300039438 Ga0436360_0382486 Ga0436360_0382486_188_574 128
203 3300039447 Ga0436361_0616956 Ga0436361_0616956_1469_1855 128
204 3300039450 Ga0436363_0206766 Ga0436363_0206766_27_413 128
205 3300039450 Ga0436363_0959216 Ga0436363_0959216_236_622 128
206 3300039453 Ga0436362_0280117 Ga0436362_0280117_262_648 128
207 3300039453 Ga0436362_0639017 Ga0436362_0639017_1120_1506 128
208 3300039453 Ga0436362_1016148 Ga0436362_1016148_195_581 128
209 3300044693 Ga0466961_0989295 Ga0466961_0989295_104_490 128
210 3300046522 Ga0495643_0109491 Ga0495643_0109491_425_811 128
211 3300046522 Ga0495643_0114460 Ga0495643_0114460_566_952 128
212 3300046691 Ga0495670_0154269 Ga0495670_0154269_95_481 128
213 3300046810 Ga0495660_0419638 Ga0495660_0419638_147_533 128
214 3300048920 Ga0496117_0152643 Ga0496117_0152643_855_1241 128
215 3300048925 Ga0496122_0238371 Ga0496122_0238371_171_557 128
216 3300049571 Ga0501034_0030728 Ga0501034_0030728_1097_1483 128
217 3300049742 Ga0501080_0477056 Ga0501080_0477056_688_1074 128
218 3300049822 Ga0501035_0280061 Ga0501035_0280061_467_853 128
219 3300053109 Ga0500569_111203 Ga0500569_111203_252_638 128
220 3300053153 Ga0500616_0000108 Ga0500616_0000108_138841_139227 128
221 3300053153 Ga0500616_0170134 Ga0500616_0170134_363_749 128
222 3300053156 Ga0500622_0037698 Ga0500622_0037698_908_1294 128
223 3300053158 Ga0500627_0168304 Ga0500627_0168304_129_515 128
224 3300053177 Ga0500636_0003031 Ga0500636_0003031_5566_5952 128
225 3300003322 rootL2_10185589 rootL2_101855894 129
226 3300005329 Ga0070683_101651056 Ga0070683_1016510561 129
227 3300005330 Ga0070690_100467673 Ga0070690_1004676732 129
228 3300005355 Ga0070671_101569323 Ga0070671_1015693231 129
229 3300005367 Ga0070667_100850337 Ga0070667_1008503372 129
230 3300005614 Ga0068856_100499156 Ga0068856_1004991563 129
231 3300009094 Ga0111539_10456723 Ga0111539_104567233 129
232 3300010375 Ga0105239_10966425 Ga0105239_109664253 129
233 3300014326 Ga0157380_10096152 Ga0157380_100961525 129
234 3300014326 Ga0157380_10135760 Ga0157380_101357603 129
235 3300014326 Ga0157380_10814522 Ga0157380_108145223 129
236 3300021388 Ga0213875_10012530 Ga0213875_100125302 129
237 3300025273 Ga0209673_1046366 Ga0209673_10463662 129
238 3300025299 Ga0209256_1030586 Ga0209256_10305863 129
239 3300025912 Ga0207707_10844931 Ga0207707_108449312 129
240 3300025926 Ga0207659_11612911 Ga0207659_116129111 129
241 3300032126 Ga0307415_101876918 Ga0307415_1018769181 129
242 3300037853 Ga0436364_0537342 Ga0436364_0537342_21041_21430 129
243 3300039438 Ga0436360_0483369 Ga0436360_0483369_261_650 129
244 3300039438 Ga0436360_0550444 Ga0436360_0550444_100_489 129
245 3300039447 Ga0436361_0466547 Ga0436361_0466547_1074_1463 129
246 3300042003 Ga0439443_096428 Ga0439443_096428_136_525 129
247 3300042147 Ga0450910_093643 Ga0450910_093643_81_470 129
248 3300048919 Ga0496116_0477758 Ga0496116_0477758_104_493 129
249 3300048924 Ga0496121_0049066 Ga0496121_0049066_3142_3531 129
250 3300048927 Ga0496124_0391766 Ga0496124_0391766_472_861 129
251 3300048929 Ga0496126_0027117 Ga0496126_0027117_3315_3704 129
252 3300049568 Ga0501031_0368160 Ga0501031_0368160_423_812 129
253 3300049569 Ga0501032_0048669 Ga0501032_0048669_1674_2063 129
254 3300049571 Ga0501034_0168737 Ga0501034_0168737_1100_1489 129
255 3300049572 Ga0501036_0089299 Ga0501036_0089299_1856_2245 129
256 3300049572 Ga0501036_0362505 Ga0501036_0362505_772_1161 129
257 3300049573 Ga0501037_0040177 Ga0501037_0040177_205_594 129
258 3300049574 Ga0501038_0040846 Ga0501038_0040846_2020_2409 129
259 3300049575 Ga0501039_0128080 Ga0501039_0128080_1364_1753 129
260 3300049576 Ga0501040_0167358 Ga0501040_0167358_213_602 129
261 3300049578 Ga0501042_0066695 Ga0501042_0066695_1417_1806 129
262 3300049580 Ga0501046_0571533 Ga0501046_0571533_199_588 129
263 3300049581 Ga0501047_0027146 Ga0501047_0027146_2655_3044 129
264 3300049582 Ga0501048_0478468 Ga0501048_0478468_137_526 129
265 3300049582 Ga0501048_0638566 Ga0501048_0638566_332_721 129
266 3300049584 Ga0501068_0158071 Ga0501068_0158071_647_1036 129
267 3300049589 Ga0501073_0067846 Ga0501073_0067846_338_727 129
268 3300049589 Ga0501073_0098642 Ga0501073_0098642_841_1230 129
269 3300049742 Ga0501080_0259497 Ga0501080_0259497_186_575 129
270 3300049742 Ga0501080_0356333 Ga0501080_0356333_820_1209 129
271 3300049744 Ga0501083_0016522 Ga0501083_0016522_1155_1544 129
272 3300049822 Ga0501035_0069393 Ga0501035_0069393_2694_3083 129
273 3300049823 Ga0501044_0345575 Ga0501044_0345575_312_701 129
274 iso_pu_bacteria 2582581315 2585325127 129
275 iso_pu_bacteria 2775507266 2778177853 129
276 iso_pu_bacteria 2824671348 2824676578 129
277 iso_pu_bacteria 2824687955 2824693240 129
278 iso_pu_bacteria 2838122688 2838124693 129
279 iso_pu_bacteria 2841949485 2841952171 129
280 iso_pu_bacteria 2841966195 2841970442 129
281 iso_pu_bacteria 2841983080 2841984971 129
282 iso_pu_bacteria 2842482326 2842487378 129
283 3300048924 Ga0496121_0332827 Ga0496121_0332827_283_675 130
284 3300049571 Ga0501034_0818806 Ga0501034_0818806_327_719 130
285 3300053104 Ga0500556_0237274 Ga0500556_0237274_292_684 130
286 3300002773 JGI25152J39213_1001578 JGI25152J39213_10015782 132
287 3300003187 JGI25151J46595_10020104 JGI25151J46595_100201042 132
288 3300003215 JGI25153J46596_10086985 JGI25153J46596_100869851 132
289 3300025258 Ga0209129_1000082 Ga0209129_100008296 132
290 3300025294 Ga0209025_1000172 Ga0209025_1000172155 132
291 3300025295 Ga0209564_1067313 Ga0209564_10673131 132
292 3300025297 Ga0209758_1032553 Ga0209758_10325533 132
293 3300025299 Ga0209256_1051400 Ga0209256_10514003 132
294 3300025303 Ga0209051_1022794 Ga0209051_10227944 132
295 3300028794 Ga0307515_10023501 Ga0307515_100235014 132
296 3300002737 JGI25162J39368_1000661 JGI25162J39368_100066112 133
297 3300003214 JGI25165J46597_1000604 JGI25165J46597_10006045 133
298 3300005331 Ga0070670_100392433 Ga0070670_1003924332 133
299 3300005334 Ga0068869_100949337 Ga0068869_1009493371 133
300 3300005347 Ga0070668_100055025 Ga0070668_1000550252 133
301 3300005441 Ga0070700_101318835 Ga0070700_1013188351 133
302 3300005445 Ga0070708_100860906 Ga0070708_1008609062 133
303 3300005459 Ga0068867_100714975 Ga0068867_1007149752 133
304 3300005471 Ga0070698_100489040 Ga0070698_1004890401 133
305 3300005471 Ga0070698_100966909 Ga0070698_1009669091 133
306 3300005539 Ga0068853_101406095 Ga0068853_1014060952 133
307 3300005548 Ga0070665_100080970 Ga0070665_1000809703 133
308 3300005577 Ga0068857_100654304 Ga0068857_1006543042 133
309 3300006058 Ga0075432_10125338 Ga0075432_101253382 133
310 3300006195 Ga0075366_10348791 Ga0075366_103487911 133
311 3300006844 Ga0075428_100144394 Ga0075428_1001443944 133
312 3300009094 Ga0111539_10108245 Ga0111539_101082453 133
313 3300009553 Ga0105249_10724301 Ga0105249_107243013 133
314 3300010375 Ga0105239_10361323 Ga0105239_103613233 133
315 3300025233 Ga0209437_100330 Ga0209437_10033035 133
316 3300025261 Ga0209233_1000304 Ga0209233_100030435 133
317 3300025922 Ga0207646_10021942 Ga0207646_100219428 133
318 3300025923 Ga0207681_10671305 Ga0207681_106713053 133
319 3300025961 Ga0207712_11289250 Ga0207712_112892501 133
320 3300025972 Ga0207668_10386591 Ga0207668_103865912 133
321 3300025986 Ga0207658_10060937 Ga0207658_100609371 133
322 3300026089 Ga0207648_10333159 Ga0207648_103331592 133
323 3300026118 Ga0207675_100333895 Ga0207675_1003338953 133
324 3300027907 Ga0207428_10049542 Ga0207428_100495422 133
325 3300028379 Ga0268266_10792697 Ga0268266_107926972 133
326 3300028381 Ga0268264_10434759 Ga0268264_104347592 133
327 3300031507 Ga0307509_10477829 Ga0307509_104778292 133
328 3300037418 Ga0395900_0541164 Ga0395900_0541164_301_705 133
329 3300037471 Ga0395905_0005673 Ga0395905_0005673_5566_5970 133
330 3300037471 Ga0395905_0111855 Ga0395905_0111855_293_697 133
331 3300038443 Ga0395901_0706599 Ga0395901_0706599_423_827 133
332 3300039453 Ga0436362_1277148 Ga0436362_1277148_906_1310 133
333 3300042157 Ga0439458_0130609 Ga0439458_0130609_139_540 133
334 3300044901 Ga0466960_0026067 Ga0466960_0026067_1267_1671 133
335 3300046507 Ga0495606_0151829 Ga0495606_0151829_763_1167 133
336 3300046516 Ga0495628_0317495 Ga0495628_0317495_261_668 133
337 3300049591 Ga0501075_1054462 Ga0501075_1054462_12_416 133
338 3300049743 Ga0501081_1497063 Ga0501081_1497063_73_477 133
339 3300050493 nmdc:mga0k408_348036_c1 nmdc:mga0k408_348036_c1_388_789 133
340 3300050496 nmdc:mga07m45_210059_c1 nmdc:mga07m45_210059_c1_656_1057 133
341 3300050508 nmdc:mga09592_318488_c1 nmdc:mga09592_318488_c1_351_755 133
342 3300050511 nmdc:mga08y16_527802_c1 nmdc:mga08y16_527802_c1_230_634 133
343 3300053094 Ga0500566_0180514 Ga0500566_0180514_209_613 133
344 3300053095 Ga0500640_099450 Ga0500640_099450_26_430 133
345 3300053111 Ga0500572_017777 Ga0500572_017777_945_1349 133
346 3300053121 Ga0500607_010830 Ga0500607_010830_3573_3977 133
347 3300053123 Ga0500614_029772 Ga0500614_029772_346_750 133
348 3300053136 Ga0500559_0050886 Ga0500559_0050886_949_1353 133
349 3300053138 Ga0500564_040364 Ga0500564_040364_903_1307 133
350 3300053148 Ga0500590_024679 Ga0500590_024679_1997_2401 133
351 3300053154 Ga0500619_070418 Ga0500619_070418_604_1008 133
352 3300053155 Ga0500620_001402 Ga0500620_001402_3925_4329 133
353 3300053157 Ga0500624_032167 Ga0500624_032167_222_626 133
354 3300053162 Ga0500638_093907 Ga0500638_093907_763_1167 133
355 3300053177 Ga0500636_0003245 Ga0500636_0003245_4522_4926 133
356 3300053723 Ga0500567_201756 Ga0500567_201756_207_611 133
357 3300053737 Ga0500601_016097 Ga0500601_016097_370_774 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

1

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.9597 1 129
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.9549 1 129
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.9309 1 129
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.927 1 129
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.8184 2 124
ID Description Score Start End Superfamily
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9707 1 129 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9689 1 129 3.40.50.1010
af_P9WF65_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9677 1 126 3.40.50.1010
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9562 1 129 3.40.50.1010
4xgrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9562 3 129 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7S8IKM2-F1-model_v4 PIN domain-containing protein 0.9953 59 128
AF-A0A5Q4GDA8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9939 1 128 GO:0000287
GO:0004540
GO:0090729
AF-A0A1H8YBG7-F1-model_v4 Ribonuclease VapC 0.9891 67 128
AF-A0A655J013-F1-model_v4 Toxin (EC 3.1.-.-) 0.9889 72 127 GO:0004518
AF-F9UDV2-F1-model_v4 PilT protein domain-containing protein 0.9882 67 130

Feature Viewer

pLDDT pTM Quality
93.71 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map