F420532

General Info

Members Datasets Scaffolds Average Seq Length
356 182 356 203

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10230461|Ga0207674_102304612
Length 223
Sequence VTAPGVIGRRPGTLRAVALVRDFPLFPLGLVALPSELVPLHIFEERYKTMMARVLEEEGEFGIVWVADDGLRPVGCACEVAEVLERMPDGRLNLVARGTRPFRIESRQDELPYPAGVVEFLADRDEEPDPAAAEDAHAAYAKLVEQATDRTPDADEIGGMSAYEMAATVEFGLDAKQGLLDLRSEAARLKLVARLFRAALKRLDFVERAQARARSNGKVNFSG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
125 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 10.96
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100085010 3300005329 Bacteria 2965
2 Ga0070683_100834633 3300005329 Bacteria 884
3 Ga0070682_100293166 3300005337 Bacteria 1191
4 Ga0070682_100449203 3300005337 Bacteria 987
5 Ga0068868_100318713 3300005338 Bacteria 1324
6 Ga0070661_100551009 3300005344 Bacteria 928
7 Ga0070661_100919059 3300005344 Bacteria 723
8 Ga0070692_10159876 3300005345 Bacteria 1290
9 Ga0070674_100072243 3300005356 Bacteria 2442
10 Ga0070659_100171767 3300005366 Bacteria 1776
11 Ga0070659_100417909 3300005366 Bacteria 1134
12 Ga0070659_100509168 3300005366 Bacteria 1027
13 Ga0070710_10096195 3300005437 Bacteria 1755
14 Ga0070701_10627849 3300005438 Bacteria 715
15 Ga0070700_100368381 3300005441 Bacteria 1070
16 Ga0070663_100563166 3300005455 Bacteria 954
17 Ga0070663_100660791 3300005455 Bacteria 885
18 Ga0070662_100794981 3300005457 Bacteria 804
19 Ga0070681_10300567 3300005458 Bacteria 1515
20 Ga0068867_100038345 3300005459 Bacteria 3488
21 Ga0070684_100209249 3300005535 Bacteria 1778
22 Ga0070684_100311242 3300005535 Bacteria 1446
23 Ga0070684_100358179 3300005535 Bacteria 1342
24 Ga0070684_100475231 3300005535 Bacteria 1156
25 Ga0070693_100214496 3300005547 Bacteria 1258
26 Ga0070665_100027761 3300005548 Bacteria 5699
27 Ga0070704_100242369 3300005549 Bacteria 1476
28 Ga0070664_100621531 3300005564 Bacteria 1003
29 Ga0070664_100961904 3300005564 Bacteria 802
30 Ga0068854_100301923 3300005578 Bacteria 1295
31 Ga0068856_100279538 3300005614 Bacteria 1686
32 Ga0070702_100042290 3300005615 Bacteria 2561
33 Ga0068852_100129268 3300005616 Bacteria 2324
34 Ga0068852_100293808 3300005616 Bacteria 1571
35 Ga0068852_100354286 3300005616 Bacteria 1434
36 Ga0068866_10067930 3300005718 Bacteria 1873
37 Ga0068861_100674271 3300005719 Bacteria 958
38 Ga0068851_10255728 3300005834 Bacteria 995
39 Ga0068870_10194876 3300005840 Bacteria 1225
40 Ga0068870_10262172 3300005840 Bacteria 1076
41 Ga0068870_10507703 3300005840 Bacteria 805
42 Ga0068860_100056777 3300005843 Bacteria 3721
43 Ga0068860_100474000 3300005843 Bacteria 1247
44 Ga0068862_100514974 3300005844 Bacteria 1138
45 Ga0081538_10003686 3300005981 Bacteria 14382
46 Ga0081538_10007830 3300005981 Bacteria 9164
47 Ga0081538_10141617 3300005981 Bacteria 1108
48 Ga0081538_10187259 3300005981 Bacteria 875
49 Ga0081540_1066010 3300005983 Bacteria 1698
50 Ga0081539_10003556 3300005985 Bacteria 18927
51 Ga0081539_10004416 3300005985 Bacteria 15568
52 Ga0081539_10009480 3300005985 Bacteria 8122
53 Ga0081539_10161348 3300005985 Bacteria 1068
54 Ga0075365_10288927 3300006038 Bacteria 1154
55 Ga0070715_10167178 3300006163 Bacteria 1092
56 Ga0075428_100612481 3300006844 Bacteria 1163
57 Ga0075430_100001037 3300006846 Bacteria 21962
58 Ga0068865_100375668 3300006881 Bacteria 1158
59 Ga0068865_100502926 3300006881 Bacteria 1011
60 Ga0111539_10004843 3300009094 Bacteria 17539
61 Ga0111539_10967225 3300009094 Bacteria 990
62 Ga0105245_10086537 3300009098 Bacteria 2874
63 Ga0105245_10112395 3300009098 Bacteria 2535
64 Ga0105245_10779181 3300009098 Bacteria 993
65 Ga0114129_10463448 3300009147 Bacteria 1660
66 Ga0114129_10654696 3300009147 Bacteria 1355
67 Ga0105243_10030558 3300009148 Bacteria 4148
68 Ga0105243_10943498 3300009148 Bacteria 861
69 Ga0105243_11150476 3300009148 Bacteria 787
70 Ga0105243_11235949 3300009148 Bacteria 762
71 Ga0105248_10538623 3300009177 Bacteria 1317
72 Ga0105248_10856753 3300009177 Bacteria 1026
73 Ga0105237_10804438 3300009545 Bacteria 947
74 Ga0105238_10836559 3300009551 Bacteria 937
75 Ga0105249_10037294 3300009553 Bacteria 4411
76 Ga0105249_11247002 3300009553 Bacteria 815
77 Ga0105239_10192613 3300010375 Bacteria 2282
78 Ga0105239_10372527 3300010375 Bacteria 1614
79 Ga0105239_11047460 3300010375 Bacteria 938
80 Ga0105239_11179370 3300010375 Bacteria 882
81 Ga0157369_10377039 3300013105 Bacteria 1472
82 Ga0157369_11289736 3300013105 Bacteria 744
83 Ga0157378_11010884 3300013297 Bacteria 866
84 Ga0157372_10299505 3300013307 Bacteria 1870
85 Ga0157372_11306870 3300013307 Bacteria 837
86 Ga0157375_10608464 3300013308 Bacteria 1251
87 Ga0157375_11845147 3300013308 Bacteria 717
88 Ga0163163_10640963 3300014325 Bacteria 1126
89 Ga0163163_11069091 3300014325 Bacteria 870
90 Ga0163163_11257987 3300014325 Bacteria 802
91 Ga0157380_10582403 3300014326 Bacteria 1104
92 Ga0157380_11299151 3300014326 Bacteria 775
93 Ga0182008_10192680 3300014497 Bacteria 1035
94 Ga0182008_10337102 3300014497 Bacteria 797
95 Ga0157377_10334581 3300014745 Bacteria 1011
96 Ga0157379_10006791 3300014968 Bacteria 9891
97 Ga0163161_10442407 3300017792 Bacteria 1049
98 Ga0206354_11102392 3300020081 Bacteria 796
99 Ga0207426_1061222 3300025302 Bacteria 1082
100 Ga0207656_10242041 3300025321 Bacteria 882
101 Ga0207656_10313555 3300025321 Bacteria 778
102 Ga0207642_10360977 3300025899 Bacteria 860
103 Ga0207688_10082602 3300025901 Bacteria 1836
104 Ga0207688_10182077 3300025901 Bacteria 1253
105 Ga0207688_10322016 3300025901 Bacteria 949
106 Ga0207645_10196137 3300025907 Bacteria 1327
107 Ga0207645_10530731 3300025907 Bacteria 798
108 Ga0207643_10084573 3300025908 Bacteria 1842
109 Ga0207643_10257954 3300025908 Bacteria 1076
110 Ga0207707_10310456 3300025912 Bacteria 1363
111 Ga0207649_10082635 3300025920 Bacteria 2083
112 Ga0207649_10484065 3300025920 Bacteria 939
113 Ga0207652_10686162 3300025921 Bacteria 914
114 Ga0207687_10071675 3300025927 Bacteria 2476
115 Ga0207664_10277495 3300025929 Bacteria 1470
116 Ga0207690_10125159 3300025932 Bacteria 1873
117 Ga0207690_10328120 3300025932 Bacteria 1204
118 Ga0207706_10021883 3300025933 Bacteria 5739
119 Ga0207706_10078362 3300025933 Bacteria 2906
120 Ga0207706_10190737 3300025933 Bacteria 1799
121 Ga0207709_10383902 3300025935 Bacteria 1070
122 Ga0207669_10016686 3300025937 Bacteria 3740
123 Ga0207669_10285617 3300025937 Bacteria 1247
124 Ga0207704_10054640 3300025938 Bacteria 2436
125 Ga0207704_10205483 3300025938 Bacteria 1445
126 Ga0207704_10486958 3300025938 Bacteria 991
127 Ga0207691_10187168 3300025940 Bacteria 1807
128 Ga0207691_10363055 3300025940 Bacteria 1238
129 Ga0207689_10315947 3300025942 Bacteria 1296
130 Ga0207661_10187925 3300025944 Bacteria 1809
131 Ga0207661_10347332 3300025944 Bacteria 1338
132 Ga0207661_10602165 3300025944 Bacteria 1009
133 Ga0207679_10359839 3300025945 Bacteria 1271
134 Ga0207712_10091368 3300025961 Bacteria 2242
135 Ga0207668_10242980 3300025972 Bacteria 1458
136 Ga0207668_10296841 3300025972 Bacteria 1332
137 Ga0207640_10286737 3300025981 Bacteria 1296
138 Ga0207677_10296817 3300026023 Bacteria 1333
139 Ga0207703_10545438 3300026035 Bacteria 1093
140 Ga0207639_10478031 3300026041 Bacteria 1135
141 Ga0207678_10122584 3300026067 Bacteria 2218
142 Ga0207678_10161145 3300026067 Bacteria 1916
143 Ga0207678_10211856 3300026067 Bacteria 1658
144 Ga0207708_10002231 3300026075 Bacteria 14290
145 Ga0207708_10010453 3300026075 Bacteria 6891
146 Ga0207708_10901323 3300026075 Bacteria 765
147 Ga0207648_10076114 3300026089 Bacteria 2925
148 Ga0207648_10372704 3300026089 Bacteria 1290
149 Ga0207648_10609048 3300026089 Bacteria 1007
150 Ga0207676_10096969 3300026095 Bacteria 2435
151 Ga0207674_10230461 3300026116 Bacteria 1800
152 Ga0207675_100028152 3300026118 Bacteria 5232
153 Ga0207675_100053288 3300026118 Bacteria 3775
154 Ga0207675_100209783 3300026118 Bacteria 1873
155 Ga0207675_100451586 3300026118 Bacteria 1274
156 Ga0207683_10181066 3300026121 Bacteria 1911
157 Ga0207698_10101993 3300026142 Bacteria 2381
158 Ga0207698_10109003 3300026142 Bacteria 2316
159 Ga0207698_10421041 3300026142 Bacteria 1281
160 Ga0207428_10570023 3300027907 Bacteria 818
161 Ga0268266_10047294 3300028379 Bacteria 3685
162 Ga0268266_10377964 3300028379 Bacteria 1336
163 Ga0268265_10354994 3300028380 Bacteria 1340
164 Ga0268264_10428695 3300028381 Bacteria 1277
165 Ga0268264_10596607 3300028381 Bacteria 1088
166 Ga0268264_10955018 3300028381 Bacteria 862
167 Ga0265326_10000017 3300028558 Bacteria 152436
168 Ga0265319_1015970 3300028563 Bacteria 2887
169 Ga0265334_10000029 3300028573 Bacteria 114485
170 Ga0265334_10099965 3300028573 Bacteria 1051
171 Ga0265318_10009783 3300028577 Bacteria 4202
172 Ga0265336_10002890 3300028666 Bacteria 6909
173 Ga0265338_10002711 3300028800 Bacteria 25983
174 Ga0265338_10026230 3300028800 Bacteria 5885
175 Ga0265338_10186715 3300028800 Bacteria 1575
176 Ga0265324_10001650 3300029957 Bacteria 12336
177 Ga0265320_10011368 3300031240 Bacteria 5243
178 Ga0265316_10067817 3300031344 Bacteria 2758
179 Ga0307405_10193806 3300031731 Bacteria 1470
180 Ga0307405_10304767 3300031731 Bacteria 1210
181 Ga0307405_10361041 3300031731 Bacteria 1124
182 Ga0307405_10673200 3300031731 Unclassified 854
183 Ga0307413_10095219 3300031824 Bacteria 1951
184 Ga0307413_10192959 3300031824 Bacteria 1464
185 Ga0307413_10606947 3300031824 Bacteria 896
186 Ga0307410_10200474 3300031852 Bacteria 1523
187 Ga0307410_10387303 3300031852 Unclassified 1126
188 Ga0307410_10402148 3300031852 Bacteria 1107
189 Ga0307410_10429815 3300031852 Bacteria 1073
190 Ga0307406_10057147 3300031901 Bacteria 2502
191 Ga0307406_10102101 3300031901 Bacteria 1956
192 Ga0307406_10118081 3300031901 Bacteria 1838
193 Ga0307406_10158188 3300031901 Bacteria 1625
194 Ga0307406_10298572 3300031901 Bacteria 1236
195 Ga0307406_10349887 3300031901 Bacteria 1154
196 Ga0307406_10389496 3300031901 Bacteria 1101
197 Ga0307406_10649422 3300031901 Bacteria 875
198 Ga0307406_10762229 3300031901 Bacteria 813
199 Ga0307406_10823887 3300031901 Bacteria 785
200 Ga0307407_10014583 3300031903 Bacteria 3855
201 Ga0307407_10046766 3300031903 Bacteria 2452
202 Ga0307407_10159936 3300031903 Bacteria 1473
203 Ga0307407_10215929 3300031903 Bacteria 1294
204 Ga0307407_10313656 3300031903 Bacteria 1098
205 Ga0307412_10352057 3300031911 Bacteria 1183
206 Ga0307412_10451894 3300031911 Bacteria 1059
207 Ga0307412_10683458 3300031911 Bacteria 879
208 Ga0307409_100093132 3300031995 Bacteria 2475
209 Ga0307409_100102407 3300031995 Bacteria 2379
210 Ga0307409_100187791 3300031995 Bacteria 1836
211 Ga0307409_100232077 3300031995 Bacteria 1673
212 Ga0307409_100247640 3300031995 Bacteria 1627
213 Ga0307409_100458997 3300031995 Bacteria 1231
214 Ga0307409_100568129 3300031995 Bacteria 1116
215 Ga0307409_100593657 3300031995 Bacteria 1093
216 Ga0307409_100844720 3300031995 Bacteria 926
217 Ga0307409_100904682 3300031995 Bacteria 896
218 Ga0307409_101056754 3300031995 Bacteria 832
219 Ga0307416_100031015 3300032002 Bacteria 4019
220 Ga0307416_100050738 3300032002 Bacteria 3309
221 Ga0307416_100671211 3300032002 Bacteria 1123
222 Ga0307416_101318617 3300032002 Bacteria 828
223 Ga0307414_10200956 3300032004 Bacteria 1621
224 Ga0307411_10138886 3300032005 Bacteria 1789
225 Ga0307411_10255202 3300032005 Bacteria 1381
226 Ga0307415_100017229 3300032126 Bacteria 4326
227 Ga0307415_100058000 3300032126 Bacteria 2664
228 Ga0307415_100068775 3300032126 Bacteria 2480
229 Ga0307415_100560863 3300032126 Bacteria 1010
230 Ga0307415_100724259 3300032126 Bacteria 900
231 Ga0307415_100859250 3300032126 Bacteria 833
232 Ga0395899_0030920 3300037312 Bacteria 4026
233 Ga0395898_0040944 3300037466 Bacteria 4578
234 Ga0395898_0458938 3300037466 Bacteria 1213
235 Ga0395898_1215806 3300037466 Bacteria 684
236 Ga0395905_0205890 3300037471 Bacteria 1844
237 Ga0395905_0357516 3300037471 Bacteria 1353
238 Ga0395901_0003958 3300038443 Bacteria 14901
239 Ga0395901_0147151 3300038443 Bacteria 2476
240 Ga0395901_0938242 3300038443 Bacteria 845
241 Ga0395901_1314513 3300038443 Bacteria 684
242 Ga0436365_0370748 3300039437 Bacteria 2108
243 Ga0436362_1288705 3300039453 Bacteria 4784
244 Ga0451791_0071111 3300041451 Bacteria 1530
245 Ga0451800_0232701 3300041459 Bacteria 911
246 Ga0451800_1441587 3300041459 Bacteria 978
247 Ga0451833_0722287 3300041491 Bacteria 1082
248 Ga0451845_0378153 3300041501 Bacteria 937
249 Ga0451853_3146289 3300041512 Bacteria 1276
250 Ga0439454_020990 3300042011 Bacteria 962
251 Ga0439464_0141869 3300042439 Bacteria 748
252 Ga0439460_0031926 3300042461 Bacteria 1505
253 Ga0439440_0040387 3300042993 Bacteria 1135
254 Ga0466972_0129866 3300044658 Bacteria 1187
255 Ga0466963_0016114 3300044694 Bacteria 4643
256 Ga0466963_0063212 3300044694 Bacteria 2477
257 Ga0466963_0468676 3300044694 Bacteria 889
258 Ga0466964_0121708 3300044706 Bacteria 1177
259 Ga0466971_0111199 3300044719 Bacteria 1264
260 Ga0466957_0065429 3300044842 Bacteria 2239
261 Ga0466957_0116337 3300044842 Bacteria 1701
262 Ga0466960_0000074 3300044901 Bacteria 32503
263 Ga0466960_0163300 3300044901 Bacteria 1197
264 Ga0466960_0329212 3300044901 Bacteria 867
265 Ga0466958_0198558 3300045836 Bacteria 1276
266 Ga0466958_0321312 3300045836 Unclassified 995
267 Ga0466958_0365504 3300045836 Bacteria 930
268 Ga0466967_0015672 3300045976 Bacteria 5951
269 Ga0466967_0017504 3300045976 Bacteria 5693
270 Ga0466967_0040498 3300045976 Bacteria 4011
271 Ga0466967_0040908 3300045976 Bacteria 3993
272 Ga0466967_0089329 3300045976 Bacteria 2797
273 Ga0466967_0120271 3300045976 Bacteria 2425
274 Ga0466967_0187078 3300045976 Bacteria 1956
275 Ga0466967_0320090 3300045976 Bacteria 1495
276 Ga0466967_0553180 3300045976 Bacteria 1133
277 Ga0466967_0772528 3300045976 Bacteria 953
278 Ga0466967_0954416 3300045976 Bacteria 853
279 Ga0466967_1027602 3300045976 Bacteria 821
280 Ga0466967_1058996 3300045976 Bacteria 808
281 Ga0495641_0078071 3300046461 Bacteria 1484
282 Ga0495650_0000055 3300046471 Bacteria 308438
283 Ga0495670_0260391 3300046691 Bacteria 926
284 Ga0496100_0024515 3300048903 Bacteria 3680
285 Ga0496101_0009400 3300048904 Bacteria 6425
286 Ga0496101_0536131 3300048904 Bacteria 925
287 Ga0496102_0053344 3300048905 Bacteria 3686
288 Ga0496102_0152798 3300048905 Bacteria 2170
289 Ga0496102_0897427 3300048905 Bacteria 808
290 Ga0496103_0244830 3300048906 Bacteria 1154
291 Ga0496104_0008125 3300048907 Bacteria 9314
292 Ga0496104_0929216 3300048907 Bacteria 775
293 Ga0496105_0010621 3300048908 Bacteria 7244
294 Ga0496105_0320441 3300048908 Bacteria 1242
295 Ga0496106_0002408 3300048909 Bacteria 13934
296 Ga0496106_0407304 3300048909 Bacteria 1093
297 Ga0496107_0069260 3300048910 Bacteria 2560
298 Ga0496107_0620797 3300048910 Bacteria 798
299 Ga0496108_0125408 3300048911 Bacteria 2204
300 Ga0496108_0419671 3300048911 Bacteria 1168
301 Ga0496109_0101718 3300048912 Bacteria 2667
302 Ga0496109_0778612 3300048912 Bacteria 895
303 Ga0496109_0918532 3300048912 Bacteria 813
304 Ga0496110_0297085 3300048913 Bacteria 1471
305 Ga0496110_1040682 3300048913 Bacteria 726
306 Ga0496111_0101156 3300048914 Bacteria 2118
307 Ga0496111_0314314 3300048914 Bacteria 1160
308 Ga0496112_0022028 3300048915 Bacteria 6066
309 Ga0496112_0032658 3300048915 Bacteria 5054
310 Ga0496112_0070514 3300048915 Bacteria 3454
311 Ga0496112_0077871 3300048915 Bacteria 3279
312 Ga0496112_0148936 3300048915 Bacteria 2308
313 Ga0496112_0349348 3300048915 Bacteria 1421
314 Ga0496112_0504127 3300048915 Bacteria 1146
315 Ga0496113_0552124 3300048916 Bacteria 924
316 Ga0496113_0801870 3300048916 Bacteria 748
317 Ga0496114_0316212 3300048917 Bacteria 1379
318 Ga0496114_0436030 3300048917 Bacteria 1160
319 Ga0496115_0013381 3300048918 Bacteria 6206
320 Ga0496121_0105624 3300048924 Bacteria 2161
321 Ga0501031_0087022 3300049568 Bacteria 2037
322 Ga0501034_0049288 3300049571 Bacteria 4250
323 Ga0501036_0092642 3300049572 Bacteria 2553
324 Ga0501036_0678534 3300049572 Bacteria 852
325 Ga0501038_0164187 3300049574 Bacteria 1803
326 Ga0501038_0280126 3300049574 Bacteria 1313
327 Ga0501039_0040397 3300049575 Bacteria 3601
328 Ga0501039_0542736 3300049575 Bacteria 912
329 Ga0501039_0631257 3300049575 Bacteria 839
330 Ga0501040_0307933 3300049576 Bacteria 1132
331 Ga0501042_0287054 3300049578 Bacteria 1188
332 Ga0501048_0101516 3300049582 Bacteria 2030
333 Ga0501067_0137210 3300049583 Bacteria 1362
334 Ga0501067_0370408 3300049583 Bacteria 799
335 Ga0501072_0038600 3300049588 Bacteria 3748
336 Ga0501076_0139475 3300049592 Bacteria 1969
337 Ga0501076_0223279 3300049592 Bacteria 1540
338 Ga0501076_0730934 3300049592 Unclassified 817
339 Ga0501077_0337526 3300049593 Bacteria 961
340 Ga0501079_0289243 3300049741 Bacteria 1281
341 Ga0501081_0044055 3300049743 Bacteria 3062
342 Ga0501045_0141802 3300049824 Bacteria 1787
343 Ga0501045_0448104 3300049824 Bacteria 959
344 nmdc:mga05p37_729529_c1 3300050507 Bacteria 1096
345 nmdc:mga0qj67_1054_c1 3300050509 Bacteria 19072
346 nmdc:mga08y16_16382_c1 3300050511 Bacteria 7793
347 nmdc:mga08y16_425067_c1 3300050511 Bacteria 1357
348 nmdc:mga08y16_592343_c1 3300050511 Bacteria 1118
349 Ga0500556_0001959 3300053104 Bacteria 7271
350 Ga0500616_0017531 3300053153 Bacteria 4061
351 Ga0500616_0045224 3300053153 Bacteria 2346
352 Ga0500599_034018 3300053736 Bacteria 767
353 Ga0501082_0485856 3300060353 Bacteria 1079
354 Ga0466962_0048017 3300061719 Bacteria 2040
355 Ga0466962_0156324 3300061719 Bacteria 1107
356 Ga0530510_0011973 3300061734 Bacteria 6086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10299505 Ga0157372_102995053 157
2 3300044694 Ga0466963_0468676 Ga0466963_0468676_64_687 177
3 3300049572 Ga0501036_0092642 Ga0501036_0092642_1568_2191 177
4 3300049574 Ga0501038_0280126 Ga0501038_0280126_309_932 177
5 3300049575 Ga0501039_0542736 Ga0501039_0542736_56_679 177
6 3300049576 Ga0501040_0307933 Ga0501040_0307933_45_668 177
7 3300049578 Ga0501042_0287054 Ga0501042_0287054_228_851 177
8 3300049588 Ga0501072_0038600 Ga0501072_0038600_1334_1957 177
9 3300049592 Ga0501076_0139475 Ga0501076_0139475_515_1138 177
10 3300049593 Ga0501077_0337526 Ga0501077_0337526_281_904 177
11 3300049741 Ga0501079_0289243 Ga0501079_0289243_431_1054 177
12 3300049743 Ga0501081_0044055 Ga0501081_0044055_1011_1634 177
13 3300049824 Ga0501045_0448104 Ga0501045_0448104_310_933 177
14 3300060353 Ga0501082_0485856 Ga0501082_0485856_64_687 177
15 3300061734 Ga0530510_0011973 Ga0530510_0011973_93_716 177
16 3300031995 Ga0307409_100458997 Ga0307409_1004589972 178
17 3300045976 Ga0466967_1027602 Ga0466967_1027602_60_689 178
18 3300048907 Ga0496104_0008125 Ga0496104_0008125_3765_4382 179
19 3300048908 Ga0496105_0010621 Ga0496105_0010621_5967_6584 179
20 3300048911 Ga0496108_0125408 Ga0496108_0125408_285_902 179
21 3300031901 Ga0307406_10389496 Ga0307406_103894962 180
22 3300032002 Ga0307416_100050738 Ga0307416_1000507385 180
23 3300032002 Ga0307416_101318617 Ga0307416_1013186172 181
24 3300005843 Ga0068860_100474000 Ga0068860_1004740002 182
25 3300009094 Ga0111539_10967225 Ga0111539_109672251 182
26 3300028381 Ga0268264_10596607 Ga0268264_105966071 182
27 3300045976 Ga0466967_0954416 Ga0466967_0954416_142_765 184
28 3300049575 Ga0501039_0040397 Ga0501039_0040397_3033_3587 184
29 3300025901 Ga0207688_10322016 Ga0207688_103220162 185
30 3300048917 Ga0496114_0316212 Ga0496114_0316212_797_1357 185
31 3300005437 Ga0070710_10096195 Ga0070710_100961953 186
32 3300005459 Ga0068867_100038345 Ga0068867_1000383452 186
33 3300005719 Ga0068861_100674271 Ga0068861_1006742712 186
34 3300006163 Ga0070715_10167178 Ga0070715_101671781 186
35 3300025932 Ga0207690_10328120 Ga0207690_103281201 186
36 3300026075 Ga0207708_10002231 Ga0207708_1000223114 186
37 3300026089 Ga0207648_10076114 Ga0207648_100761142 186
38 3300026118 Ga0207675_100028152 Ga0207675_1000281522 186
39 3300031852 Ga0307410_10200474 Ga0307410_102004742 186
40 3300031901 Ga0307406_10102101 Ga0307406_101021011 186
41 3300031903 Ga0307407_10215929 Ga0307407_102159292 186
42 3300031911 Ga0307412_10683458 Ga0307412_106834581 186
43 3300031995 Ga0307409_100593657 Ga0307409_1005936571 186
44 3300032005 Ga0307411_10138886 Ga0307411_101388862 186
45 3300050511 nmdc:mga08y16_16382_c1 nmdc:mga08y16_16382_c1_876_1436 186
46 3300031901 Ga0307406_10349887 Ga0307406_103498872 187
47 3300031995 Ga0307409_100568129 Ga0307409_1005681292 187
48 3300045976 Ga0466967_0187078 Ga0466967_0187078_320_943 187
49 3300014325 Ga0163163_11257987 Ga0163163_112579872 188
50 3300045976 Ga0466967_0017504 Ga0466967_0017504_2937_3560 188
51 3300005441 Ga0070700_100368381 Ga0070700_1003683812 191
52 3300005455 Ga0070663_100660791 Ga0070663_1006607912 191
53 3300005547 Ga0070693_100214496 Ga0070693_1002144962 191
54 3300005564 Ga0070664_100961904 Ga0070664_1009619041 191
55 3300009148 Ga0105243_11150476 Ga0105243_111504761 191
56 3300009177 Ga0105248_10856753 Ga0105248_108567531 191
57 3300025933 Ga0207706_10078362 Ga0207706_100783622 191
58 3300025945 Ga0207679_10359839 Ga0207679_103598391 191
59 3300026075 Ga0207708_10901323 Ga0207708_109013231 191
60 3300026118 Ga0207675_100209783 Ga0207675_1002097833 191
61 3300028381 Ga0268264_10955018 Ga0268264_109550181 191
62 3300005344 Ga0070661_100919059 Ga0070661_1009190591 192
63 3300006881 Ga0068865_100502926 Ga0068865_1005029262 192
64 3300006038 Ga0075365_10288927 Ga0075365_102889272 193
65 3300048914 Ga0496111_0101156 Ga0496111_0101156_111_734 193
66 3300050507 nmdc:mga05p37_729529_c1 nmdc:mga05p37_729529_c1_351_932 193
67 3300050511 nmdc:mga08y16_592343_c1 nmdc:mga08y16_592343_c1_151_732 193
68 3300005344 Ga0070661_100551009 Ga0070661_1005510091 194
69 3300005366 Ga0070659_100171767 Ga0070659_1001717672 194
70 3300014745 Ga0157377_10334581 Ga0157377_103345812 194
71 3300025933 Ga0207706_10021883 Ga0207706_100218832 194
72 3300005564 Ga0070664_100621531 Ga0070664_1006215312 196
73 3300014326 Ga0157380_10582403 Ga0157380_105824032 196
74 3300025972 Ga0207668_10242980 Ga0207668_102429802 196
75 3300031911 Ga0307412_10451894 Ga0307412_104518942 196
76 3300045976 Ga0466967_0040908 Ga0466967_0040908_3228_3851 196
77 3300045976 Ga0466967_0120271 Ga0466967_0120271_1587_2210 196
78 3300025920 Ga0207649_10082635 Ga0207649_100826352 197
79 3300031731 Ga0307405_10673200 Ga0307405_106732001 201
80 3300031824 Ga0307413_10095219 Ga0307413_100952192 201
81 3300031852 Ga0307410_10387303 Ga0307410_103873032 201
82 3300031901 Ga0307406_10118081 Ga0307406_101180812 201
83 3300031901 Ga0307406_10298572 Ga0307406_102985722 201
84 3300031903 Ga0307407_10014583 Ga0307407_100145832 201
85 3300031903 Ga0307407_10159936 Ga0307407_101599362 201
86 3300031911 Ga0307412_10352057 Ga0307412_103520572 201
87 3300031995 Ga0307409_100187791 Ga0307409_1001877912 201
88 3300031995 Ga0307409_100232077 Ga0307409_1002320772 201
89 3300032002 Ga0307416_100031015 Ga0307416_1000310153 201
90 3300032004 Ga0307414_10200956 Ga0307414_102009562 201
91 3300032005 Ga0307411_10255202 Ga0307411_102552022 201
92 3300032126 Ga0307415_100058000 Ga0307415_1000580002 201
93 3300031903 Ga0307407_10046766 Ga0307407_100467662 202
94 3300031995 Ga0307409_100102407 Ga0307409_1001024072 202
95 3300005337 Ga0070682_100449203 Ga0070682_1004492032 203
96 3300005457 Ga0070662_100794981 Ga0070662_1007949811 203
97 3300005535 Ga0070684_100209249 Ga0070684_1002092492 203
98 3300005548 Ga0070665_100027761 Ga0070665_1000277613 203
99 3300005840 Ga0068870_10194876 Ga0068870_101948762 203
100 3300005981 Ga0081538_10003686 Ga0081538_100036865 203
101 3300005985 Ga0081539_10003556 Ga0081539_1000355624 203
102 3300005985 Ga0081539_10004416 Ga0081539_100044165 203
103 3300005985 Ga0081539_10009480 Ga0081539_100094809 203
104 3300006846 Ga0075430_100001037 Ga0075430_10000103719 203
105 3300009098 Ga0105245_10779181 Ga0105245_107791812 203
106 3300009147 Ga0114129_10654696 Ga0114129_106546962 203
107 3300009148 Ga0105243_11235949 Ga0105243_112359491 203
108 3300009177 Ga0105248_10538623 Ga0105248_105386232 203
109 3300009553 Ga0105249_10037294 Ga0105249_100372944 203
110 3300010375 Ga0105239_10372527 Ga0105239_103725272 203
111 3300010375 Ga0105239_11047460 Ga0105239_110474602 203
112 3300010375 Ga0105239_11179370 Ga0105239_111793701 203
113 3300013105 Ga0157369_11289736 Ga0157369_112897361 203
114 3300013297 Ga0157378_11010884 Ga0157378_110108841 203
115 3300014325 Ga0163163_10640963 Ga0163163_106409632 203
116 3300014968 Ga0157379_10006791 Ga0157379_100067914 203
117 3300017792 Ga0163161_10442407 Ga0163161_104424072 203
118 3300020081 Ga0206354_11102392 Ga0206354_111023921 203
119 3300025899 Ga0207642_10360977 Ga0207642_103609771 203
120 3300025901 Ga0207688_10082602 Ga0207688_100826022 203
121 3300025929 Ga0207664_10277495 Ga0207664_102774952 203
122 3300025933 Ga0207706_10190737 Ga0207706_101907372 203
123 3300025938 Ga0207704_10486958 Ga0207704_104869582 203
124 3300025944 Ga0207661_10602165 Ga0207661_106021652 203
125 3300025961 Ga0207712_10091368 Ga0207712_100913682 203
126 3300025972 Ga0207668_10296841 Ga0207668_102968411 203
127 3300026067 Ga0207678_10122584 Ga0207678_101225843 203
128 3300026067 Ga0207678_10211856 Ga0207678_102118562 203
129 3300026118 Ga0207675_100451586 Ga0207675_1004515862 203
130 3300028379 Ga0268266_10047294 Ga0268266_100472943 203
131 3300028558 Ga0265326_10000017 Ga0265326_1000001753 203
132 3300028563 Ga0265319_1015970 Ga0265319_10159702 203
133 3300028573 Ga0265334_10000029 Ga0265334_1000002921 203
134 3300028573 Ga0265334_10099965 Ga0265334_100999652 203
135 3300028577 Ga0265318_10009783 Ga0265318_100097834 203
136 3300028666 Ga0265336_10002890 Ga0265336_100028904 203
137 3300028800 Ga0265338_10002711 Ga0265338_1000271118 203
138 3300028800 Ga0265338_10026230 Ga0265338_100262303 203
139 3300028800 Ga0265338_10186715 Ga0265338_101867152 203
140 3300029957 Ga0265324_10001650 Ga0265324_100016502 203
141 3300031240 Ga0265320_10011368 Ga0265320_100113683 203
142 3300031344 Ga0265316_10067817 Ga0265316_100678173 203
143 3300031901 Ga0307406_10649422 Ga0307406_106494222 203
144 3300031995 Ga0307409_100904682 Ga0307409_1009046821 203
145 3300032126 Ga0307415_100068775 Ga0307415_1000687752 203
146 3300032126 Ga0307415_100560863 Ga0307415_1005608631 203
147 3300037312 Ga0395899_0030920 Ga0395899_0030920_1166_1786 203
148 3300037466 Ga0395898_0040944 Ga0395898_0040944_1941_2561 203
149 3300037466 Ga0395898_0458938 Ga0395898_0458938_575_1198 203
150 3300037466 Ga0395898_1215806 Ga0395898_1215806_17_634 203
151 3300037471 Ga0395905_0205890 Ga0395905_0205890_685_1305 203
152 3300037471 Ga0395905_0357516 Ga0395905_0357516_503_1126 203
153 3300038443 Ga0395901_0003958 Ga0395901_0003958_2097_2717 203
154 3300038443 Ga0395901_0147151 Ga0395901_0147151_1189_1812 203
155 3300038443 Ga0395901_0938242 Ga0395901_0938242_26_643 203
156 3300039437 Ga0436365_0370748 Ga0436365_0370748_1048_1674 203
157 3300039453 Ga0436362_1288705 Ga0436362_1288705_3710_4336 203
158 3300041451 Ga0451791_0071111 Ga0451791_0071111_42_662 203
159 3300041491 Ga0451833_0722287 Ga0451833_0722287_149_775 203
160 3300041501 Ga0451845_0378153 Ga0451845_0378153_32_649 203
161 3300041512 Ga0451853_3146289 Ga0451853_3146289_56_673 203
162 3300044901 Ga0466960_0000074 Ga0466960_0000074_14961_15584 203
163 3300044901 Ga0466960_0163300 Ga0466960_0163300_356_979 203
164 3300045836 Ga0466958_0365504 Ga0466958_0365504_160_780 203
165 3300045976 Ga0466967_0320090 Ga0466967_0320090_470_1090 203
166 3300045976 Ga0466967_0553180 Ga0466967_0553180_339_959 203
167 3300045976 Ga0466967_1058996 Ga0466967_1058996_169_792 203
168 3300046461 Ga0495641_0078071 Ga0495641_0078071_534_1154 203
169 3300046471 Ga0495650_0000055 Ga0495650_0000055_299377_300000 203
170 3300048903 Ga0496100_0024515 Ga0496100_0024515_2185_2811 203
171 3300048904 Ga0496101_0009400 Ga0496101_0009400_4080_4706 203
172 3300048904 Ga0496101_0536131 Ga0496101_0536131_38_661 203
173 3300048905 Ga0496102_0053344 Ga0496102_0053344_213_839 203
174 3300048905 Ga0496102_0152798 Ga0496102_0152798_199_819 203
175 3300048906 Ga0496103_0244830 Ga0496103_0244830_185_811 203
176 3300048908 Ga0496105_0320441 Ga0496105_0320441_62_679 203
177 3300048909 Ga0496106_0002408 Ga0496106_0002408_8459_9085 203
178 3300048910 Ga0496107_0069260 Ga0496107_0069260_1437_2063 203
179 3300048911 Ga0496108_0419671 Ga0496108_0419671_37_657 203
180 3300048912 Ga0496109_0101718 Ga0496109_0101718_2014_2634 203
181 3300048912 Ga0496109_0778612 Ga0496109_0778612_161_787 203
182 3300048912 Ga0496109_0918532 Ga0496109_0918532_34_660 203
183 3300048913 Ga0496110_0297085 Ga0496110_0297085_522_1142 203
184 3300048914 Ga0496111_0314314 Ga0496111_0314314_500_1120 203
185 3300048915 Ga0496112_0022028 Ga0496112_0022028_2038_2661 203
186 3300048915 Ga0496112_0032658 Ga0496112_0032658_4085_4702 203
187 3300048915 Ga0496112_0070514 Ga0496112_0070514_2405_3025 203
188 3300048915 Ga0496112_0077871 Ga0496112_0077871_2483_3100 203
189 3300048915 Ga0496112_0349348 Ga0496112_0349348_155_772 203
190 3300048915 Ga0496112_0504127 Ga0496112_0504127_398_1018 203
191 3300048916 Ga0496113_0801870 Ga0496113_0801870_100_717 203
192 3300048917 Ga0496114_0436030 Ga0496114_0436030_185_811 203
193 3300048918 Ga0496115_0013381 Ga0496115_0013381_1232_1858 203
194 3300048924 Ga0496121_0105624 Ga0496121_0105624_424_1047 203
195 3300049571 Ga0501034_0049288 Ga0501034_0049288_817_1440 203
196 3300049583 Ga0501067_0137210 Ga0501067_0137210_395_1015 203
197 3300049592 Ga0501076_0730934 Ga0501076_0730934_184_807 203
198 3300050509 nmdc:mga0qj67_1054_c1 nmdc:mga0qj67_1054_c1_15483_16106 203
199 3300053104 Ga0500556_0001959 Ga0500556_0001959_2192_2818 203
200 3300053153 Ga0500616_0017531 Ga0500616_0017531_1243_1869 203
201 3300053153 Ga0500616_0045224 Ga0500616_0045224_302_925 203
202 3300053736 Ga0500599_034018 Ga0500599_034018_87_713 203
203 3300005329 Ga0070683_100085010 Ga0070683_1000850103 204
204 3300005329 Ga0070683_100834633 Ga0070683_1008346332 204
205 3300005337 Ga0070682_100293166 Ga0070682_1002931662 204
206 3300005338 Ga0068868_100318713 Ga0068868_1003187132 204
207 3300005345 Ga0070692_10159876 Ga0070692_101598762 204
208 3300005356 Ga0070674_100072243 Ga0070674_1000722432 204
209 3300005366 Ga0070659_100417909 Ga0070659_1004179092 204
210 3300005366 Ga0070659_100509168 Ga0070659_1005091682 204
211 3300005438 Ga0070701_10627849 Ga0070701_106278491 204
212 3300005455 Ga0070663_100563166 Ga0070663_1005631661 204
213 3300005458 Ga0070681_10300567 Ga0070681_103005672 204
214 3300005535 Ga0070684_100311242 Ga0070684_1003112422 204
215 3300005535 Ga0070684_100358179 Ga0070684_1003581792 204
216 3300005535 Ga0070684_100475231 Ga0070684_1004752312 204
217 3300005549 Ga0070704_100242369 Ga0070704_1002423691 204
218 3300005578 Ga0068854_100301923 Ga0068854_1003019232 204
219 3300005614 Ga0068856_100279538 Ga0068856_1002795381 204
220 3300005615 Ga0070702_100042290 Ga0070702_1000422902 204
221 3300005616 Ga0068852_100129268 Ga0068852_1001292682 204
222 3300005616 Ga0068852_100293808 Ga0068852_1002938082 204
223 3300005616 Ga0068852_100354286 Ga0068852_1003542862 204
224 3300005718 Ga0068866_10067930 Ga0068866_100679302 204
225 3300005834 Ga0068851_10255728 Ga0068851_102557282 204
226 3300005840 Ga0068870_10262172 Ga0068870_102621722 204
227 3300005840 Ga0068870_10507703 Ga0068870_105077031 204
228 3300005843 Ga0068860_100056777 Ga0068860_1000567777 204
229 3300005844 Ga0068862_100514974 Ga0068862_1005149742 204
230 3300005981 Ga0081538_10007830 Ga0081538_100078303 204
231 3300005981 Ga0081538_10141617 Ga0081538_101416172 204
232 3300005981 Ga0081538_10187259 Ga0081538_101872592 204
233 3300005983 Ga0081540_1066010 Ga0081540_10660102 204
234 3300005985 Ga0081539_10161348 Ga0081539_101613482 204
235 3300006844 Ga0075428_100612481 Ga0075428_1006124811 204
236 3300006881 Ga0068865_100375668 Ga0068865_1003756681 204
237 3300009094 Ga0111539_10004843 Ga0111539_100048432 204
238 3300009098 Ga0105245_10086537 Ga0105245_100865372 204
239 3300009098 Ga0105245_10112395 Ga0105245_101123952 204
240 3300009147 Ga0114129_10463448 Ga0114129_104634482 204
241 3300009148 Ga0105243_10030558 Ga0105243_100305582 204
242 3300009148 Ga0105243_10943498 Ga0105243_109434982 204
243 3300009545 Ga0105237_10804438 Ga0105237_108044382 204
244 3300009551 Ga0105238_10836559 Ga0105238_108365592 204
245 3300009553 Ga0105249_11247002 Ga0105249_112470021 204
246 3300010375 Ga0105239_10192613 Ga0105239_101926132 204
247 3300013105 Ga0157369_10377039 Ga0157369_103770392 204
248 3300013307 Ga0157372_11306870 Ga0157372_113068702 204
249 3300013308 Ga0157375_10608464 Ga0157375_106084642 204
250 3300013308 Ga0157375_11845147 Ga0157375_118451471 204
251 3300014325 Ga0163163_11069091 Ga0163163_110690911 204
252 3300014326 Ga0157380_11299151 Ga0157380_112991512 204
253 3300014497 Ga0182008_10192680 Ga0182008_101926801 204
254 3300014497 Ga0182008_10337102 Ga0182008_103371022 204
255 3300025302 Ga0207426_1061222 Ga0207426_10612222 204
256 3300025321 Ga0207656_10242041 Ga0207656_102420412 204
257 3300025321 Ga0207656_10313555 Ga0207656_103135552 204
258 3300025901 Ga0207688_10182077 Ga0207688_101820772 204
259 3300025907 Ga0207645_10196137 Ga0207645_101961372 204
260 3300025907 Ga0207645_10530731 Ga0207645_105307311 204
261 3300025908 Ga0207643_10084573 Ga0207643_100845732 204
262 3300025908 Ga0207643_10257954 Ga0207643_102579542 204
263 3300025912 Ga0207707_10310456 Ga0207707_103104562 204
264 3300025920 Ga0207649_10484065 Ga0207649_104840652 204
265 3300025921 Ga0207652_10686162 Ga0207652_106861621 204
266 3300025927 Ga0207687_10071675 Ga0207687_100716753 204
267 3300025932 Ga0207690_10125159 Ga0207690_101251592 204
268 3300025935 Ga0207709_10383902 Ga0207709_103839022 204
269 3300025937 Ga0207669_10016686 Ga0207669_100166862 204
270 3300025937 Ga0207669_10285617 Ga0207669_102856172 204
271 3300025938 Ga0207704_10054640 Ga0207704_100546405 204
272 3300025938 Ga0207704_10205483 Ga0207704_102054832 204
273 3300025940 Ga0207691_10187168 Ga0207691_101871682 204
274 3300025940 Ga0207691_10363055 Ga0207691_103630552 204
275 3300025942 Ga0207689_10315947 Ga0207689_103159472 204
276 3300025944 Ga0207661_10187925 Ga0207661_101879252 204
277 3300025944 Ga0207661_10347332 Ga0207661_103473321 204
278 3300025981 Ga0207640_10286737 Ga0207640_102867372 204
279 3300026023 Ga0207677_10296817 Ga0207677_102968172 204
280 3300026035 Ga0207703_10545438 Ga0207703_105454382 204
281 3300026041 Ga0207639_10478031 Ga0207639_104780312 204
282 3300026067 Ga0207678_10161145 Ga0207678_101611454 204
283 3300026075 Ga0207708_10010453 Ga0207708_100104537 204
284 3300026089 Ga0207648_10372704 Ga0207648_103727042 204
285 3300026089 Ga0207648_10609048 Ga0207648_106090482 204
286 3300026095 Ga0207676_10096969 Ga0207676_100969692 204
287 3300026116 Ga0207674_10230461 Ga0207674_102304612 204
288 3300026118 Ga0207675_100053288 Ga0207675_1000532882 204
289 3300026121 Ga0207683_10181066 Ga0207683_101810662 204
290 3300026142 Ga0207698_10101993 Ga0207698_101019933 204
291 3300026142 Ga0207698_10109003 Ga0207698_101090032 204
292 3300026142 Ga0207698_10421041 Ga0207698_104210412 204
293 3300027907 Ga0207428_10570023 Ga0207428_105700231 204
294 3300028379 Ga0268266_10377964 Ga0268266_103779642 204
295 3300028380 Ga0268265_10354994 Ga0268265_103549942 204
296 3300028381 Ga0268264_10428695 Ga0268264_104286951 204
297 3300031731 Ga0307405_10193806 Ga0307405_101938062 204
298 3300031731 Ga0307405_10304767 Ga0307405_103047672 204
299 3300031731 Ga0307405_10361041 Ga0307405_103610412 204
300 3300031824 Ga0307413_10192959 Ga0307413_101929593 204
301 3300031824 Ga0307413_10606947 Ga0307413_106069471 204
302 3300031852 Ga0307410_10402148 Ga0307410_104021481 204
303 3300031852 Ga0307410_10429815 Ga0307410_104298151 204
304 3300031901 Ga0307406_10057147 Ga0307406_100571474 204
305 3300031901 Ga0307406_10158188 Ga0307406_101581881 204
306 3300031901 Ga0307406_10762229 Ga0307406_107622292 204
307 3300031901 Ga0307406_10823887 Ga0307406_108238871 204
308 3300031903 Ga0307407_10313656 Ga0307407_103136562 204
309 3300031995 Ga0307409_100093132 Ga0307409_1000931323 204
310 3300031995 Ga0307409_100247640 Ga0307409_1002476402 204
311 3300031995 Ga0307409_100844720 Ga0307409_1008447202 204
312 3300031995 Ga0307409_101056754 Ga0307409_1010567541 204
313 3300032002 Ga0307416_100671211 Ga0307416_1006712111 204
314 3300032126 Ga0307415_100017229 Ga0307415_1000172295 204
315 3300032126 Ga0307415_100724259 Ga0307415_1007242592 204
316 3300032126 Ga0307415_100859250 Ga0307415_1008592502 204
317 3300038443 Ga0395901_1314513 Ga0395901_1314513_48_671 204
318 3300041459 Ga0451800_0232701 Ga0451800_0232701_67_723 204
319 3300041459 Ga0451800_1441587 Ga0451800_1441587_46_681 204
320 3300042011 Ga0439454_020990 Ga0439454_020990_317_940 204
321 3300042439 Ga0439464_0141869 Ga0439464_0141869_104_727 204
322 3300042461 Ga0439460_0031926 Ga0439460_0031926_351_1013 204
323 3300042993 Ga0439440_0040387 Ga0439440_0040387_138_761 204
324 3300044658 Ga0466972_0129866 Ga0466972_0129866_424_1047 204
325 3300044694 Ga0466963_0016114 Ga0466963_0016114_1509_2132 204
326 3300044694 Ga0466963_0063212 Ga0466963_0063212_1761_2384 204
327 3300044706 Ga0466964_0121708 Ga0466964_0121708_320_943 204
328 3300044719 Ga0466971_0111199 Ga0466971_0111199_170_793 204
329 3300044842 Ga0466957_0065429 Ga0466957_0065429_908_1531 204
330 3300044842 Ga0466957_0116337 Ga0466957_0116337_975_1598 204
331 3300044901 Ga0466960_0329212 Ga0466960_0329212_48_671 204
332 3300045836 Ga0466958_0198558 Ga0466958_0198558_378_1001 204
333 3300045836 Ga0466958_0321312 Ga0466958_0321312_37_660 204
334 3300045976 Ga0466967_0015672 Ga0466967_0015672_5016_5639 204
335 3300045976 Ga0466967_0040498 Ga0466967_0040498_3297_3920 204
336 3300045976 Ga0466967_0089329 Ga0466967_0089329_1483_2106 204
337 3300045976 Ga0466967_0772528 Ga0466967_0772528_318_941 204
338 3300046691 Ga0495670_0260391 Ga0495670_0260391_158_787 204
339 3300048905 Ga0496102_0897427 Ga0496102_0897427_85_708 204
340 3300048907 Ga0496104_0929216 Ga0496104_0929216_71_700 204
341 3300048909 Ga0496106_0407304 Ga0496106_0407304_186_809 204
342 3300048910 Ga0496107_0620797 Ga0496107_0620797_52_675 204
343 3300048913 Ga0496110_1040682 Ga0496110_1040682_27_650 204
344 3300048915 Ga0496112_0148936 Ga0496112_0148936_384_1007 204
345 3300048916 Ga0496113_0552124 Ga0496113_0552124_225_848 204
346 3300049568 Ga0501031_0087022 Ga0501031_0087022_656_1279 204
347 3300049572 Ga0501036_0678534 Ga0501036_0678534_107_730 204
348 3300049574 Ga0501038_0164187 Ga0501038_0164187_67_690 204
349 3300049575 Ga0501039_0631257 Ga0501039_0631257_17_640 204
350 3300049582 Ga0501048_0101516 Ga0501048_0101516_654_1277 204
351 3300049583 Ga0501067_0370408 Ga0501067_0370408_48_671 204
352 3300049592 Ga0501076_0223279 Ga0501076_0223279_381_1004 204
353 3300049824 Ga0501045_0141802 Ga0501045_0141802_738_1361 204
354 3300050511 nmdc:mga08y16_425067_c1 nmdc:mga08y16_425067_c1_610_1233 204
355 3300061719 Ga0466962_0048017 Ga0466962_0048017_1037_1660 204
356 3300061719 Ga0466962_0156324 Ga0466962_0156324_364_999 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

22

197

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ane-assembly1.cif.gz_D crystal structure of n-terminal domain of e.coli lon protease 0.8478 1 102
3ljc-assembly1.cif.gz_A crystal structure of lon n-terminal domain. 0.8433 3 197
7p6u-assembly1.cif.gz_C lon protease from thermus thermophilus 0.8148 1 197
7yux-assembly1.cif.gz_F mtalon-adp for the spiral oligomers of hexamer 0.8089 1 197
7p6u-assembly1.cif.gz_F lon protease from thermus thermophilus 0.8072 1 197
ID Description Score Start End Superfamily
af_I1K7N5_54_171_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9406 3 102 2.30.130.40
af_B4FM67_80_193_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9226 2 102 2.30.130.40
af_Q9VSB2_786_901_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9154 1 102 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9142 4 104 2.30.130.40
af_A0A2R8PXH8_356_472_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9086 2 102 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A7J9YZ51-F1-model_v4 Peptidase S16 0.9964 1 102
AF-A0A838D0U6-F1-model_v4 LON peptidase substrate-binding domain-containing protein 0.9947 1 190
AF-A0A6J4RR23-F1-model_v4 ATP-dependent protease La domain protein 0.9906 1 193 GO:0006508
GO:0008233
AF-A0A7Y5XXK5-F1-model_v4 Peptidase S16 0.9794 1 95
AF-A0A538K6X8-F1-model_v4 Peptidase S16 0.9674 1 204

Feature Viewer

pLDDT pTM Quality
93.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map