F420583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 356 | 217 | 712 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0107379|Ga0466963_0107379_389_1165 |
| Length | 258 |
| Sequence | MSGTISSPRYRHRSVRAYRVLIPHGTGSAAGHRLEAQVRVLLADDERLLADTVADGLRKLAMAVDVCYDGEAAIERLSVNRYDVAVLDRDMPGRSGDDVCRWLVNSDLGTRILVLTAAAGIRDRVEGLGLGADDYLTKPFAFAELVARIQALSRRPNAAHAPVLDHGGVVLDVPRHRAFRDGLLLDLTPKEFAVLSVLMHSAGRIVTAEQLLEQAWDEHADPFTNAVRVAVMTLRKKLGDPPIVHTVPRVGYRFGDPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 122 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 145 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 146 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 147 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 183 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 188 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 190 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 191 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 192 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 193 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 194 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 195 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 196 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 197 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 198 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 199 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 200 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 201 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 202 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 203 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 204 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 205 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 206 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 207 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 208 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 209 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 210 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 211 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 212 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 213 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 214 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 215 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 216 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 217 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.85 |
| Metatranscriptomes | 0 |
| Isolates | 8.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.12 |
| Nodule | 1.69 |
| Rhizoplane | 5.62 |
| Rhizosphere | 79.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0107379 | 3300044694 | Bacteria | 1914 |
| 2 | JGI25406J46586_10001598 | 3300003203 | Bacteria | 10690 |
| 3 | Ga0070683_100052280 | 3300005329 | Bacteria | 3784 |
| 4 | Ga0070690_100491228 | 3300005330 | Bacteria | 917 |
| 5 | Ga0070680_100307654 | 3300005336 | Bacteria | 1344 |
| 6 | Ga0070660_100444988 | 3300005339 | Bacteria | 1074 |
| 7 | Ga0070660_100777354 | 3300005339 | Bacteria | 805 |
| 8 | Ga0070689_100131436 | 3300005340 | Bacteria | 2008 |
| 9 | Ga0070691_10076102 | 3300005341 | Bacteria | 1636 |
| 10 | Ga0070668_100000321 | 3300005347 | Bacteria | 31632 |
| 11 | Ga0070668_100013455 | 3300005347 | Bacteria | 6108 |
| 12 | Ga0070668_100022502 | 3300005347 | Bacteria | 4765 |
| 13 | Ga0070669_100027643 | 3300005353 | Bacteria | 4083 |
| 14 | Ga0070671_100483842 | 3300005355 | Bacteria | 1064 |
| 15 | Ga0070673_100194727 | 3300005364 | Bacteria | 1743 |
| 16 | Ga0070688_100158901 | 3300005365 | Bacteria | 1552 |
| 17 | Ga0070659_100059399 | 3300005366 | Bacteria | 3019 |
| 18 | Ga0070714_100049917 | 3300005435 | Bacteria | 3562 |
| 19 | Ga0070714_100146787 | 3300005435 | Bacteria | 2123 |
| 20 | Ga0070714_100479663 | 3300005435 | Bacteria | 1184 |
| 21 | Ga0070713_100009384 | 3300005436 | Bacteria | 7000 |
| 22 | Ga0070701_10011216 | 3300005438 | Bacteria | 3997 |
| 23 | Ga0070711_100076663 | 3300005439 | Bacteria | 2371 |
| 24 | Ga0070663_100003749 | 3300005455 | Bacteria | 8819 |
| 25 | Ga0070663_100097991 | 3300005455 | Bacteria | 2183 |
| 26 | Ga0068867_100756942 | 3300005459 | Bacteria | 862 |
| 27 | Ga0070698_100601238 | 3300005471 | Bacteria | 1040 |
| 28 | Ga0070699_100495175 | 3300005518 | Bacteria | 1110 |
| 29 | Ga0070679_100235679 | 3300005530 | Bacteria | 1789 |
| 30 | Ga0070679_100514473 | 3300005530 | Bacteria | 1141 |
| 31 | Ga0070684_100062024 | 3300005535 | Bacteria | 3274 |
| 32 | Ga0070684_100101763 | 3300005535 | Bacteria | 2567 |
| 33 | Ga0070684_100852625 | 3300005535 | Bacteria | 853 |
| 34 | Ga0070686_100136645 | 3300005544 | Bacteria | 1702 |
| 35 | Ga0070686_100156539 | 3300005544 | Bacteria | 1601 |
| 36 | Ga0070695_100320791 | 3300005545 | Bacteria | 1151 |
| 37 | Ga0070665_100282710 | 3300005548 | Bacteria | 1661 |
| 38 | Ga0070665_100398060 | 3300005548 | Bacteria | 1385 |
| 39 | Ga0070665_100487977 | 3300005548 | Bacteria | 1243 |
| 40 | Ga0068855_100057748 | 3300005563 | Bacteria | 4548 |
| 41 | Ga0068855_100161730 | 3300005563 | Bacteria | 2540 |
| 42 | Ga0068855_100291207 | 3300005563 | Bacteria | 1810 |
| 43 | Ga0068855_101025303 | 3300005563 | Bacteria | 866 |
| 44 | Ga0070664_100479776 | 3300005564 | Bacteria | 1144 |
| 45 | Ga0070664_100586113 | 3300005564 | Bacteria | 1033 |
| 46 | Ga0068854_100158586 | 3300005578 | Bacteria | 1750 |
| 47 | Ga0068856_100000987 | 3300005614 | Bacteria | 30377 |
| 48 | Ga0068856_100026315 | 3300005614 | Bacteria | 5674 |
| 49 | Ga0068856_100093756 | 3300005614 | Bacteria | 2988 |
| 50 | Ga0068856_100267106 | 3300005614 | Bacteria | 1727 |
| 51 | Ga0068852_100052473 | 3300005616 | Bacteria | 3504 |
| 52 | Ga0068859_100069702 | 3300005617 | Bacteria | 3551 |
| 53 | Ga0068864_100283722 | 3300005618 | Bacteria | 1546 |
| 54 | Ga0068861_100241617 | 3300005719 | Bacteria | 1536 |
| 55 | Ga0068870_10027795 | 3300005840 | Bacteria | 2833 |
| 56 | Ga0068863_100579067 | 3300005841 | Bacteria | 1110 |
| 57 | Ga0068863_100797743 | 3300005841 | Bacteria | 942 |
| 58 | Ga0068858_100609418 | 3300005842 | Bacteria | 1059 |
| 59 | Ga0068860_100121187 | 3300005843 | Bacteria | 2504 |
| 60 | Ga0068862_100181168 | 3300005844 | Bacteria | 1891 |
| 61 | Ga0081455_10000414 | 3300005937 | Bacteria | 56192 |
| 62 | Ga0081455_10044259 | 3300005937 | Bacteria | 3886 |
| 63 | Ga0081540_1011335 | 3300005983 | Bacteria | 5964 |
| 64 | Ga0081540_1080243 | 3300005983 | Bacteria | 1472 |
| 65 | Ga0081539_10000027 | 3300005985 | Bacteria | 328691 |
| 66 | Ga0075365_10059309 | 3300006038 | Bacteria | 2550 |
| 67 | Ga0070712_100538645 | 3300006175 | Bacteria | 983 |
| 68 | Ga0068871_100428279 | 3300006358 | Bacteria | 1183 |
| 69 | Ga0075430_100001076 | 3300006846 | Bacteria | 21644 |
| 70 | Ga0075433_10222871 | 3300006852 | Bacteria | 1675 |
| 71 | Ga0075429_100338400 | 3300006880 | Bacteria | 1317 |
| 72 | Ga0097620_100069705 | 3300006931 | Bacteria | 3551 |
| 73 | Ga0105251_10113621 | 3300009011 | Bacteria | 1232 |
| 74 | Ga0105244_10139496 | 3300009036 | Bacteria | 1167 |
| 75 | Ga0105240_10153696 | 3300009093 | Bacteria | 2739 |
| 76 | Ga0105240_10472616 | 3300009093 | Bacteria | 1399 |
| 77 | Ga0111539_10260553 | 3300009094 | Bacteria | 2018 |
| 78 | Ga0105245_10028236 | 3300009098 | Bacteria | 4947 |
| 79 | Ga0105245_10047977 | 3300009098 | Bacteria | 3819 |
| 80 | Ga0105247_10003925 | 3300009101 | Bacteria | 9586 |
| 81 | Ga0105247_10098603 | 3300009101 | Bacteria | 1865 |
| 82 | Ga0114129_10179963 | 3300009147 | Bacteria | 2878 |
| 83 | Ga0105243_10072694 | 3300009148 | Bacteria | 2784 |
| 84 | Ga0105243_10098256 | 3300009148 | Bacteria | 2425 |
| 85 | Ga0105241_10249592 | 3300009174 | Bacteria | 1504 |
| 86 | Ga0105242_10112603 | 3300009176 | Bacteria | 2322 |
| 87 | Ga0105242_11047897 | 3300009176 | Bacteria | 826 |
| 88 | Ga0105248_10141428 | 3300009177 | Bacteria | 2715 |
| 89 | Ga0105237_10073908 | 3300009545 | Bacteria | 3400 |
| 90 | Ga0105237_10325777 | 3300009545 | Bacteria | 1540 |
| 91 | Ga0105237_10383291 | 3300009545 | Bacteria | 1411 |
| 92 | Ga0105237_10460081 | 3300009545 | Bacteria | 1278 |
| 93 | Ga0105238_10169712 | 3300009551 | Bacteria | 2158 |
| 94 | Ga0105238_10421787 | 3300009551 | Bacteria | 1329 |
| 95 | Ga0105238_10425998 | 3300009551 | Bacteria | 1322 |
| 96 | Ga0105238_10427782 | 3300009551 | Bacteria | 1319 |
| 97 | Ga0105249_10103702 | 3300009553 | Bacteria | 2679 |
| 98 | Ga0105239_10441022 | 3300010375 | Bacteria | 1476 |
| 99 | Ga0105246_10354240 | 3300011119 | Bacteria | 1204 |
| 100 | Ga0157369_10166139 | 3300013105 | Bacteria | 2327 |
| 101 | Ga0157369_10286909 | 3300013105 | Bacteria | 1714 |
| 102 | Ga0157378_10163843 | 3300013297 | Bacteria | 2081 |
| 103 | Ga0157378_10643129 | 3300013297 | Bacteria | 1075 |
| 104 | Ga0157372_10525817 | 3300013307 | Bacteria | 1379 |
| 105 | Ga0157375_10129199 | 3300013308 | Bacteria | 2645 |
| 106 | Ga0163163_10171576 | 3300014325 | Bacteria | 2216 |
| 107 | Ga0157380_10108686 | 3300014326 | Bacteria | 2325 |
| 108 | Ga0157379_10306755 | 3300014968 | Bacteria | 1447 |
| 109 | Ga0213876_10015494 | 3300021384 | Bacteria | 4034 |
| 110 | Ga0213876_10103862 | 3300021384 | Bacteria | 1507 |
| 111 | Ga0213875_10183355 | 3300021388 | Bacteria | 983 |
| 112 | Ga0207692_10036263 | 3300025898 | Bacteria | 2403 |
| 113 | Ga0207710_10058070 | 3300025900 | Bacteria | 1749 |
| 114 | Ga0207688_10195514 | 3300025901 | Bacteria | 1211 |
| 115 | Ga0207647_10112540 | 3300025904 | Bacteria | 1609 |
| 116 | Ga0207699_10024020 | 3300025906 | Bacteria | 3327 |
| 117 | Ga0207643_10030819 | 3300025908 | Bacteria | 2988 |
| 118 | Ga0207705_10042130 | 3300025909 | Bacteria | 3277 |
| 119 | Ga0207705_10228582 | 3300025909 | Bacteria | 1414 |
| 120 | Ga0207654_10028224 | 3300025911 | Bacteria | 3058 |
| 121 | Ga0207654_10080982 | 3300025911 | Bacteria | 1954 |
| 122 | Ga0207695_10151281 | 3300025913 | Bacteria | 2260 |
| 123 | Ga0207671_10584447 | 3300025914 | Bacteria | 890 |
| 124 | Ga0207671_10726266 | 3300025914 | Bacteria | 789 |
| 125 | Ga0207663_10037431 | 3300025916 | Bacteria | 2925 |
| 126 | Ga0207657_10052802 | 3300025919 | Bacteria | 3526 |
| 127 | Ga0207657_10091306 | 3300025919 | Bacteria | 2540 |
| 128 | Ga0207649_10128360 | 3300025920 | Bacteria | 1719 |
| 129 | Ga0207652_10926140 | 3300025921 | Bacteria | 769 |
| 130 | Ga0207681_10050740 | 3300025923 | Bacteria | 2808 |
| 131 | Ga0207687_10004015 | 3300025927 | Bacteria | 9859 |
| 132 | Ga0207687_10249763 | 3300025927 | Bacteria | 1410 |
| 133 | Ga0207700_10117047 | 3300025928 | Bacteria | 2154 |
| 134 | Ga0207664_10030361 | 3300025929 | Bacteria | 4127 |
| 135 | Ga0207664_10109137 | 3300025929 | Bacteria | 2299 |
| 136 | Ga0207644_10117729 | 3300025931 | Bacteria | 2018 |
| 137 | Ga0207690_10060715 | 3300025932 | Bacteria | 2568 |
| 138 | Ga0207709_10066204 | 3300025935 | Bacteria | 2275 |
| 139 | Ga0207670_10034291 | 3300025936 | Bacteria | 3279 |
| 140 | Ga0207711_10332374 | 3300025941 | Bacteria | 1405 |
| 141 | Ga0207689_10148055 | 3300025942 | Bacteria | 1935 |
| 142 | Ga0207661_10441866 | 3300025944 | Bacteria | 1184 |
| 143 | Ga0207667_10034309 | 3300025949 | Bacteria | 5450 |
| 144 | Ga0207667_10389867 | 3300025949 | Bacteria | 1419 |
| 145 | Ga0207667_10489233 | 3300025949 | Bacteria | 1248 |
| 146 | Ga0207651_10063733 | 3300025960 | Bacteria | 2576 |
| 147 | Ga0207712_10063856 | 3300025961 | Bacteria | 2623 |
| 148 | Ga0207668_10005210 | 3300025972 | Bacteria | 7650 |
| 149 | Ga0207668_10010596 | 3300025972 | Bacteria | 5576 |
| 150 | Ga0207668_10057173 | 3300025972 | Bacteria | 2720 |
| 151 | Ga0207640_10104918 | 3300025981 | Bacteria | 1990 |
| 152 | Ga0207658_10366822 | 3300025986 | Bacteria | 1258 |
| 153 | Ga0207703_10021844 | 3300026035 | Bacteria | 5010 |
| 154 | Ga0207639_10302475 | 3300026041 | Bacteria | 1414 |
| 155 | Ga0207678_10000161 | 3300026067 | Bacteria | 55954 |
| 156 | Ga0207678_10017451 | 3300026067 | Bacteria | 6305 |
| 157 | Ga0207708_10066973 | 3300026075 | Bacteria | 2746 |
| 158 | Ga0207702_10028138 | 3300026078 | Bacteria | 4670 |
| 159 | Ga0207702_10071681 | 3300026078 | Bacteria | 2984 |
| 160 | Ga0207648_10440034 | 3300026089 | Bacteria | 1186 |
| 161 | Ga0207676_10311957 | 3300026095 | Bacteria | 1440 |
| 162 | Ga0207674_10112574 | 3300026116 | Bacteria | 2695 |
| 163 | Ga0207675_100153601 | 3300026118 | Bacteria | 2192 |
| 164 | Ga0207675_100302225 | 3300026118 | Bacteria | 1559 |
| 165 | Ga0207675_101172384 | 3300026118 | Bacteria | 788 |
| 166 | Ga0207698_10005347 | 3300026142 | Bacteria | 7918 |
| 167 | Ga0268266_10242647 | 3300028379 | Bacteria | 1664 |
| 168 | Ga0268264_10008227 | 3300028381 | Bacteria | 8660 |
| 169 | Ga0265319_1057508 | 3300028563 | Bacteria | 1268 |
| 170 | Ga0307515_10019231 | 3300028794 | Bacteria | 12310 |
| 171 | Ga0307511_10155654 | 3300030521 | Bacteria | 1298 |
| 172 | Ga0307512_10149138 | 3300030522 | Bacteria | 1405 |
| 173 | Ga0307513_10047278 | 3300031456 | Bacteria | 4682 |
| 174 | Ga0307509_10080527 | 3300031507 | Bacteria | 3368 |
| 175 | Ga0307508_10293201 | 3300031616 | Bacteria | 1220 |
| 176 | Ga0265314_10018522 | 3300031711 | Bacteria | 5426 |
| 177 | Ga0307405_10022308 | 3300031731 | Bacteria | 3577 |
| 178 | Ga0307413_10274415 | 3300031824 | Bacteria | 1264 |
| 179 | Ga0307413_10491703 | 3300031824 | Bacteria | 983 |
| 180 | Ga0307409_100026587 | 3300031995 | Bacteria | 4084 |
| 181 | Ga0307409_100130898 | 3300031995 | Bacteria | 2144 |
| 182 | Ga0307409_100150728 | 3300031995 | Bacteria | 2018 |
| 183 | Ga0307411_10612430 | 3300032005 | Bacteria | 938 |
| 184 | Ga0307411_10910709 | 3300032005 | Bacteria | 782 |
| 185 | Ga0307415_100238893 | 3300032126 | Bacteria | 1468 |
| 186 | Ga0307507_10001354 | 3300033179 | Bacteria | 54837 |
| 187 | Ga0307507_10015314 | 3300033179 | Bacteria | 9033 |
| 188 | Ga0307507_10074841 | 3300033179 | Bacteria | 3034 |
| 189 | Ga0307507_10221942 | 3300033179 | Bacteria | 1269 |
| 190 | Ga0307510_10058253 | 3300033180 | Bacteria | 4002 |
| 191 | Ga0373951_0000006 | 3300035091 | Bacteria | 85240 |
| 192 | Ga0373953_0187968 | 3300035117 | Bacteria | 892 |
| 193 | Ga0373942_0052216 | 3300035207 | Bacteria | 1149 |
| 194 | Ga0373925_0824476 | 3300037068 | Bacteria | 765 |
| 195 | Ga0395899_0014758 | 3300037312 | Bacteria | 5964 |
| 196 | Ga0395900_0016426 | 3300037418 | Bacteria | 7547 |
| 197 | Ga0395900_0228323 | 3300037418 | Bacteria | 1873 |
| 198 | Ga0395900_0444564 | 3300037418 | Bacteria | 1253 |
| 199 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 200 | Ga0395898_0485681 | 3300037466 | Bacteria | 1175 |
| 201 | Ga0436364_0112430 | 3300037853 | Bacteria | 46821 |
| 202 | Ga0395901_0041232 | 3300038443 | Bacteria | 4783 |
| 203 | Ga0395901_0242364 | 3300038443 | Bacteria | 1880 |
| 204 | Ga0436365_0131291 | 3300039437 | Bacteria | 43697 |
| 205 | Ga0436365_0457026 | 3300039437 | Bacteria | 17369 |
| 206 | Ga0436363_0970724 | 3300039450 | Bacteria | 6811 |
| 207 | Ga0436362_0341322 | 3300039453 | Bacteria | 699 |
| 208 | Ga0436362_0739364 | 3300039453 | Bacteria | 4381 |
| 209 | Ga0451853_0269984 | 3300041512 | Bacteria | 2720 |
| 210 | Ga0466972_0011180 | 3300044658 | Bacteria | 4505 |
| 211 | Ga0466972_0014646 | 3300044658 | Bacteria | 3925 |
| 212 | Ga0466972_0042225 | 3300044658 | Bacteria | 2218 |
| 213 | Ga0466972_0051397 | 3300044658 | Bacteria | 1989 |
| 214 | Ga0466965_0021399 | 3300044683 | Bacteria | 3112 |
| 215 | Ga0466965_0035705 | 3300044683 | Bacteria | 2436 |
| 216 | Ga0466965_0155829 | 3300044683 | Bacteria | 1196 |
| 217 | Ga0466966_0010983 | 3300044684 | Bacteria | 6010 |
| 218 | Ga0466966_0021689 | 3300044684 | Bacteria | 4216 |
| 219 | Ga0466966_0081198 | 3300044684 | Bacteria | 2019 |
| 220 | Ga0466961_0009374 | 3300044693 | Bacteria | 6236 |
| 221 | Ga0466961_0021063 | 3300044693 | Bacteria | 4196 |
| 222 | Ga0466961_0044755 | 3300044693 | Bacteria | 2832 |
| 223 | Ga0466961_0090385 | 3300044693 | Bacteria | 1934 |
| 224 | Ga0466961_0090749 | 3300044693 | Bacteria | 1929 |
| 225 | Ga0466961_0211841 | 3300044693 | Bacteria | 1196 |
| 226 | Ga0466961_0494286 | 3300044693 | Bacteria | 739 |
| 227 | Ga0466963_0001728 | 3300044694 | Bacteria | 11883 |
| 228 | Ga0466963_0004065 | 3300044694 | Bacteria | 8465 |
| 229 | Ga0466963_0015358 | 3300044694 | Bacteria | 4739 |
| 230 | Ga0466963_0025801 | 3300044694 | Bacteria | 3752 |
| 231 | Ga0466963_0028061 | 3300044694 | Bacteria | 3610 |
| 232 | Ga0466963_0051151 | 3300044694 | Bacteria | 2737 |
| 233 | Ga0466963_0102009 | 3300044694 | Bacteria | 1965 |
| 234 | Ga0466963_0104528 | 3300044694 | Bacteria | 1941 |
| 235 | Ga0466963_0234683 | 3300044694 | Bacteria | 1286 |
| 236 | Ga0466963_0372914 | 3300044694 | Bacteria | 1006 |
| 237 | Ga0466964_0043832 | 3300044706 | Bacteria | 1816 |
| 238 | Ga0466964_0063635 | 3300044706 | Bacteria | 1541 |
| 239 | Ga0466964_0109229 | 3300044706 | Bacteria | 1231 |
| 240 | Ga0466964_0118558 | 3300044706 | Bacteria | 1190 |
| 241 | Ga0466971_0022537 | 3300044719 | Bacteria | 2806 |
| 242 | Ga0466971_0025488 | 3300044719 | Bacteria | 2641 |
| 243 | Ga0466971_0109045 | 3300044719 | Bacteria | 1276 |
| 244 | Ga0466968_0221972 | 3300044735 | Bacteria | 890 |
| 245 | Ga0466970_0017429 | 3300044765 | Bacteria | 3711 |
| 246 | Ga0466970_0024353 | 3300044765 | Bacteria | 3164 |
| 247 | Ga0466970_0044046 | 3300044765 | Bacteria | 2376 |
| 248 | Ga0466970_0282812 | 3300044765 | Bacteria | 933 |
| 249 | Ga0466970_0303325 | 3300044765 | Bacteria | 901 |
| 250 | Ga0466970_0464877 | 3300044765 | Bacteria | 726 |
| 251 | Ga0466957_0009956 | 3300044842 | Bacteria | 5438 |
| 252 | Ga0466957_0020006 | 3300044842 | Bacteria | 3940 |
| 253 | Ga0466957_0025299 | 3300044842 | Bacteria | 3518 |
| 254 | Ga0466957_0050081 | 3300044842 | Bacteria | 2541 |
| 255 | Ga0466957_0116305 | 3300044842 | Bacteria | 1701 |
| 256 | Ga0466957_0168193 | 3300044842 | Bacteria | 1427 |
| 257 | Ga0466960_0009599 | 3300044901 | Bacteria | 3994 |
| 258 | Ga0466960_0010037 | 3300044901 | Bacteria | 3921 |
| 259 | Ga0466960_0070430 | 3300044901 | Bacteria | 1740 |
| 260 | Ga0466960_0103584 | 3300044901 | Bacteria | 1469 |
| 261 | Ga0466960_0208659 | 3300044901 | Bacteria | 1070 |
| 262 | Ga0466959_0027816 | 3300045049 | Bacteria | 4194 |
| 263 | Ga0466959_0067340 | 3300045049 | Bacteria | 2596 |
| 264 | Ga0466959_0090407 | 3300045049 | Bacteria | 2199 |
| 265 | Ga0466959_0121079 | 3300045049 | Bacteria | 1860 |
| 266 | Ga0466959_0225063 | 3300045049 | Bacteria | 1300 |
| 267 | Ga0466958_0005868 | 3300045836 | Bacteria | 6645 |
| 268 | Ga0466958_0007302 | 3300045836 | Bacteria | 6069 |
| 269 | Ga0466958_0010080 | 3300045836 | Bacteria | 5282 |
| 270 | Ga0466958_0050063 | 3300045836 | Bacteria | 2529 |
| 271 | Ga0466958_0075657 | 3300045836 | Bacteria | 2065 |
| 272 | Ga0466967_0000529 | 3300045976 | Bacteria | 18598 |
| 273 | Ga0466967_0005618 | 3300045976 | Bacteria | 8722 |
| 274 | Ga0466967_0017257 | 3300045976 | Bacteria | 5723 |
| 275 | Ga0466967_0020972 | 3300045976 | Bacteria | 5293 |
| 276 | Ga0466967_0027580 | 3300045976 | Bacteria | 4726 |
| 277 | Ga0466967_0039893 | 3300045976 | Bacteria | 4040 |
| 278 | Ga0466967_0052649 | 3300045976 | Bacteria | 3574 |
| 279 | Ga0466967_0060896 | 3300045976 | Bacteria | 3347 |
| 280 | Ga0466967_0115382 | 3300045976 | Bacteria | 2473 |
| 281 | Ga0466967_0132773 | 3300045976 | Bacteria | 2313 |
| 282 | Ga0466967_0153193 | 3300045976 | Bacteria | 2157 |
| 283 | Ga0466967_0154672 | 3300045976 | Bacteria | 2147 |
| 284 | Ga0466967_0191149 | 3300045976 | Bacteria | 1935 |
| 285 | Ga0466967_0328228 | 3300045976 | Bacteria | 1477 |
| 286 | Ga0495653_0362359 | 3300046463 | Bacteria | 930 |
| 287 | Ga0495608_0436429 | 3300046511 | Bacteria | 798 |
| 288 | Ga0495672_0167618 | 3300047320 | Bacteria | 1123 |
| 289 | Ga0496100_0116905 | 3300048903 | Bacteria | 1861 |
| 290 | Ga0496101_0426424 | 3300048904 | Bacteria | 1045 |
| 291 | Ga0496102_0434283 | 3300048905 | Bacteria | 1233 |
| 292 | Ga0496103_0066700 | 3300048906 | Bacteria | 2246 |
| 293 | Ga0496104_0194489 | 3300048907 | Bacteria | 1940 |
| 294 | Ga0496105_0120623 | 3300048908 | Bacteria | 2162 |
| 295 | Ga0496106_0033544 | 3300048909 | Bacteria | 3830 |
| 296 | Ga0496108_0084681 | 3300048911 | Bacteria | 2691 |
| 297 | Ga0496108_0793060 | 3300048911 | Bacteria | 817 |
| 298 | Ga0496109_0162650 | 3300048912 | Bacteria | 2092 |
| 299 | Ga0496109_0755882 | 3300048912 | Bacteria | 910 |
| 300 | Ga0496110_0106190 | 3300048913 | Bacteria | 2519 |
| 301 | Ga0496110_0112486 | 3300048913 | Bacteria | 2448 |
| 302 | Ga0496110_0445407 | 3300048913 | Bacteria | 1180 |
| 303 | Ga0496111_0209667 | 3300048914 | Bacteria | 1447 |
| 304 | Ga0496112_0065301 | 3300048915 | Bacteria | 3592 |
| 305 | Ga0496112_0347487 | 3300048915 | Bacteria | 1426 |
| 306 | Ga0496114_0023585 | 3300048917 | Bacteria | 5023 |
| 307 | Ga0496115_0265368 | 3300048918 | Bacteria | 1411 |
| 308 | Ga0496115_0721706 | 3300048918 | Bacteria | 782 |
| 309 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 310 | Ga0496126_0008154 | 3300048929 | Bacteria | 11339 |
| 311 | Ga0496126_0070367 | 3300048929 | Bacteria | 3117 |
| 312 | Ga0501039_0233582 | 3300049575 | Bacteria | 1446 |
| 313 | Ga0501068_0057963 | 3300049584 | Bacteria | 2349 |
| 314 | Ga0501044_0624674 | 3300049823 | Bacteria | 968 |
| 315 | nmdc:mga0yw44_146888_c1 | 3300050492 | Bacteria | 1536 |
| 316 | nmdc:mga07m45_308540_c1 | 3300050496 | Unclassified | 920 |
| 317 | nmdc:mga09592_275717_c1 | 3300050508 | Bacteria | 1459 |
| 318 | nmdc:mga0qj67_1997_c1 | 3300050509 | Bacteria | 14533 |
| 319 | nmdc:mga08y16_81651_c1 | 3300050511 | Bacteria | 3370 |
| 320 | nmdc:mga0a205_116648_c1 | 3300050515 | Bacteria | 2568 |
| 321 | Ga0500577_0035946 | 3300053142 | Bacteria | 1770 |
| 322 | Ga0501084_0143762 | 3300054114 | Bacteria | 2009 |
| 323 | Ga0466962_0000848 | 3300061719 | Bacteria | 13818 |
| 324 | Ga0466962_0005941 | 3300061719 | Bacteria | 5867 |
| 325 | Ga0466962_0008465 | 3300061719 | Bacteria | 4929 |
| 326 | Ga0466962_0009036 | 3300061719 | Bacteria | 4773 |
| 327 | Ga0466962_0034342 | 3300061719 | Bacteria | 2428 |
| 328 | 2501943253 | 2501939600 | Bacteria | 6907073 |
| 329 | 2772646194 | 2772190715 | Bacteria | 6959372 |
| 330 | 2774851735 | 2773857922 | Bacteria | 9757215 |
| 331 | 2799185903 | 2799112218 | Bacteria | 4315149 |
| 332 | 2855671465 | 2855670206 | Bacteria | 7120389 |
| 333 | 2855680633 | 2855676851 | Bacteria | 7063653 |
| 334 | 2857292161 | 2857288857 | Bacteria | 7189066 |
| 335 | 2858854556 | 2858848962 | Bacteria | 6963058 |
| 336 | 2858873860 | 2858868258 | Bacteria | 7683772 |
| 337 | 2858883682 | 2858882152 | Bacteria | 7230291 |
| 338 | 2858890477 | 2858888857 | Bacteria | 7060307 |
| 339 | 2858901107 | 2858895516 | Bacteria | 7378898 |
| 340 | 2867350801 | 2867346516 | Bacteria | 7608576 |
| 341 | 2867509593 | 2867507094 | Bacteria | 6506033 |
| 342 | 2869049136 | 2869048445 | Bacteria | 6875584 |
| 343 | 2869062595 | 2869061728 | Bacteria | 7112407 |
| 344 | 2869070397 | 2869068681 | Bacteria | 7205615 |
| 345 | 2880498845 | 2880495981 | Bacteria | 7340502 |
| 346 | 2915768818 | 2915768154 | Bacteria | 8424322 |
| 347 | 2929220849 | 2929219909 | Bacteria | 6984360 |
| 348 | 2929227435 | 2929226422 | Bacteria | 7248583 |
| 349 | 649811386 | 649633069 | Bacteria | 6962533 |
| 350 | 8003318550 | 8003314358 | Bacteria | 10575343 |
| 351 | 8003319625 | 8003314358 | Bacteria | 10575343 |
| 352 | 8003833879 | 8003830390 | Bacteria | 6541657 |
| 353 | 8003877675 | 8003870546 | Bacteria | 7396674 |
| 354 | 8054710919 | 8054704163 | Bacteria | 7247792 |
| 355 | 8054727569 | 8054727385 | Bacteria | 7558670 |
| 356 | 8054735017 | 8054734606 | Bacteria | 6947278 |
| 357 | Ga0466963_0107379 | |||
| 358 | JGI25406J46586_10001598 | |||
| 359 | Ga0070683_100052280 | |||
| 360 | Ga0070690_100491228 | |||
| 361 | Ga0070680_100307654 | |||
| 362 | Ga0070660_100444988 | |||
| 363 | Ga0070660_100777354 | |||
| 364 | Ga0070689_100131436 | |||
| 365 | Ga0070691_10076102 | |||
| 366 | Ga0070668_100000321 | |||
| 367 | Ga0070668_100013455 | |||
| 368 | Ga0070668_100022502 | |||
| 369 | Ga0070669_100027643 | |||
| 370 | Ga0070671_100483842 | |||
| 371 | Ga0070673_100194727 | |||
| 372 | Ga0070688_100158901 | |||
| 373 | Ga0070659_100059399 | |||
| 374 | Ga0070714_100049917 | |||
| 375 | Ga0070714_100146787 | |||
| 376 | Ga0070714_100479663 | |||
| 377 | Ga0070713_100009384 | |||
| 378 | Ga0070701_10011216 | |||
| 379 | Ga0070711_100076663 | |||
| 380 | Ga0070663_100003749 | |||
| 381 | Ga0070663_100097991 | |||
| 382 | Ga0068867_100756942 | |||
| 383 | Ga0070698_100601238 | |||
| 384 | Ga0070699_100495175 | |||
| 385 | Ga0070679_100235679 | |||
| 386 | Ga0070679_100514473 | |||
| 387 | Ga0070684_100062024 | |||
| 388 | Ga0070684_100101763 | |||
| 389 | Ga0070684_100852625 | |||
| 390 | Ga0070686_100136645 | |||
| 391 | Ga0070686_100156539 | |||
| 392 | Ga0070695_100320791 | |||
| 393 | Ga0070665_100282710 | |||
| 394 | Ga0070665_100398060 | |||
| 395 | Ga0070665_100487977 | |||
| 396 | Ga0068855_100057748 | |||
| 397 | Ga0068855_100161730 | |||
| 398 | Ga0068855_100291207 | |||
| 399 | Ga0068855_101025303 | |||
| 400 | Ga0070664_100479776 | |||
| 401 | Ga0070664_100586113 | |||
| 402 | Ga0068854_100158586 | |||
| 403 | Ga0068856_100000987 | |||
| 404 | Ga0068856_100026315 | |||
| 405 | Ga0068856_100093756 | |||
| 406 | Ga0068856_100267106 | |||
| 407 | Ga0068852_100052473 | |||
| 408 | Ga0068859_100069702 | |||
| 409 | Ga0068864_100283722 | |||
| 410 | Ga0068861_100241617 | |||
| 411 | Ga0068870_10027795 | |||
| 412 | Ga0068863_100579067 | |||
| 413 | Ga0068863_100797743 | |||
| 414 | Ga0068858_100609418 | |||
| 415 | Ga0068860_100121187 | |||
| 416 | Ga0068862_100181168 | |||
| 417 | Ga0081455_10000414 | |||
| 418 | Ga0081455_10044259 | |||
| 419 | Ga0081540_1011335 | |||
| 420 | Ga0081540_1080243 | |||
| 421 | Ga0081539_10000027 | |||
| 422 | Ga0075365_10059309 | |||
| 423 | Ga0070712_100538645 | |||
| 424 | Ga0068871_100428279 | |||
| 425 | Ga0075430_100001076 | |||
| 426 | Ga0075433_10222871 | |||
| 427 | Ga0075429_100338400 | |||
| 428 | Ga0097620_100069705 | |||
| 429 | Ga0105251_10113621 | |||
| 430 | Ga0105244_10139496 | |||
| 431 | Ga0105240_10153696 | |||
| 432 | Ga0105240_10472616 | |||
| 433 | Ga0111539_10260553 | |||
| 434 | Ga0105245_10028236 | |||
| 435 | Ga0105245_10047977 | |||
| 436 | Ga0105247_10003925 | |||
| 437 | Ga0105247_10098603 | |||
| 438 | Ga0114129_10179963 | |||
| 439 | Ga0105243_10072694 | |||
| 440 | Ga0105243_10098256 | |||
| 441 | Ga0105241_10249592 | |||
| 442 | Ga0105242_10112603 | |||
| 443 | Ga0105242_11047897 | |||
| 444 | Ga0105248_10141428 | |||
| 445 | Ga0105237_10073908 | |||
| 446 | Ga0105237_10325777 | |||
| 447 | Ga0105237_10383291 | |||
| 448 | Ga0105237_10460081 | |||
| 449 | Ga0105238_10169712 | |||
| 450 | Ga0105238_10421787 | |||
| 451 | Ga0105238_10425998 | |||
| 452 | Ga0105238_10427782 | |||
| 453 | Ga0105249_10103702 | |||
| 454 | Ga0105239_10441022 | |||
| 455 | Ga0105246_10354240 | |||
| 456 | Ga0157369_10166139 | |||
| 457 | Ga0157369_10286909 | |||
| 458 | Ga0157378_10163843 | |||
| 459 | Ga0157378_10643129 | |||
| 460 | Ga0157372_10525817 | |||
| 461 | Ga0157375_10129199 | |||
| 462 | Ga0163163_10171576 | |||
| 463 | Ga0157380_10108686 | |||
| 464 | Ga0157379_10306755 | |||
| 465 | Ga0213876_10015494 | |||
| 466 | Ga0213876_10103862 | |||
| 467 | Ga0213875_10183355 | |||
| 468 | Ga0207692_10036263 | |||
| 469 | Ga0207710_10058070 | |||
| 470 | Ga0207688_10195514 | |||
| 471 | Ga0207647_10112540 | |||
| 472 | Ga0207699_10024020 | |||
| 473 | Ga0207643_10030819 | |||
| 474 | Ga0207705_10042130 | |||
| 475 | Ga0207705_10228582 | |||
| 476 | Ga0207654_10028224 | |||
| 477 | Ga0207654_10080982 | |||
| 478 | Ga0207695_10151281 | |||
| 479 | Ga0207671_10584447 | |||
| 480 | Ga0207671_10726266 | |||
| 481 | Ga0207663_10037431 | |||
| 482 | Ga0207657_10052802 | |||
| 483 | Ga0207657_10091306 | |||
| 484 | Ga0207649_10128360 | |||
| 485 | Ga0207652_10926140 | |||
| 486 | Ga0207681_10050740 | |||
| 487 | Ga0207687_10004015 | |||
| 488 | Ga0207687_10249763 | |||
| 489 | Ga0207700_10117047 | |||
| 490 | Ga0207664_10030361 | |||
| 491 | Ga0207664_10109137 | |||
| 492 | Ga0207644_10117729 | |||
| 493 | Ga0207690_10060715 | |||
| 494 | Ga0207709_10066204 | |||
| 495 | Ga0207670_10034291 | |||
| 496 | Ga0207711_10332374 | |||
| 497 | Ga0207689_10148055 | |||
| 498 | Ga0207661_10441866 | |||
| 499 | Ga0207667_10034309 | |||
| 500 | Ga0207667_10389867 | |||
| 501 | Ga0207667_10489233 | |||
| 502 | Ga0207651_10063733 | |||
| 503 | Ga0207712_10063856 | |||
| 504 | Ga0207668_10005210 | |||
| 505 | Ga0207668_10010596 | |||
| 506 | Ga0207668_10057173 | |||
| 507 | Ga0207640_10104918 | |||
| 508 | Ga0207658_10366822 | |||
| 509 | Ga0207703_10021844 | |||
| 510 | Ga0207639_10302475 | |||
| 511 | Ga0207678_10000161 | |||
| 512 | Ga0207678_10017451 | |||
| 513 | Ga0207708_10066973 | |||
| 514 | Ga0207702_10028138 | |||
| 515 | Ga0207702_10071681 | |||
| 516 | Ga0207648_10440034 | |||
| 517 | Ga0207676_10311957 | |||
| 518 | Ga0207674_10112574 | |||
| 519 | Ga0207675_100153601 | |||
| 520 | Ga0207675_100302225 | |||
| 521 | Ga0207675_101172384 | |||
| 522 | Ga0207698_10005347 | |||
| 523 | Ga0268266_10242647 | |||
| 524 | Ga0268264_10008227 | |||
| 525 | Ga0265319_1057508 | |||
| 526 | Ga0307515_10019231 | |||
| 527 | Ga0307511_10155654 | |||
| 528 | Ga0307512_10149138 | |||
| 529 | Ga0307513_10047278 | |||
| 530 | Ga0307509_10080527 | |||
| 531 | Ga0307508_10293201 | |||
| 532 | Ga0265314_10018522 | |||
| 533 | Ga0307405_10022308 | |||
| 534 | Ga0307413_10274415 | |||
| 535 | Ga0307413_10491703 | |||
| 536 | Ga0307409_100026587 | |||
| 537 | Ga0307409_100130898 | |||
| 538 | Ga0307409_100150728 | |||
| 539 | Ga0307411_10612430 | |||
| 540 | Ga0307411_10910709 | |||
| 541 | Ga0307415_100238893 | |||
| 542 | Ga0307507_10001354 | |||
| 543 | Ga0307507_10015314 | |||
| 544 | Ga0307507_10074841 | |||
| 545 | Ga0307507_10221942 | |||
| 546 | Ga0307510_10058253 | |||
| 547 | Ga0373951_0000006 | |||
| 548 | Ga0373953_0187968 | |||
| 549 | Ga0373942_0052216 | |||
| 550 | Ga0373925_0824476 | |||
| 551 | Ga0395899_0014758 | |||
| 552 | Ga0395900_0016426 | |||
| 553 | Ga0395900_0228323 | |||
| 554 | Ga0395900_0444564 | |||
| 555 | Ga0395898_0000015 | |||
| 556 | Ga0395898_0485681 | |||
| 557 | Ga0436364_0112430 | |||
| 558 | Ga0395901_0041232 | |||
| 559 | Ga0395901_0242364 | |||
| 560 | Ga0436365_0131291 | |||
| 561 | Ga0436365_0457026 | |||
| 562 | Ga0436363_0970724 | |||
| 563 | Ga0436362_0341322 | |||
| 564 | Ga0436362_0739364 | |||
| 565 | Ga0451853_0269984 | |||
| 566 | Ga0466972_0011180 | |||
| 567 | Ga0466972_0014646 | |||
| 568 | Ga0466972_0042225 | |||
| 569 | Ga0466972_0051397 | |||
| 570 | Ga0466965_0021399 | |||
| 571 | Ga0466965_0035705 | |||
| 572 | Ga0466965_0155829 | |||
| 573 | Ga0466966_0010983 | |||
| 574 | Ga0466966_0021689 | |||
| 575 | Ga0466966_0081198 | |||
| 576 | Ga0466961_0009374 | |||
| 577 | Ga0466961_0021063 | |||
| 578 | Ga0466961_0044755 | |||
| 579 | Ga0466961_0090385 | |||
| 580 | Ga0466961_0090749 | |||
| 581 | Ga0466961_0211841 | |||
| 582 | Ga0466961_0494286 | |||
| 583 | Ga0466963_0001728 | |||
| 584 | Ga0466963_0004065 | |||
| 585 | Ga0466963_0015358 | |||
| 586 | Ga0466963_0025801 | |||
| 587 | Ga0466963_0028061 | |||
| 588 | Ga0466963_0051151 | |||
| 589 | Ga0466963_0102009 | |||
| 590 | Ga0466963_0104528 | |||
| 591 | Ga0466963_0234683 | |||
| 592 | Ga0466963_0372914 | |||
| 593 | Ga0466964_0043832 | |||
| 594 | Ga0466964_0063635 | |||
| 595 | Ga0466964_0109229 | |||
| 596 | Ga0466964_0118558 | |||
| 597 | Ga0466971_0022537 | |||
| 598 | Ga0466971_0025488 | |||
| 599 | Ga0466971_0109045 | |||
| 600 | Ga0466968_0221972 | |||
| 601 | Ga0466970_0017429 | |||
| 602 | Ga0466970_0024353 | |||
| 603 | Ga0466970_0044046 | |||
| 604 | Ga0466970_0282812 | |||
| 605 | Ga0466970_0303325 | |||
| 606 | Ga0466970_0464877 | |||
| 607 | Ga0466957_0009956 | |||
| 608 | Ga0466957_0020006 | |||
| 609 | Ga0466957_0025299 | |||
| 610 | Ga0466957_0050081 | |||
| 611 | Ga0466957_0116305 | |||
| 612 | Ga0466957_0168193 | |||
| 613 | Ga0466960_0009599 | |||
| 614 | Ga0466960_0010037 | |||
| 615 | Ga0466960_0070430 | |||
| 616 | Ga0466960_0103584 | |||
| 617 | Ga0466960_0208659 | |||
| 618 | Ga0466959_0027816 | |||
| 619 | Ga0466959_0067340 | |||
| 620 | Ga0466959_0090407 | |||
| 621 | Ga0466959_0121079 | |||
| 622 | Ga0466959_0225063 | |||
| 623 | Ga0466958_0005868 | |||
| 624 | Ga0466958_0007302 | |||
| 625 | Ga0466958_0010080 | |||
| 626 | Ga0466958_0050063 | |||
| 627 | Ga0466958_0075657 | |||
| 628 | Ga0466967_0000529 | |||
| 629 | Ga0466967_0005618 | |||
| 630 | Ga0466967_0017257 | |||
| 631 | Ga0466967_0020972 | |||
| 632 | Ga0466967_0027580 | |||
| 633 | Ga0466967_0039893 | |||
| 634 | Ga0466967_0052649 | |||
| 635 | Ga0466967_0060896 | |||
| 636 | Ga0466967_0115382 | |||
| 637 | Ga0466967_0132773 | |||
| 638 | Ga0466967_0153193 | |||
| 639 | Ga0466967_0154672 | |||
| 640 | Ga0466967_0191149 | |||
| 641 | Ga0466967_0328228 | |||
| 642 | Ga0495653_0362359 | |||
| 643 | Ga0495608_0436429 | |||
| 644 | Ga0495672_0167618 | |||
| 645 | Ga0496100_0116905 | |||
| 646 | Ga0496101_0426424 | |||
| 647 | Ga0496102_0434283 | |||
| 648 | Ga0496103_0066700 | |||
| 649 | Ga0496104_0194489 | |||
| 650 | Ga0496105_0120623 | |||
| 651 | Ga0496106_0033544 | |||
| 652 | Ga0496108_0084681 | |||
| 653 | Ga0496108_0793060 | |||
| 654 | Ga0496109_0162650 | |||
| 655 | Ga0496109_0755882 | |||
| 656 | Ga0496110_0106190 | |||
| 657 | Ga0496110_0112486 | |||
| 658 | Ga0496110_0445407 | |||
| 659 | Ga0496111_0209667 | |||
| 660 | Ga0496112_0065301 | |||
| 661 | Ga0496112_0347487 | |||
| 662 | Ga0496114_0023585 | |||
| 663 | Ga0496115_0265368 | |||
| 664 | Ga0496115_0721706 | |||
| 665 | Ga0496126_0000006 | |||
| 666 | Ga0496126_0008154 | |||
| 667 | Ga0496126_0070367 | |||
| 668 | Ga0501039_0233582 | |||
| 669 | Ga0501068_0057963 | |||
| 670 | Ga0501044_0624674 | |||
| 671 | nmdc:mga0yw44_146888_c1 | |||
| 672 | nmdc:mga07m45_308540_c1 | |||
| 673 | nmdc:mga09592_275717_c1 | |||
| 674 | nmdc:mga0qj67_1997_c1 | |||
| 675 | nmdc:mga08y16_81651_c1 | |||
| 676 | nmdc:mga0a205_116648_c1 | |||
| 677 | Ga0500577_0035946 | |||
| 678 | Ga0501084_0143762 | |||
| 679 | Ga0466962_0000848 | |||
| 680 | Ga0466962_0005941 | |||
| 681 | Ga0466962_0008465 | |||
| 682 | Ga0466962_0009036 | |||
| 683 | Ga0466962_0034342 | |||
| 684 | 2501943253 | |||
| 685 | 2772646194 | |||
| 686 | 2774851735 | |||
| 687 | 2799185903 | |||
| 688 | 2855671465 | |||
| 689 | 2855680633 | |||
| 690 | 2857292161 | |||
| 691 | 2858854556 | |||
| 692 | 2858873860 | |||
| 693 | 2858883682 | |||
| 694 | 2858890477 | |||
| 695 | 2858901107 | |||
| 696 | 2867350801 | |||
| 697 | 2867509593 | |||
| 698 | 2869049136 | |||
| 699 | 2869062595 | |||
| 700 | 2869070397 | |||
| 701 | 2880498845 | |||
| 702 | 2915768818 | |||
| 703 | 2929220849 | |||
| 704 | 2929227435 | |||
| 705 | 649811386 | |||
| 706 | 8003318550 | |||
| 707 | 8003319625 | |||
| 708 | 8003833879 | |||
| 709 | 8003877675 | |||
| 710 | 8054710919 | |||
| 711 | 8054727569 | |||
| 712 | 8054735017 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nnn-assembly1.cif.gz_B | bef3 activated drrd receiver domain | 0.9617 | 1 | 118 |
| 6ont-assembly1.cif.gz_A-2 | structure of the francisella response regulator 1452 receiver domain | 0.9606 | 2 | 118 |
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9601 | 1 | 118 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.957 | 2 | 120 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.954 | 1 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9715 | 2 | 117 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9588 | 1 | 80 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9561 | 1 | 83 | 3.40.50.2300 |
| af_P14375_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9491 | 1 | 116 | 3.40.50.2300 |
| af_P52076_121_218_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.949 | 126 | 219 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5T074-F1-model_v4 | Response regulator transcription factor | 0.8378 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7Y5T074-F1-model_v4 | Response regulator transcription factor | 0.8277 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A4R6BGH9-F1-model_v4 | Response regulator ArlR | 0.7841 | 1 | 219 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A4R6BGH9-F1-model_v4 | Response regulator ArlR | 0.7811 | 1 | 219 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7C5YVR1-F1-model_v4 | Response regulator transcription factor | 0.7784 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |