F420556

General Info

Members Datasets Scaffolds Average Seq Length
356 235 712 251

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10009909|Ga0307510_100099094
Length 285
Sequence LSPATAPPVESSTSSVAGSASPSRSRGRPTQLAGLHAVVTGASRGIGADIAAALVADGVRVSLLGRDAEALRRVADNLGGDERARSMTTDVTDSDSVTNAFNAARSHFGPVQLLINNAGQAASAKFTDTDETLWNQLFAVNLHGTYYCCRQAVPDMLSAGFGRIVNVASIAGLRGAAYISAYVSSKHAVIGLTRALALEYAARNITVNAVCPGYVDTDIVRSAVANIVSKTGRSEAEALAALVANNPQRRLIEPREVADTVMWLCRPGSESVTGQSIVLAGGEVT

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
235 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0
Rhizoplane 6.74
Rhizosphere 74.44
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10009909 3300033180 Bacteria 11331
2 rootH1_10088114 3300003316 Bacteria 2012
3 rootH2_10018197 3300003320 Bacteria 17459
4 rootH2_10119723 3300003320 Bacteria 2206
5 rootL2_10113349 3300003322 Bacteria 1555
6 rootH1_10166956 3300003323 Bacteria 1232
7 Ga0070683_100314071 3300005329 Bacteria 1491
8 Ga0070690_100202852 3300005330 Bacteria 1381
9 Ga0070670_100130980 3300005331 Bacteria 2166
10 Ga0070666_10105471 3300005335 Bacteria 1947
11 Ga0070680_100035017 3300005336 Bacteria 4052
12 Ga0070660_100007234 3300005339 Bacteria 7725
13 Ga0070675_100048390 3300005354 Bacteria 3486
14 Ga0070671_100003523 3300005355 Bacteria 12231
15 Ga0070671_100022614 3300005355 Bacteria 5135
16 Ga0070671_100278518 3300005355 Archaea 1422
17 Ga0070673_100526311 3300005364 Bacteria 1072
18 Ga0070659_100014504 3300005366 Bacteria 5890
19 Ga0070667_100008505 3300005367 Bacteria 8509
20 Ga0070667_100750602 3300005367 Bacteria 904
21 Ga0070713_100022024 3300005436 Bacteria 4916
22 Ga0070710_10082201 3300005437 Bacteria 1883
23 Ga0070711_100002285 3300005439 Bacteria 10866
24 Ga0070711_100048958 3300005439 Bacteria 2893
25 Ga0070711_100072931 3300005439 Bacteria 2423
26 Ga0070705_100199928 3300005440 Bacteria 1369
27 Ga0070663_100170638 3300005455 Bacteria 1681
28 Ga0070678_100096532 3300005456 Bacteria 2280
29 Ga0070681_10181978 3300005458 Bacteria 2023
30 Ga0070707_100819204 3300005468 Bacteria 895
31 Ga0070698_100000406 3300005471 Bacteria 45673
32 Ga0070679_100025565 3300005530 Bacteria 5796
33 Ga0070686_100124280 3300005544 Bacteria 1776
34 Ga0070665_100029292 3300005548 Bacteria 5541
35 Ga0070665_100078113 3300005548 Bacteria 3316
36 Ga0070665_100274424 3300005548 Bacteria 1688
37 Ga0068855_100050698 3300005563 Bacteria 4890
38 Ga0068855_100384266 3300005563 Bacteria 1541
39 Ga0068856_100026857 3300005614 Bacteria 5614
40 Ga0068859_100000516 3300005617 Bacteria 38281
41 Ga0068859_100021009 3300005617 Bacteria 6553
42 Ga0068859_100529651 3300005617 Bacteria 1273
43 Ga0068866_10032754 3300005718 Bacteria 2516
44 Ga0068863_100004662 3300005841 Bacteria 13516
45 Ga0068863_100040041 3300005841 Bacteria 4456
46 Ga0068858_100002126 3300005842 Bacteria 20085
47 Ga0068858_100009013 3300005842 Bacteria 9543
48 Ga0068858_100250428 3300005842 Bacteria 1682
49 Ga0068860_100000302 3300005843 Bacteria 68581
50 Ga0068860_100063390 3300005843 Bacteria 3511
51 Ga0068860_100927327 3300005843 Bacteria 887
52 Ga0068862_100011113 3300005844 Bacteria 7435
53 Ga0068862_100033368 3300005844 Bacteria 4350
54 Ga0070717_10199774 3300006028 Bacteria 1751
55 Ga0075365_10031073 3300006038 Bacteria 3424
56 Ga0075364_10095775 3300006051 Bacteria 1974
57 Ga0070715_10000368 3300006163 Bacteria 11294
58 Ga0070712_100049317 3300006175 Bacteria 2923
59 Ga0075362_10052859 3300006177 Bacteria 1822
60 Ga0075367_10252635 3300006178 Bacteria 1106
61 Ga0068871_100006891 3300006358 Bacteria 8090
62 Ga0068871_100403164 3300006358 Bacteria 1218
63 Ga0068871_100444745 3300006358 Bacteria 1161
64 Ga0075431_100099021 3300006847 Bacteria 3009
65 Ga0075431_100246163 3300006847 Bacteria 1817
66 Ga0075433_10001725 3300006852 Bacteria 16301
67 Ga0075433_10066560 3300006852 Bacteria 3161
68 Ga0075429_100041611 3300006880 Bacteria 4002
69 Ga0097620_100000516 3300006931 Bacteria 38281
70 Ga0097620_100021009 3300006931 Bacteria 6553
71 Ga0097620_100529624 3300006931 Bacteria 1273
72 Ga0075435_100294648 3300007076 Bacteria 1387
73 Ga0099795_10000157 3300007788 Bacteria 11437
74 Ga0105250_10017314 3300009092 Bacteria 2930
75 Ga0105240_10003065 3300009093 Bacteria 26255
76 Ga0105240_10074974 3300009093 Bacteria 4174
77 Ga0105240_10085909 3300009093 Bacteria 3854
78 Ga0105240_10276727 3300009093 Bacteria 1930
79 Ga0111539_10050932 3300009094 Bacteria 4933
80 Ga0111539_10081379 3300009094 Bacteria 3809
81 Ga0105245_10005961 3300009098 Bacteria 10706
82 Ga0105247_10000160 3300009101 Bacteria 66010
83 Ga0105247_10047692 3300009101 Bacteria 2631
84 Ga0105247_10108303 3300009101 Bacteria 1785
85 Ga0114129_10998023 3300009147 Unclassified 1054
86 Ga0105242_10713983 3300009176 Bacteria 982
87 Ga0105248_10062189 3300009177 Bacteria 4193
88 Ga0105237_10434697 3300009545 Bacteria 1318
89 Ga0105237_10495181 3300009545 Bacteria 1229
90 Ga0105238_10015876 3300009551 Bacteria 7619
91 Ga0105238_10083822 3300009551 Bacteria 3177
92 Ga0105249_10046106 3300009553 Bacteria 3967
93 Ga0105249_10125984 3300009553 Bacteria 2439
94 Ga0105249_10197256 3300009553 Bacteria 1968
95 Ga0105249_10319370 3300009553 Bacteria 1564
96 Ga0099796_10000169 3300010159 Bacteria 9840
97 Ga0105239_10000031 3300010375 Bacteria 226947
98 Ga0105239_10020074 3300010375 Bacteria 7373
99 Ga0105239_10218228 3300010375 Bacteria 2138
100 Ga0157370_10120722 3300013104 Bacteria 2447
101 Ga0157369_10000598 3300013105 Bacteria 46913
102 Ga0157374_10099576 3300013296 Bacteria 2785
103 Ga0157374_10367530 3300013296 Bacteria 1431
104 Ga0157378_10286449 3300013297 Bacteria 1590
105 Ga0163162_10024980 3300013306 Bacteria 5902
106 Ga0163162_10027768 3300013306 Bacteria 5598
107 Ga0163162_10408234 3300013306 Bacteria 1491
108 Ga0163163_10019346 3300014325 Bacteria 6394
109 Ga0157379_10001449 3300014968 Bacteria 19495
110 Ga0157379_10091628 3300014968 Bacteria 2726
111 Ga0213874_10002017 3300021377 Bacteria 4290
112 Ga0213876_10000393 3300021384 Bacteria 36736
113 Ga0207692_10078270 3300025898 Bacteria 1761
114 Ga0207710_10004774 3300025900 Bacteria 5879
115 Ga0207680_10166065 3300025903 Bacteria 1483
116 Ga0207705_10000279 3300025909 Bacteria 48672
117 Ga0207707_10015432 3300025912 Bacteria 6653
118 Ga0207707_10057057 3300025912 Bacteria 3399
119 Ga0207695_10008959 3300025913 Bacteria 12457
120 Ga0207695_10063162 3300025913 Bacteria 3818
121 Ga0207695_10116019 3300025913 Bacteria 2652
122 Ga0207695_10161248 3300025913 Bacteria 2174
123 Ga0207671_10064549 3300025914 Bacteria 2722
124 Ga0207671_10328149 3300025914 Bacteria 1212
125 Ga0207693_10002158 3300025915 Bacteria 17141
126 Ga0207663_10034808 3300025916 Bacteria 3016
127 Ga0207660_10009720 3300025917 Bacteria 6226
128 Ga0207657_10018852 3300025919 Bacteria 6571
129 Ga0207652_10012844 3300025921 Bacteria 6771
130 Ga0207652_10021479 3300025921 Bacteria 5328
131 Ga0207681_10255222 3300025923 Bacteria 1371
132 Ga0207694_10066848 3300025924 Bacteria 2805
133 Ga0207650_10419442 3300025925 Unclassified 1110
134 Ga0207700_10073742 3300025928 Bacteria 2637
135 Ga0207700_10080520 3300025928 Bacteria 2540
136 Ga0207700_10280371 3300025928 Bacteria 1433
137 Ga0207664_10240500 3300025929 Bacteria 1576
138 Ga0207664_10407131 3300025929 Bacteria 1210
139 Ga0207664_10495600 3300025929 Bacteria 1094
140 Ga0207644_10008133 3300025931 Bacteria 6871
141 Ga0207644_10158283 3300025931 Bacteria 1758
142 Ga0207644_10320990 3300025931 Bacteria 1252
143 Ga0207704_10060930 3300025938 Bacteria 2337
144 Ga0207665_10024876 3300025939 Bacteria 3949
145 Ga0207665_10303575 3300025939 Bacteria 1194
146 Ga0207667_10197866 3300025949 Bacteria 2062
147 Ga0207667_10285627 3300025949 Bacteria 1686
148 Ga0207712_10118845 3300025961 Bacteria 1996
149 Ga0207677_10149334 3300026023 Bacteria 1801
150 Ga0207703_10000546 3300026035 Bacteria 38625
151 Ga0207703_10002179 3300026035 Bacteria 17192
152 Ga0207639_10196969 3300026041 Bacteria 1725
153 Ga0207678_10161015 3300026067 Bacteria 1917
154 Ga0207702_10021568 3300026078 Bacteria 5334
155 Ga0207641_10018087 3300026088 Bacteria 5775
156 Ga0207676_10068446 3300026095 Bacteria 2840
157 Ga0207674_10412780 3300026116 Bacteria 1305
158 Ga0207675_100025359 3300026118 Bacteria 5517
159 Ga0207683_10003904 3300026121 Bacteria 12920
160 Ga0207698_10313725 3300026142 Bacteria 1465
161 Ga0209179_1001900 3300027512 Bacteria 2692
162 Ga0268266_10004419 3300028379 Bacteria 13471
163 Ga0268266_10241310 3300028379 Bacteria 1668
164 Ga0268266_10412035 3300028379 Bacteria 1279
165 Ga0268265_10008348 3300028380 Bacteria 6992
166 Ga0268265_10061484 3300028380 Bacteria 2882
167 Ga0268265_10105241 3300028380 Bacteria 2289
168 Ga0268264_10000020 3300028381 Bacteria 483593
169 Ga0268264_10119844 3300028381 Bacteria 2317
170 Ga0307515_10144305 3300028794 Bacteria 2532
171 Ga0307511_10001404 3300030521 Bacteria 25426
172 Ga0307511_10033177 3300030521 Bacteria 4564
173 Ga0307511_10038904 3300030521 Bacteria 4073
174 Ga0265316_10111922 3300031344 Bacteria 2067
175 Ga0307509_10003073 3300031507 Bacteria 25922
176 Ga0307509_10196714 3300031507 Bacteria 1858
177 Ga0307509_10218375 3300031507 Bacteria 1722
178 Ga0307509_10301834 3300031507 Bacteria 1349
179 Ga0307508_10192970 3300031616 Bacteria 1638
180 Ga0307508_10200215 3300031616 Bacteria 1597
181 Ga0316578_10062544 3300031728 Bacteria 2195
182 Ga0307405_10034590 3300031731 Bacteria 3008
183 Ga0307416_100000289 3300032002 Bacteria 26280
184 Ga0307411_10027447 3300032005 Bacteria 3445
185 Ga0307510_10000001 3300033180 Bacteria 1172244
186 Ga0373923_0117061 3300035111 Bacteria 1188
187 Ga0373936_0025762 3300035113 Bacteria 2301
188 Ga0373954_0042661 3300035118 Bacteria 2115
189 Ga0373954_0107356 3300035118 Bacteria 1349
190 Ga0373957_0029312 3300035120 Bacteria 2010
191 Ga0373943_0000902 3300035170 Bacteria 13104
192 Ga0373946_0185972 3300035171 Bacteria 988
193 Ga0373955_0028103 3300035172 Bacteria 2914
194 Ga0373955_0045862 3300035172 Bacteria 2360
195 Ga0373935_0020471 3300035692 Bacteria 4044
196 Ga0373935_0032763 3300035692 Bacteria 3230
197 Ga0373935_0049317 3300035692 Bacteria 2668
198 Ga0373935_0227849 3300035692 Bacteria 1297
199 Ga0373927_0015319 3300035695 Bacteria 5064
200 Ga0373927_0016920 3300035695 Bacteria 4806
201 Ga0373927_0052270 3300035695 Bacteria 2643
202 Ga0373927_0146850 3300035695 Bacteria 1544
203 Ga0373933_0009570 3300035724 Bacteria 5291
204 Ga0373933_0258536 3300035724 Bacteria 1122
205 Ga0373947_0036909 3300035725 Bacteria 2898
206 Ga0373947_0067711 3300035725 Bacteria 2182
207 Ga0373947_0116367 3300035725 Bacteria 1695
208 Ga0373937_0047307 3300036401 Bacteria 3936
209 Ga0373937_0052853 3300036401 Bacteria 3726
210 Ga0316584_0385309 3300036712 Bacteria 1001
211 Ga0373925_0077195 3300037068 Bacteria 2527
212 Ga0373925_0154252 3300037068 Bacteria 1805
213 Ga0395898_0003564 3300037466 Bacteria 17354
214 Ga0395898_0154025 3300037466 Bacteria 2199
215 Ga0436365_0009505 3300039437 Bacteria 114283
216 Ga0436360_1239710 3300039438 Bacteria 1051
217 Ga0436363_0030180 3300039450 Bacteria 7856
218 Ga0436363_1644096 3300039450 Bacteria 18178
219 Ga0439439_0044070 3300041406 Bacteria 1161
220 Ga0451577_0000016 3300042876 Bacteria 531002
221 Ga0466966_0088736 3300044684 Bacteria 1921
222 Ga0495592_0004384 3300046454 Bacteria 10326
223 Ga0495629_0028335 3300046459 Bacteria 3977
224 Ga0495629_0043243 3300046459 Bacteria 3163
225 Ga0495629_0292659 3300046459 Bacteria 1116
226 Ga0495651_0013518 3300046462 Bacteria 6312
227 Ga0495653_0010661 3300046463 Bacteria 7525
228 Ga0495650_0000093 3300046471 Bacteria 221558
229 Ga0495580_0000770 3300046472 Bacteria 27580
230 Ga0495580_0011039 3300046472 Bacteria 7002
231 Ga0495580_0203395 3300046472 Bacteria 1364
232 Ga0495582_0145789 3300046473 Bacteria 1343
233 Ga0495662_0024617 3300046476 Bacteria 2905
234 Ga0495664_0018205 3300046477 Bacteria 4021
235 Ga0495594_0132634 3300046499 Bacteria 1411
236 Ga0495594_0221438 3300046499 Bacteria 1079
237 Ga0495606_0160729 3300046507 Bacteria 1311
238 Ga0495608_0006934 3300046511 Bacteria 8022
239 Ga0495618_0035828 3300046514 Bacteria 3114
240 Ga0495618_0102836 3300046514 Bacteria 1829
241 Ga0495628_0023011 3300046516 Bacteria 5115
242 Ga0495630_0028747 3300046517 Bacteria 4131
243 Ga0495632_0100981 3300046519 Bacteria 1360
244 Ga0495643_0018774 3300046522 Bacteria 4008
245 Ga0495666_0017222 3300046526 Bacteria 3599
246 Ga0495652_0004100 3300046529 Bacteria 14064
247 Ga0495665_0158858 3300046531 Bacteria 1179
248 Ga0495587_0007905 3300046536 Bacteria 6869
249 Ga0495645_0026874 3300046543 Bacteria 4180
250 Ga0495645_0037614 3300046543 Bacteria 3529
251 Ga0495667_0019879 3300046559 Bacteria 4532
252 Ga0495634_0009248 3300046642 Bacteria 7273
253 Ga0495599_0009045 3300046678 Bacteria 6068
254 Ga0495623_0015126 3300046679 Bacteria 4989
255 Ga0495646_0006996 3300046680 Bacteria 7162
256 Ga0495647_0020066 3300046681 Bacteria 2397
257 Ga0495658_0000143 3300046683 Bacteria 39833
258 Ga0495658_0081544 3300046683 Bacteria 1900
259 Ga0495613_0080617 3300046689 Bacteria 2365
260 Ga0495649_0038890 3300046694 Bacteria 2609
261 Ga0495600_0050155 3300046809 Bacteria 2723
262 Ga0495581_0083432 3300047315 Bacteria 1851
263 Ga0495604_0038657 3300047317 Bacteria 3753
264 Ga0495674_0178679 3300047319 Bacteria 1768
265 Ga0495676_0044552 3300047321 Bacteria 3621
266 Ga0495680_0088514 3300047322 Bacteria 2326
267 Ga0495675_0007401 3300047444 Bacteria 6760
268 Ga0495684_0017529 3300047471 Bacteria 5513
269 Ga0495593_0054781 3300047673 Bacteria 2101
270 Ga0495602_0053186 3300048088 Bacteria 3588
271 Ga0495614_0116102 3300048089 Bacteria 1178
272 Ga0496100_0242421 3300048903 Bacteria 1330
273 Ga0496101_0012664 3300048904 Bacteria 5636
274 Ga0496102_0020556 3300048905 Bacteria 5834
275 Ga0496102_0031414 3300048905 Bacteria 4764
276 Ga0496102_0246223 3300048905 Bacteria 1685
277 Ga0496102_0306579 3300048905 Bacteria 1496
278 Ga0496102_0438320 3300048905 Bacteria 1226
279 Ga0496103_0053817 3300048906 Bacteria 2495
280 Ga0496104_0244850 3300048907 Bacteria 1705
281 Ga0496104_0262822 3300048907 Bacteria 1638
282 Ga0496104_0671218 3300048907 Bacteria 945
283 Ga0496105_0014358 3300048908 Bacteria 6302
284 Ga0496106_0005572 3300048909 Bacteria 9321
285 Ga0496106_0014077 3300048909 Bacteria 5911
286 Ga0496107_0002298 3300048910 Bacteria 12337
287 Ga0496108_0128732 3300048911 Bacteria 2175
288 Ga0496111_0007861 3300048914 Bacteria 7027
289 Ga0496112_0044505 3300048915 Bacteria 4350
290 Ga0496113_0024702 3300048916 Bacteria 4276
291 Ga0496114_0020528 3300048917 Bacteria 5361
292 Ga0496114_0243474 3300048917 Bacteria 1582
293 Ga0496115_0015740 3300048918 Bacteria 5744
294 Ga0496115_0052922 3300048918 Bacteria 3257
295 Ga0496115_0125651 3300048918 Bacteria 2113
296 Ga0496116_0005327 3300048919 Bacteria 11986
297 Ga0496117_0000155 3300048920 Bacteria 146091
298 Ga0496117_0056829 3300048920 Bacteria 2722
299 Ga0496118_0000066 3300048921 Bacteria 207678
300 Ga0496118_0008170 3300048921 Bacteria 10890
301 Ga0496118_0010974 3300048921 Bacteria 8903
302 Ga0496119_0009925 3300048922 Bacteria 8080
303 Ga0496119_0012753 3300048922 Bacteria 6787
304 Ga0496119_0116422 3300048922 Bacteria 1475
305 Ga0496120_0001432 3300048923 Bacteria 28778
306 Ga0496120_0084149 3300048923 Bacteria 1716
307 Ga0496121_0001380 3300048924 Bacteria 41120
308 Ga0496121_0009848 3300048924 Bacteria 10908
309 Ga0496121_0011153 3300048924 Bacteria 10023
310 Ga0496124_0010052 3300048927 Bacteria 9651
311 Ga0496124_0205847 3300048927 Bacteria 1492
312 Ga0496124_0242906 3300048927 Bacteria 1338
313 Ga0496125_0001878 3300048928 Bacteria 28857
314 Ga0496125_0015510 3300048928 Bacteria 7364
315 Ga0496125_0023577 3300048928 Bacteria 5677
316 Ga0496125_0024638 3300048928 Bacteria 5527
317 Ga0496126_0013430 3300048929 Bacteria 8329
318 Ga0496126_0037862 3300048929 Bacteria 4493
319 Ga0496126_0211114 3300048929 Bacteria 1634
320 Ga0496126_0232167 3300048929 Unclassified 1545
321 Ga0495682_0041787 3300049460 Bacteria 1681
322 Ga0501033_0157951 3300049570 Bacteria 1633
323 Ga0501037_0357345 3300049573 Bacteria 1007
324 Ga0501039_0009009 3300049575 Bacteria 7603
325 Ga0501041_0048647 3300049577 Bacteria 2583
326 Ga0501047_0149663 3300049581 Bacteria 2211
327 Ga0501048_0425438 3300049582 Bacteria 950
328 Ga0501068_0082390 3300049584 Bacteria 1976
329 Ga0501070_0552982 3300049586 Bacteria 921
330 Ga0501074_0130599 3300049590 Bacteria 1797
331 Ga0501076_0815412 3300049592 Bacteria 770
332 nmdc:mga0yw44_42985_c1 3300050492 Bacteria 2697
333 nmdc:mga09592_739786_c1 3300050508 Unclassified 835
334 nmdc:mga06r32_216641_c1 3300050510 Bacteria 1902
335 nmdc:mga06r32_290128_c1 3300050510 Bacteria 1623
336 nmdc:mga08y16_132391_c1 3300050511 Bacteria 2592
337 nmdc:mga08y16_146249_c1 3300050511 Bacteria 2457
338 nmdc:mga08y16_38819_c1 3300050511 Bacteria 4997
339 nmdc:mga0rr50_110624_c1 3300050513 Bacteria 2173
340 nmdc:mga0a205_130_c1 3300050515 Bacteria 46564
341 Ga0495601_0008585 3300053077 Bacteria 6036
342 Ga0500566_0085084 3300053094 Bacteria 1754
343 Ga0500641_0140673 3300053096 Bacteria 1042
344 Ga0500591_116562 3300053115 Bacteria 1107
345 Ga0500595_022241 3300053119 Bacteria 2248
346 Ga0500652_000004 3300053131 Bacteria 173428
347 Ga0500559_0066475 3300053136 Bacteria 1617
348 Ga0500573_0202528 3300053140 Bacteria 1052
349 Ga0500590_084119 3300053148 Bacteria 1558
350 Ga0500604_0033793 3300053151 Bacteria 1514
351 Ga0500639_102261 3300053163 Bacteria 1408
352 Ga0500636_0023642 3300053177 Bacteria 3633
353 Ga0500636_0146728 3300053177 Bacteria 1299
354 Ga0500637_0018793 3300053178 Bacteria 3717
355 Ga0500637_0086831 3300053178 Bacteria 1809
356 Ga0500596_011235 3300053735 Bacteria 1371
357 Ga0307510_10009909
358 rootH1_10088114
359 rootH2_10018197
360 rootH2_10119723
361 rootL2_10113349
362 rootH1_10166956
363 Ga0070683_100314071
364 Ga0070690_100202852
365 Ga0070670_100130980
366 Ga0070666_10105471
367 Ga0070680_100035017
368 Ga0070660_100007234
369 Ga0070675_100048390
370 Ga0070671_100003523
371 Ga0070671_100022614
372 Ga0070671_100278518
373 Ga0070673_100526311
374 Ga0070659_100014504
375 Ga0070667_100008505
376 Ga0070667_100750602
377 Ga0070713_100022024
378 Ga0070710_10082201
379 Ga0070711_100002285
380 Ga0070711_100048958
381 Ga0070711_100072931
382 Ga0070705_100199928
383 Ga0070663_100170638
384 Ga0070678_100096532
385 Ga0070681_10181978
386 Ga0070707_100819204
387 Ga0070698_100000406
388 Ga0070679_100025565
389 Ga0070686_100124280
390 Ga0070665_100029292
391 Ga0070665_100078113
392 Ga0070665_100274424
393 Ga0068855_100050698
394 Ga0068855_100384266
395 Ga0068856_100026857
396 Ga0068859_100000516
397 Ga0068859_100021009
398 Ga0068859_100529651
399 Ga0068866_10032754
400 Ga0068863_100004662
401 Ga0068863_100040041
402 Ga0068858_100002126
403 Ga0068858_100009013
404 Ga0068858_100250428
405 Ga0068860_100000302
406 Ga0068860_100063390
407 Ga0068860_100927327
408 Ga0068862_100011113
409 Ga0068862_100033368
410 Ga0070717_10199774
411 Ga0075365_10031073
412 Ga0075364_10095775
413 Ga0070715_10000368
414 Ga0070712_100049317
415 Ga0075362_10052859
416 Ga0075367_10252635
417 Ga0068871_100006891
418 Ga0068871_100403164
419 Ga0068871_100444745
420 Ga0075431_100099021
421 Ga0075431_100246163
422 Ga0075433_10001725
423 Ga0075433_10066560
424 Ga0075429_100041611
425 Ga0097620_100000516
426 Ga0097620_100021009
427 Ga0097620_100529624
428 Ga0075435_100294648
429 Ga0099795_10000157
430 Ga0105250_10017314
431 Ga0105240_10003065
432 Ga0105240_10074974
433 Ga0105240_10085909
434 Ga0105240_10276727
435 Ga0111539_10050932
436 Ga0111539_10081379
437 Ga0105245_10005961
438 Ga0105247_10000160
439 Ga0105247_10047692
440 Ga0105247_10108303
441 Ga0114129_10998023
442 Ga0105242_10713983
443 Ga0105248_10062189
444 Ga0105237_10434697
445 Ga0105237_10495181
446 Ga0105238_10015876
447 Ga0105238_10083822
448 Ga0105249_10046106
449 Ga0105249_10125984
450 Ga0105249_10197256
451 Ga0105249_10319370
452 Ga0099796_10000169
453 Ga0105239_10000031
454 Ga0105239_10020074
455 Ga0105239_10218228
456 Ga0157370_10120722
457 Ga0157369_10000598
458 Ga0157374_10099576
459 Ga0157374_10367530
460 Ga0157378_10286449
461 Ga0163162_10024980
462 Ga0163162_10027768
463 Ga0163162_10408234
464 Ga0163163_10019346
465 Ga0157379_10001449
466 Ga0157379_10091628
467 Ga0213874_10002017
468 Ga0213876_10000393
469 Ga0207692_10078270
470 Ga0207710_10004774
471 Ga0207680_10166065
472 Ga0207705_10000279
473 Ga0207707_10015432
474 Ga0207707_10057057
475 Ga0207695_10008959
476 Ga0207695_10063162
477 Ga0207695_10116019
478 Ga0207695_10161248
479 Ga0207671_10064549
480 Ga0207671_10328149
481 Ga0207693_10002158
482 Ga0207663_10034808
483 Ga0207660_10009720
484 Ga0207657_10018852
485 Ga0207652_10012844
486 Ga0207652_10021479
487 Ga0207681_10255222
488 Ga0207694_10066848
489 Ga0207650_10419442
490 Ga0207700_10073742
491 Ga0207700_10080520
492 Ga0207700_10280371
493 Ga0207664_10240500
494 Ga0207664_10407131
495 Ga0207664_10495600
496 Ga0207644_10008133
497 Ga0207644_10158283
498 Ga0207644_10320990
499 Ga0207704_10060930
500 Ga0207665_10024876
501 Ga0207665_10303575
502 Ga0207667_10197866
503 Ga0207667_10285627
504 Ga0207712_10118845
505 Ga0207677_10149334
506 Ga0207703_10000546
507 Ga0207703_10002179
508 Ga0207639_10196969
509 Ga0207678_10161015
510 Ga0207702_10021568
511 Ga0207641_10018087
512 Ga0207676_10068446
513 Ga0207674_10412780
514 Ga0207675_100025359
515 Ga0207683_10003904
516 Ga0207698_10313725
517 Ga0209179_1001900
518 Ga0268266_10004419
519 Ga0268266_10241310
520 Ga0268266_10412035
521 Ga0268265_10008348
522 Ga0268265_10061484
523 Ga0268265_10105241
524 Ga0268264_10000020
525 Ga0268264_10119844
526 Ga0307515_10144305
527 Ga0307511_10001404
528 Ga0307511_10033177
529 Ga0307511_10038904
530 Ga0265316_10111922
531 Ga0307509_10003073
532 Ga0307509_10196714
533 Ga0307509_10218375
534 Ga0307509_10301834
535 Ga0307508_10192970
536 Ga0307508_10200215
537 Ga0316578_10062544
538 Ga0307405_10034590
539 Ga0307416_100000289
540 Ga0307411_10027447
541 Ga0307510_10000001
542 Ga0373923_0117061
543 Ga0373936_0025762
544 Ga0373954_0042661
545 Ga0373954_0107356
546 Ga0373957_0029312
547 Ga0373943_0000902
548 Ga0373946_0185972
549 Ga0373955_0028103
550 Ga0373955_0045862
551 Ga0373935_0020471
552 Ga0373935_0032763
553 Ga0373935_0049317
554 Ga0373935_0227849
555 Ga0373927_0015319
556 Ga0373927_0016920
557 Ga0373927_0052270
558 Ga0373927_0146850
559 Ga0373933_0009570
560 Ga0373933_0258536
561 Ga0373947_0036909
562 Ga0373947_0067711
563 Ga0373947_0116367
564 Ga0373937_0047307
565 Ga0373937_0052853
566 Ga0316584_0385309
567 Ga0373925_0077195
568 Ga0373925_0154252
569 Ga0395898_0003564
570 Ga0395898_0154025
571 Ga0436365_0009505
572 Ga0436360_1239710
573 Ga0436363_0030180
574 Ga0436363_1644096
575 Ga0439439_0044070
576 Ga0451577_0000016
577 Ga0466966_0088736
578 Ga0495592_0004384
579 Ga0495629_0028335
580 Ga0495629_0043243
581 Ga0495629_0292659
582 Ga0495651_0013518
583 Ga0495653_0010661
584 Ga0495650_0000093
585 Ga0495580_0000770
586 Ga0495580_0011039
587 Ga0495580_0203395
588 Ga0495582_0145789
589 Ga0495662_0024617
590 Ga0495664_0018205
591 Ga0495594_0132634
592 Ga0495594_0221438
593 Ga0495606_0160729
594 Ga0495608_0006934
595 Ga0495618_0035828
596 Ga0495618_0102836
597 Ga0495628_0023011
598 Ga0495630_0028747
599 Ga0495632_0100981
600 Ga0495643_0018774
601 Ga0495666_0017222
602 Ga0495652_0004100
603 Ga0495665_0158858
604 Ga0495587_0007905
605 Ga0495645_0026874
606 Ga0495645_0037614
607 Ga0495667_0019879
608 Ga0495634_0009248
609 Ga0495599_0009045
610 Ga0495623_0015126
611 Ga0495646_0006996
612 Ga0495647_0020066
613 Ga0495658_0000143
614 Ga0495658_0081544
615 Ga0495613_0080617
616 Ga0495649_0038890
617 Ga0495600_0050155
618 Ga0495581_0083432
619 Ga0495604_0038657
620 Ga0495674_0178679
621 Ga0495676_0044552
622 Ga0495680_0088514
623 Ga0495675_0007401
624 Ga0495684_0017529
625 Ga0495593_0054781
626 Ga0495602_0053186
627 Ga0495614_0116102
628 Ga0496100_0242421
629 Ga0496101_0012664
630 Ga0496102_0020556
631 Ga0496102_0031414
632 Ga0496102_0246223
633 Ga0496102_0306579
634 Ga0496102_0438320
635 Ga0496103_0053817
636 Ga0496104_0244850
637 Ga0496104_0262822
638 Ga0496104_0671218
639 Ga0496105_0014358
640 Ga0496106_0005572
641 Ga0496106_0014077
642 Ga0496107_0002298
643 Ga0496108_0128732
644 Ga0496111_0007861
645 Ga0496112_0044505
646 Ga0496113_0024702
647 Ga0496114_0020528
648 Ga0496114_0243474
649 Ga0496115_0015740
650 Ga0496115_0052922
651 Ga0496115_0125651
652 Ga0496116_0005327
653 Ga0496117_0000155
654 Ga0496117_0056829
655 Ga0496118_0000066
656 Ga0496118_0008170
657 Ga0496118_0010974
658 Ga0496119_0009925
659 Ga0496119_0012753
660 Ga0496119_0116422
661 Ga0496120_0001432
662 Ga0496120_0084149
663 Ga0496121_0001380
664 Ga0496121_0009848
665 Ga0496121_0011153
666 Ga0496124_0010052
667 Ga0496124_0205847
668 Ga0496124_0242906
669 Ga0496125_0001878
670 Ga0496125_0015510
671 Ga0496125_0023577
672 Ga0496125_0024638
673 Ga0496126_0013430
674 Ga0496126_0037862
675 Ga0496126_0211114
676 Ga0496126_0232167
677 Ga0495682_0041787
678 Ga0501033_0157951
679 Ga0501037_0357345
680 Ga0501039_0009009
681 Ga0501041_0048647
682 Ga0501047_0149663
683 Ga0501048_0425438
684 Ga0501068_0082390
685 Ga0501070_0552982
686 Ga0501074_0130599
687 Ga0501076_0815412
688 nmdc:mga0yw44_42985_c1
689 nmdc:mga09592_739786_c1
690 nmdc:mga06r32_216641_c1
691 nmdc:mga06r32_290128_c1
692 nmdc:mga08y16_132391_c1
693 nmdc:mga08y16_146249_c1
694 nmdc:mga08y16_38819_c1
695 nmdc:mga0rr50_110624_c1
696 nmdc:mga0a205_130_c1
697 Ga0495601_0008585
698 Ga0500566_0085084
699 Ga0500641_0140673
700 Ga0500591_116562
701 Ga0500595_022241
702 Ga0500652_000004
703 Ga0500559_0066475
704 Ga0500573_0202528
705 Ga0500590_084119
706 Ga0500604_0033793
707 Ga0500639_102261
708 Ga0500636_0023642
709 Ga0500636_0146728
710 Ga0500637_0018793
711 Ga0500637_0086831
712 Ga0500596_011235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

228

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

283

0.91

PF08659

KR

KR domain

36

197

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

37

280

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_D the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9705 9 258
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9701 9 258
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9681 7 258
6zzq-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate 0.9667 7 255
4cqm-assembly1.cif.gz_J crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9666 11 255
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9728 12 54 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9663 95 193 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.958 8 258 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9531 11 258 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9523 7 255 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N9XYB0-F1-model_v4 deleted 0.977 9 158
AF-A0A6S7GHD8-F1-model_v4 Dehydrogenase reductase SDR family member 7-like 0.976 66 193 GO:0016491
AF-A0A2V8G497-F1-model_v4 Short-chain dehydrogenase 0.9718 15 168
AF-A0A1A2N6M4-F1-model_v4 Dehydrogenase 0.9712 7 196 GO:0016491
AF-A0A848T5Q6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9692 7 193 GO:0016491

Map