F420508

General Info

Members Datasets Scaffolds Average Seq Length
356 204 712 345

Family's Representative Sequence

Representative Sequence 3300020080|Ga0206350_10587735|Ga0206350_105877351
Length 374
Sequence MKRPLLLLLVAISCLVAGVATAAPAHHGPHGKRDQPHGKSANRTGFYVTHNLVSDQAGMADHVDSNLVNAWGLTALPGSPWWVADNGADVATVYTADGAAFPAGTPLVVQVPKAPTGAVANAGSSFVVSNGGASGAATFLFATEAGKILGWNRSVSPTQAMVAVDDSASGAVFKGLALASSSNGDELFATDFHNNRVDVFDGSFHDVTPAGSFSDPSVPAGFAPFGIQNIGGHIFVTYAKQDADRHDDVPGQGFGFVDEYDTNGKLLAHVAQQGQLNSPWGLALAPAGFGRFGGDLLVGNFGDGQINAFQQGPNGAFEHRGELRDVSGKSLTIDGLWSLQFGLGTANNGPTDTLFFTAGPDGEMHGLFGTIKAG

Samples

Sample ID Description Type Environment
1 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
131 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 1.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.83
Rhizosphere 90.17
Stem 0
Stem Tuber 0
Unclassified 10.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206350_10587735 3300020080 Bacteria 1359
2 ARcpr5yngRDRAFT_c001037 3300000043 Bacteria 3167
3 ARSoilOldRDRAFT_c000499 3300000044 Bacteria 4429
4 ARCol0yngRDRAFT_1001233 3300000652 Bacteria 2154
5 Ga0070683_100009987 3300005329 Bacteria 8140
6 Ga0070683_100013258 3300005329 Bacteria 7184
7 Ga0070683_100021337 3300005329 Bacteria 5779
8 Ga0070683_100161790 3300005329 Bacteria 2124
9 Ga0070680_100038463 3300005336 Bacteria 3869
10 Ga0070680_100085201 3300005336 Bacteria 2610
11 Ga0070682_100010541 3300005337 Bacteria 5246
12 Ga0070682_100156649 3300005337 Bacteria 1569
13 Ga0068868_100203148 3300005338 Bacteria 1653
14 Ga0070660_100046107 3300005339 Bacteria 3340
15 Ga0070660_100051799 3300005339 Bacteria 3162
16 Ga0070691_10007939 3300005341 Bacteria 4852
17 Ga0070661_100010837 3300005344 Bacteria 6346
18 Ga0070661_100029214 3300005344 Bacteria 3978
19 Ga0070692_10004143 3300005345 Bacteria 6001
20 Ga0070675_100413545 3300005354 Bacteria 1205
21 Ga0070673_100070178 3300005364 Bacteria 2811
22 Ga0070659_100029566 3300005366 Bacteria 4235
23 Ga0070659_100114789 3300005366 Bacteria 2176
24 Ga0070659_100230131 3300005366 Bacteria 1532
25 Ga0070709_10115781 3300005434 Bacteria 1809
26 Ga0070709_10186146 3300005434 Bacteria 1461
27 Ga0070714_100002525 3300005435 Bacteria 13493
28 Ga0070714_100012198 3300005435 Bacteria 6852
29 Ga0070713_100055145 3300005436 Bacteria 3301
30 Ga0070710_10041692 3300005437 Bacteria 2536
31 Ga0070710_10164704 3300005437 Unclassified 1377
32 Ga0070700_100131583 3300005441 Bacteria 1689
33 Ga0070678_100049871 3300005456 Bacteria 3024
34 Ga0070681_10019803 3300005458 Bacteria 6739
35 Ga0070681_10087337 3300005458 Bacteria 3072
36 Ga0070681_10096768 3300005458 Bacteria 2900
37 Ga0070706_100027143 3300005467 Bacteria 5268
38 Ga0070706_100162918 3300005467 Unclassified 2082
39 Ga0070707_100011203 3300005468 Bacteria 8357
40 Ga0070698_100377733 3300005471 Bacteria 1349
41 Ga0070699_100014277 3300005518 Bacteria 6829
42 Ga0070699_100095785 3300005518 Bacteria 2599
43 Ga0070679_100219763 3300005530 Unclassified 1861
44 Ga0070684_100045527 3300005535 Bacteria 3799
45 Ga0070684_100092120 3300005535 Bacteria 2697
46 Ga0070684_100097920 3300005535 Bacteria 2616
47 Ga0068853_100222779 3300005539 Unclassified 1723
48 Ga0068853_100267390 3300005539 Bacteria 1574
49 Ga0070672_100096287 3300005543 Bacteria 2395
50 Ga0070696_100179503 3300005546 Bacteria 1570
51 Ga0070693_100027969 3300005547 Bacteria 3062
52 Ga0070693_100152104 3300005547 Bacteria 1467
53 Ga0070665_100248325 3300005548 Bacteria 1780
54 Ga0070704_100012248 3300005549 Bacteria 5295
55 Ga0070704_100014842 3300005549 Bacteria 4874
56 Ga0070664_100012662 3300005564 Bacteria 6867
57 Ga0070664_100042140 3300005564 Bacteria 3853
58 Ga0068854_100235827 3300005578 Unclassified 1454
59 Ga0068856_100145845 3300005614 Bacteria 2375
60 Ga0068856_100254585 3300005614 Unclassified 1771
61 Ga0070702_100200360 3300005615 Bacteria 1321
62 Ga0068852_100053502 3300005616 Bacteria 3475
63 Ga0081455_10015167 3300005937 Bacteria 7500
64 Ga0081455_10015983 3300005937 Bacteria 7263
65 Ga0081455_10035329 3300005937 Bacteria 4469
66 Ga0081455_10069986 3300005937 Unclassified 2914
67 Ga0081540_1001344 3300005983 Bacteria 21413
68 Ga0081540_1017530 3300005983 Bacteria 4429
69 Ga0081539_10001472 3300005985 Bacteria 39944
70 Ga0070717_10053123 3300006028 Bacteria 3339
71 Ga0070717_10087068 3300006028 Bacteria 2630
72 Ga0070712_100006446 3300006175 Bacteria 7276
73 Ga0070712_100027153 3300006175 Bacteria 3820
74 Ga0068871_100207754 3300006358 Bacteria 1693
75 Ga0075428_100008395 3300006844 Bacteria 11450
76 Ga0075428_100385020 3300006844 Bacteria 1503
77 Ga0075431_100097528 3300006847 Bacteria 3035
78 Ga0075433_10036401 3300006852 Bacteria 4240
79 Ga0075433_10058099 3300006852 Bacteria 3382
80 Ga0075433_10070726 3300006852 Bacteria 3067
81 Ga0075434_100004678 3300006871 Bacteria 12368
82 Ga0075434_100082697 3300006871 Bacteria 3208
83 Ga0075434_100109260 3300006871 Bacteria 2776
84 Ga0075434_100165937 3300006871 Bacteria 2228
85 Ga0075429_100015573 3300006880 Bacteria 6589
86 Ga0068865_100073529 3300006881 Bacteria 2431
87 Ga0075436_100041133 3300006914 Bacteria 3189
88 Ga0075435_100007055 3300007076 Bacteria 7977
89 Ga0111539_10043187 3300009094 Bacteria 5405
90 Ga0111539_10268657 3300009094 Bacteria 1985
91 Ga0105245_10014409 3300009098 Bacteria 6888
92 Ga0105245_10024346 3300009098 Bacteria 5314
93 Ga0114129_10025458 3300009147 Bacteria 8386
94 Ga0114129_10083861 3300009147 Bacteria 4425
95 Ga0105243_10056367 3300009148 Bacteria 3125
96 Ga0105243_10100234 3300009148 Unclassified 2403
97 Ga0105243_10161705 3300009148 Unclassified 1931
98 Ga0105241_10123402 3300009174 Bacteria 2089
99 Ga0105242_10046796 3300009176 Bacteria 3511
100 Ga0105238_10009364 3300009551 Bacteria 9807
101 Ga0105238_10245739 3300009551 Bacteria 1767
102 Ga0105239_10039728 3300010375 Bacteria 5155
103 Ga0105239_10041772 3300010375 Bacteria 5025
104 Ga0105239_10107964 3300010375 Bacteria 3084
105 Ga0105239_10479480 3300010375 Bacteria 1413
106 Ga0105246_10201035 3300011119 Bacteria 1549
107 Ga0157371_10152568 3300013102 Bacteria 1648
108 Ga0157370_10182276 3300013104 Bacteria 1951
109 Ga0157369_10007795 3300013105 Bacteria 12321
110 Ga0157369_10056879 3300013105 Bacteria 4220
111 Ga0157374_10049154 3300013296 Bacteria 3917
112 Ga0157374_10102959 3300013296 Bacteria 2739
113 Ga0157372_10056411 3300013307 Bacteria 4389
114 Ga0157372_10256797 3300013307 Bacteria 2029
115 Ga0157375_10109868 3300013308 Bacteria 2854
116 Ga0157375_10159579 3300013308 Bacteria 2396
117 Ga0157375_10330146 3300013308 Bacteria 1690
118 Ga0157377_10071207 3300014745 Bacteria 2010
119 Ga0157376_10026260 3300014969 Bacteria 4599
120 Ga0197907_11398177 3300020069 Bacteria 1309
121 Ga0206356_10362365 3300020070 Unclassified 1184
122 Ga0224712_10033574 3300022467 Bacteria 1879
123 Ga0207688_10019260 3300025901 Bacteria 3716
124 Ga0207688_10041340 3300025901 Bacteria 2564
125 Ga0207688_10087508 3300025901 Bacteria 1786
126 Ga0207699_10090952 3300025906 Bacteria 1915
127 Ga0207643_10100659 3300025908 Bacteria 1695
128 Ga0207684_10003373 3300025910 Bacteria 15641
129 Ga0207707_10029716 3300025912 Bacteria 4779
130 Ga0207707_10118541 3300025912 Bacteria 2313
131 Ga0207693_10003685 3300025915 Bacteria 13076
132 Ga0207693_10009718 3300025915 Bacteria 7831
133 Ga0207693_10016436 3300025915 Bacteria 5913
134 Ga0207663_10009050 3300025916 Bacteria 5245
135 Ga0207657_10092098 3300025919 Bacteria 2526
136 Ga0207657_10158932 3300025919 Bacteria 1837
137 Ga0207652_10130920 3300025921 Unclassified 2237
138 Ga0207646_10073419 3300025922 Unclassified 3056
139 Ga0207694_10079206 3300025924 Bacteria 2577
140 Ga0207694_10236661 3300025924 Bacteria 1492
141 Ga0207659_10301287 3300025926 Unclassified 1317
142 Ga0207687_10028303 3300025927 Bacteria 3765
143 Ga0207687_10041008 3300025927 Bacteria 3176
144 Ga0207687_10130073 3300025927 Bacteria 1896
145 Ga0207700_10000006 3300025928 Bacteria 348187
146 Ga0207700_10167118 3300025928 Bacteria 1832
147 Ga0207664_10007813 3300025929 Bacteria 7429
148 Ga0207664_10032444 3300025929 Bacteria 4002
149 Ga0207664_10078403 3300025929 Bacteria 2679
150 Ga0207664_10288281 3300025929 Bacteria 1442
151 Ga0207690_10289948 3300025932 Bacteria 1277
152 Ga0207706_10048000 3300025933 Bacteria 3776
153 Ga0207706_10117055 3300025933 Bacteria 2344
154 Ga0207704_10123336 3300025938 Bacteria 1778
155 Ga0207665_10006848 3300025939 Bacteria 7543
156 Ga0207665_10070282 3300025939 Bacteria 2388
157 Ga0207691_10102642 3300025940 Bacteria 2551
158 Ga0207711_10562506 3300025941 Bacteria 1064
159 Ga0207689_10038921 3300025942 Bacteria 3937
160 Ga0207689_10109825 3300025942 Unclassified 2266
161 Ga0207661_10012236 3300025944 Bacteria 6233
162 Ga0207661_10023652 3300025944 Bacteria 4645
163 Ga0207661_10055021 3300025944 Bacteria 3190
164 Ga0207661_10105388 3300025944 Unclassified 2375
165 Ga0207661_10218923 3300025944 Bacteria 1682
166 Ga0207679_10054931 3300025945 Bacteria 2934
167 Ga0207667_10306120 3300025949 Bacteria 1623
168 Ga0207651_10010524 3300025960 Bacteria 5131
169 Ga0207712_10400970 3300025961 Bacteria 1153
170 Ga0207640_10199634 3300025981 Bacteria 1515
171 Ga0207677_10130477 3300026023 Unclassified 1907
172 Ga0207677_10180861 3300026023 Bacteria 1659
173 Ga0207639_10113635 3300026041 Unclassified 2212
174 Ga0207639_10122362 3300026041 Bacteria 2140
175 Ga0207708_10120296 3300026075 Bacteria 2046
176 Ga0207708_10126957 3300026075 Bacteria 1991
177 Ga0207702_10190517 3300026078 Unclassified 1894
178 Ga0207683_10012222 3300026121 Bacteria 7328
179 Ga0209966_1003602 3300027695 Bacteria 2609
180 Ga0207428_10001196 3300027907 Bacteria 27877
181 Ga0268266_10220076 3300028379 Bacteria 1745
182 Ga0307407_10049330 3300031903 Bacteria 2402
183 Ga0373940_0034635 3300035088 Bacteria 1363
184 Ga0373944_0011505 3300035089 Bacteria 2426
185 Ga0373939_0006969 3300035114 Bacteria 2735
186 Ga0373941_0000593 3300035115 Bacteria 7329
187 Ga0373945_0050461 3300035116 Unclassified 1529
188 Ga0373960_0009821 3300035121 Bacteria 2327
189 Ga0373960_0036468 3300035121 Bacteria 1401
190 Ga0373943_0006118 3300035170 Bacteria 5407
191 Ga0373955_0038742 3300035172 Bacteria 2542
192 Ga0373924_0021470 3300035410 Bacteria 2519
193 Ga0373931_0095238 3300035691 Bacteria 1665
194 Ga0373947_0018478 3300035725 Bacteria 4013
195 Ga0373937_0016919 3300036401 Bacteria 6484
196 Ga0373925_0035578 3300037068 Bacteria 3675
197 Ga0373925_0246645 3300037068 Bacteria 1432
198 Ga0395899_0005365 3300037312 Bacteria 9958
199 Ga0395899_0291134 3300037312 Unclassified 1108
200 Ga0395900_0010297 3300037418 Bacteria 9567
201 Ga0395900_0018054 3300037418 Bacteria 7201
202 Ga0395900_0317400 3300037418 Bacteria 1539
203 Ga0395898_0006659 3300037466 Bacteria 12323
204 Ga0395898_0012940 3300037466 Bacteria 8606
205 Ga0395898_0028345 3300037466 Bacteria 5612
206 Ga0395898_0368337 3300037466 Bacteria 1370
207 Ga0395905_0026891 3300037471 Bacteria 5426
208 Ga0395905_0124490 3300037471 Bacteria 2424
209 Ga0395905_0471023 3300037471 Unclassified 1155
210 Ga0395901_0001542 3300038443 Bacteria 23884
211 Ga0395901_0019695 3300038443 Bacteria 6898
212 Ga0395901_0116270 3300038443 Bacteria 2809
213 Ga0395901_0254557 3300038443 Bacteria 1829
214 Ga0395901_0268589 3300038443 Bacteria 1774
215 Ga0395901_0323842 3300038443 Bacteria 1594
216 Ga0439448_0009223 3300042005 Bacteria 2907
217 Ga0439455_0008615 3300042012 Bacteria 2191
218 Ga0439458_0018106 3300042157 Bacteria 1612
219 Ga0466965_0153946 3300044683 Bacteria 1203
220 Ga0466964_0009004 3300044706 Bacteria 3758
221 Ga0466964_0014596 3300044706 Bacteria 2987
222 Ga0466964_0014805 3300044706 Bacteria 2968
223 Ga0466957_0036524 3300044842 Bacteria 2954
224 Ga0466957_0061724 3300044842 Bacteria 2301
225 Ga0466967_0097527 3300045976 Bacteria 2683
226 Ga0466967_0201106 3300045976 Bacteria 1887
227 Ga0466967_0235531 3300045976 Bacteria 1744
228 Ga0495592_0018556 3300046454 Bacteria 5293
229 Ga0495603_0000065 3300046455 Bacteria 46432
230 Ga0495591_070494 3300046458 Bacteria 909
231 Ga0495641_0006525 3300046461 Bacteria 7538
232 Ga0495641_0010711 3300046461 Bacteria 5285
233 Ga0495641_0056774 3300046461 Bacteria 1774
234 Ga0495641_0091747 3300046461 Unclassified 1357
235 Ga0495651_0009320 3300046462 Bacteria 7535
236 Ga0495651_0139937 3300046462 Bacteria 1756
237 Ga0495653_0013990 3300046463 Bacteria 6543
238 Ga0495653_0245465 3300046463 Unclassified 1191
239 Ga0495582_0018976 3300046473 Bacteria 3763
240 Ga0495582_0027505 3300046473 Bacteria 3118
241 Ga0495582_0043349 3300046473 Bacteria 2478
242 Ga0495582_0058972 3300046473 Bacteria 2117
243 Ga0495662_0078591 3300046476 Bacteria 1603
244 Ga0495662_0153292 3300046476 Bacteria 1135
245 Ga0495664_0095051 3300046477 Unclassified 1794
246 Ga0495584_0045713 3300046491 Bacteria 2208
247 Ga0495594_0176533 3300046499 Bacteria 1216
248 Ga0495608_0005404 3300046511 Bacteria 9133
249 Ga0495608_0008075 3300046511 Bacteria 7398
250 Ga0495628_0156050 3300046516 Unclassified 1736
251 Ga0495628_0163080 3300046516 Bacteria 1693
252 Ga0495630_0032384 3300046517 Unclassified 3895
253 Ga0495630_0053455 3300046517 Bacteria 3024
254 Ga0495630_0106261 3300046517 Bacteria 2126
255 Ga0495586_0041596 3300046535 Bacteria 2475
256 Ga0495586_0045991 3300046535 Bacteria 2353
257 Ga0495586_0283083 3300046535 Unclassified 949
258 Ga0495609_0057317 3300046538 Bacteria 1725
259 Ga0495645_0189479 3300046543 Unclassified 1403
260 Ga0495667_0016760 3300046559 Bacteria 4949
261 Ga0495667_0043549 3300046559 Unclassified 2974
262 Ga0495635_0070470 3300046663 Bacteria 2396
263 Ga0495635_0119906 3300046663 Bacteria 1795
264 Ga0495588_0007132 3300046674 Bacteria 5067
265 Ga0495599_0040652 3300046678 Bacteria 2919
266 Ga0495599_0111026 3300046678 Unclassified 1708
267 Ga0495658_0011902 3300046683 Bacteria 4391
268 Ga0495613_0054918 3300046689 Bacteria 2928
269 Ga0495613_0055844 3300046689 Bacteria 2900
270 Ga0495613_0079332 3300046689 Bacteria 2387
271 Ga0495613_0178069 3300046689 Unclassified 1506
272 Ga0495624_0010981 3300046690 Bacteria 6236
273 Ga0495670_0075918 3300046691 Bacteria 1707
274 Ga0495600_0058061 3300046809 Bacteria 2528
275 Ga0495581_0071970 3300047315 Bacteria 2000
276 Ga0495674_0063574 3300047319 Bacteria 3210
277 Ga0495676_0000444 3300047321 Bacteria 33833
278 Ga0495676_0039947 3300047321 Bacteria 3879
279 Ga0495676_0165529 3300047321 Unclassified 1560
280 Ga0495680_0003633 3300047322 Bacteria 15069
281 Ga0495680_0062509 3300047322 Bacteria 2862
282 Ga0495675_0153280 3300047444 Unclassified 1423
283 Ga0495685_064766 3300047447 Unclassified 1229
284 Ga0495684_0017483 3300047471 Bacteria 5521
285 Ga0495684_0033304 3300047471 Bacteria 3953
286 Ga0495593_0120929 3300047673 Bacteria 1333
287 Ga0496101_0424587 3300048904 Bacteria 1048
288 Ga0496102_0391575 3300048905 Bacteria 1307
289 Ga0496104_0019766 3300048907 Bacteria 6166
290 Ga0496108_0006767 3300048911 Bacteria 9280
291 Ga0496108_0007649 3300048911 Bacteria 8747
292 Ga0496108_0011987 3300048911 Bacteria 7054
293 Ga0496108_0072799 3300048911 Bacteria 2901
294 Ga0496109_0026213 3300048912 Bacteria 5197
295 Ga0496109_0030463 3300048912 Bacteria 4835
296 Ga0496109_0126850 3300048912 Bacteria 2379
297 Ga0496109_0219315 3300048912 Bacteria 1789
298 Ga0496109_0441324 3300048912 Unclassified 1230
299 Ga0496109_0487781 3300048912 Unclassified 1163
300 Ga0496110_0010671 3300048913 Bacteria 7480
301 Ga0496110_0032157 3300048913 Bacteria 4529
302 Ga0496110_0035544 3300048913 Bacteria 4323
303 Ga0496110_0111643 3300048913 Bacteria 2458
304 Ga0496110_0158890 3300048913 Bacteria 2048
305 Ga0496110_0171425 3300048913 Bacteria 1969
306 Ga0496110_0214156 3300048913 Bacteria 1752
307 Ga0496111_0014820 3300048914 Bacteria 5336
308 Ga0496111_0047134 3300048914 Bacteria 3104
309 Ga0496111_0102590 3300048914 Bacteria 2103
310 Ga0496112_0000822 3300048915 Bacteria 22028
311 Ga0496112_0001601 3300048915 Bacteria 17507
312 Ga0496112_0302590 3300048915 Bacteria 1544
313 Ga0496113_0010709 3300048916 Bacteria 6075
314 Ga0496113_0130471 3300048916 Bacteria 1972
315 Ga0496113_0140614 3300048916 Bacteria 1899
316 Ga0496114_0027180 3300048917 Bacteria 4685
317 Ga0496114_0041743 3300048917 Bacteria 3802
318 Ga0496114_0212411 3300048917 Bacteria 1697
319 Ga0496115_0006335 3300048918 Bacteria 8665
320 Ga0496115_0026011 3300048918 Bacteria 4562
321 Ga0496115_0157010 3300048918 Bacteria 1879
322 Ga0501039_0007147 3300049575 Bacteria 8506
323 Ga0501042_0047265 3300049578 Bacteria 3069
324 Ga0501046_0224248 3300049580 Bacteria 1390
325 Ga0501048_0022666 3300049582 Bacteria 4591
326 Ga0501068_0155552 3300049584 Bacteria 1439
327 Ga0501069_0156328 3300049585 Bacteria 1312
328 Ga0501072_0052194 3300049588 Bacteria 3219
329 Ga0501075_0010319 3300049591 Bacteria 6564
330 Ga0501077_0043771 3300049593 Bacteria 2845
331 Ga0501081_0055356 3300049743 Bacteria 2741
332 Ga0501083_0075988 3300049744 Bacteria 2230
333 Ga0501045_0060233 3300049824 Bacteria 2782
334 nmdc:mga05p37_18776_c1 3300050507 Bacteria 8355
335 nmdc:mga05p37_55663_c1 3300050507 Bacteria 4868
336 nmdc:mga09592_33432_c1 3300050508 Bacteria 4292
337 nmdc:mga06r32_525163_c1 3300050510 Bacteria 1159
338 nmdc:mga08y16_190653_c1 3300050511 Bacteria 2126
339 nmdc:mga08y16_207463_c1 3300050511 Bacteria 2030
340 nmdc:mga08y16_30095_c1 3300050511 Bacteria 5716
341 nmdc:mga0n895_12638_c1 3300050512 Bacteria 7579
342 nmdc:mga0n895_289795_c1 3300050512 Bacteria 1660
343 nmdc:mga0rr50_236813_c1 3300050513 Bacteria 1512
344 nmdc:mga0rr50_9528_c1 3300050513 Bacteria 6111
345 nmdc:mga0a205_10453_c1 3300050515 Bacteria 8525
346 nmdc:mga0a205_372727_c1 3300050515 Bacteria 1293
347 nmdc:mga0a205_5900_c1 3300050515 Bacteria 11031
348 Ga0495601_0073456 3300053077 Bacteria 2186
349 Ga0495601_0136943 3300053077 Bacteria 1596
350 Ga0495595_0083506 3300053084 Bacteria 1525
351 Ga0495619_0074884 3300053085 Bacteria 2271
352 Ga0495619_0104678 3300053085 Bacteria 1929
353 Ga0495619_0320793 3300053085 Bacteria 1072
354 Ga0495619_0358529 3300053085 Unclassified 1008
355 Ga0501084_0041148 3300054114 Bacteria 3865
356 Ga0587114_006187 3300059655 Bacteria 1329
357 Ga0206350_10587735
358 ARcpr5yngRDRAFT_c001037
359 ARSoilOldRDRAFT_c000499
360 ARCol0yngRDRAFT_1001233
361 Ga0070683_100009987
362 Ga0070683_100013258
363 Ga0070683_100021337
364 Ga0070683_100161790
365 Ga0070680_100038463
366 Ga0070680_100085201
367 Ga0070682_100010541
368 Ga0070682_100156649
369 Ga0068868_100203148
370 Ga0070660_100046107
371 Ga0070660_100051799
372 Ga0070691_10007939
373 Ga0070661_100010837
374 Ga0070661_100029214
375 Ga0070692_10004143
376 Ga0070675_100413545
377 Ga0070673_100070178
378 Ga0070659_100029566
379 Ga0070659_100114789
380 Ga0070659_100230131
381 Ga0070709_10115781
382 Ga0070709_10186146
383 Ga0070714_100002525
384 Ga0070714_100012198
385 Ga0070713_100055145
386 Ga0070710_10041692
387 Ga0070710_10164704
388 Ga0070700_100131583
389 Ga0070678_100049871
390 Ga0070681_10019803
391 Ga0070681_10087337
392 Ga0070681_10096768
393 Ga0070706_100027143
394 Ga0070706_100162918
395 Ga0070707_100011203
396 Ga0070698_100377733
397 Ga0070699_100014277
398 Ga0070699_100095785
399 Ga0070679_100219763
400 Ga0070684_100045527
401 Ga0070684_100092120
402 Ga0070684_100097920
403 Ga0068853_100222779
404 Ga0068853_100267390
405 Ga0070672_100096287
406 Ga0070696_100179503
407 Ga0070693_100027969
408 Ga0070693_100152104
409 Ga0070665_100248325
410 Ga0070704_100012248
411 Ga0070704_100014842
412 Ga0070664_100012662
413 Ga0070664_100042140
414 Ga0068854_100235827
415 Ga0068856_100145845
416 Ga0068856_100254585
417 Ga0070702_100200360
418 Ga0068852_100053502
419 Ga0081455_10015167
420 Ga0081455_10015983
421 Ga0081455_10035329
422 Ga0081455_10069986
423 Ga0081540_1001344
424 Ga0081540_1017530
425 Ga0081539_10001472
426 Ga0070717_10053123
427 Ga0070717_10087068
428 Ga0070712_100006446
429 Ga0070712_100027153
430 Ga0068871_100207754
431 Ga0075428_100008395
432 Ga0075428_100385020
433 Ga0075431_100097528
434 Ga0075433_10036401
435 Ga0075433_10058099
436 Ga0075433_10070726
437 Ga0075434_100004678
438 Ga0075434_100082697
439 Ga0075434_100109260
440 Ga0075434_100165937
441 Ga0075429_100015573
442 Ga0068865_100073529
443 Ga0075436_100041133
444 Ga0075435_100007055
445 Ga0111539_10043187
446 Ga0111539_10268657
447 Ga0105245_10014409
448 Ga0105245_10024346
449 Ga0114129_10025458
450 Ga0114129_10083861
451 Ga0105243_10056367
452 Ga0105243_10100234
453 Ga0105243_10161705
454 Ga0105241_10123402
455 Ga0105242_10046796
456 Ga0105238_10009364
457 Ga0105238_10245739
458 Ga0105239_10039728
459 Ga0105239_10041772
460 Ga0105239_10107964
461 Ga0105239_10479480
462 Ga0105246_10201035
463 Ga0157371_10152568
464 Ga0157370_10182276
465 Ga0157369_10007795
466 Ga0157369_10056879
467 Ga0157374_10049154
468 Ga0157374_10102959
469 Ga0157372_10056411
470 Ga0157372_10256797
471 Ga0157375_10109868
472 Ga0157375_10159579
473 Ga0157375_10330146
474 Ga0157377_10071207
475 Ga0157376_10026260
476 Ga0197907_11398177
477 Ga0206356_10362365
478 Ga0224712_10033574
479 Ga0207688_10019260
480 Ga0207688_10041340
481 Ga0207688_10087508
482 Ga0207699_10090952
483 Ga0207643_10100659
484 Ga0207684_10003373
485 Ga0207707_10029716
486 Ga0207707_10118541
487 Ga0207693_10003685
488 Ga0207693_10009718
489 Ga0207693_10016436
490 Ga0207663_10009050
491 Ga0207657_10092098
492 Ga0207657_10158932
493 Ga0207652_10130920
494 Ga0207646_10073419
495 Ga0207694_10079206
496 Ga0207694_10236661
497 Ga0207659_10301287
498 Ga0207687_10028303
499 Ga0207687_10041008
500 Ga0207687_10130073
501 Ga0207700_10000006
502 Ga0207700_10167118
503 Ga0207664_10007813
504 Ga0207664_10032444
505 Ga0207664_10078403
506 Ga0207664_10288281
507 Ga0207690_10289948
508 Ga0207706_10048000
509 Ga0207706_10117055
510 Ga0207704_10123336
511 Ga0207665_10006848
512 Ga0207665_10070282
513 Ga0207691_10102642
514 Ga0207711_10562506
515 Ga0207689_10038921
516 Ga0207689_10109825
517 Ga0207661_10012236
518 Ga0207661_10023652
519 Ga0207661_10055021
520 Ga0207661_10105388
521 Ga0207661_10218923
522 Ga0207679_10054931
523 Ga0207667_10306120
524 Ga0207651_10010524
525 Ga0207712_10400970
526 Ga0207640_10199634
527 Ga0207677_10130477
528 Ga0207677_10180861
529 Ga0207639_10113635
530 Ga0207639_10122362
531 Ga0207708_10120296
532 Ga0207708_10126957
533 Ga0207702_10190517
534 Ga0207683_10012222
535 Ga0209966_1003602
536 Ga0207428_10001196
537 Ga0268266_10220076
538 Ga0307407_10049330
539 Ga0373940_0034635
540 Ga0373944_0011505
541 Ga0373939_0006969
542 Ga0373941_0000593
543 Ga0373945_0050461
544 Ga0373960_0009821
545 Ga0373960_0036468
546 Ga0373943_0006118
547 Ga0373955_0038742
548 Ga0373924_0021470
549 Ga0373931_0095238
550 Ga0373947_0018478
551 Ga0373937_0016919
552 Ga0373925_0035578
553 Ga0373925_0246645
554 Ga0395899_0005365
555 Ga0395899_0291134
556 Ga0395900_0010297
557 Ga0395900_0018054
558 Ga0395900_0317400
559 Ga0395898_0006659
560 Ga0395898_0012940
561 Ga0395898_0028345
562 Ga0395898_0368337
563 Ga0395905_0026891
564 Ga0395905_0124490
565 Ga0395905_0471023
566 Ga0395901_0001542
567 Ga0395901_0019695
568 Ga0395901_0116270
569 Ga0395901_0254557
570 Ga0395901_0268589
571 Ga0395901_0323842
572 Ga0439448_0009223
573 Ga0439455_0008615
574 Ga0439458_0018106
575 Ga0466965_0153946
576 Ga0466964_0009004
577 Ga0466964_0014596
578 Ga0466964_0014805
579 Ga0466957_0036524
580 Ga0466957_0061724
581 Ga0466967_0097527
582 Ga0466967_0201106
583 Ga0466967_0235531
584 Ga0495592_0018556
585 Ga0495603_0000065
586 Ga0495591_070494
587 Ga0495641_0006525
588 Ga0495641_0010711
589 Ga0495641_0056774
590 Ga0495641_0091747
591 Ga0495651_0009320
592 Ga0495651_0139937
593 Ga0495653_0013990
594 Ga0495653_0245465
595 Ga0495582_0018976
596 Ga0495582_0027505
597 Ga0495582_0043349
598 Ga0495582_0058972
599 Ga0495662_0078591
600 Ga0495662_0153292
601 Ga0495664_0095051
602 Ga0495584_0045713
603 Ga0495594_0176533
604 Ga0495608_0005404
605 Ga0495608_0008075
606 Ga0495628_0156050
607 Ga0495628_0163080
608 Ga0495630_0032384
609 Ga0495630_0053455
610 Ga0495630_0106261
611 Ga0495586_0041596
612 Ga0495586_0045991
613 Ga0495586_0283083
614 Ga0495609_0057317
615 Ga0495645_0189479
616 Ga0495667_0016760
617 Ga0495667_0043549
618 Ga0495635_0070470
619 Ga0495635_0119906
620 Ga0495588_0007132
621 Ga0495599_0040652
622 Ga0495599_0111026
623 Ga0495658_0011902
624 Ga0495613_0054918
625 Ga0495613_0055844
626 Ga0495613_0079332
627 Ga0495613_0178069
628 Ga0495624_0010981
629 Ga0495670_0075918
630 Ga0495600_0058061
631 Ga0495581_0071970
632 Ga0495674_0063574
633 Ga0495676_0000444
634 Ga0495676_0039947
635 Ga0495676_0165529
636 Ga0495680_0003633
637 Ga0495680_0062509
638 Ga0495675_0153280
639 Ga0495685_064766
640 Ga0495684_0017483
641 Ga0495684_0033304
642 Ga0495593_0120929
643 Ga0496101_0424587
644 Ga0496102_0391575
645 Ga0496104_0019766
646 Ga0496108_0006767
647 Ga0496108_0007649
648 Ga0496108_0011987
649 Ga0496108_0072799
650 Ga0496109_0026213
651 Ga0496109_0030463
652 Ga0496109_0126850
653 Ga0496109_0219315
654 Ga0496109_0441324
655 Ga0496109_0487781
656 Ga0496110_0010671
657 Ga0496110_0032157
658 Ga0496110_0035544
659 Ga0496110_0111643
660 Ga0496110_0158890
661 Ga0496110_0171425
662 Ga0496110_0214156
663 Ga0496111_0014820
664 Ga0496111_0047134
665 Ga0496111_0102590
666 Ga0496112_0000822
667 Ga0496112_0001601
668 Ga0496112_0302590
669 Ga0496113_0010709
670 Ga0496113_0130471
671 Ga0496113_0140614
672 Ga0496114_0027180
673 Ga0496114_0041743
674 Ga0496114_0212411
675 Ga0496115_0006335
676 Ga0496115_0026011
677 Ga0496115_0157010
678 Ga0501039_0007147
679 Ga0501042_0047265
680 Ga0501046_0224248
681 Ga0501048_0022666
682 Ga0501068_0155552
683 Ga0501069_0156328
684 Ga0501072_0052194
685 Ga0501075_0010319
686 Ga0501077_0043771
687 Ga0501081_0055356
688 Ga0501083_0075988
689 Ga0501045_0060233
690 nmdc:mga05p37_18776_c1
691 nmdc:mga05p37_55663_c1
692 nmdc:mga09592_33432_c1
693 nmdc:mga06r32_525163_c1
694 nmdc:mga08y16_190653_c1
695 nmdc:mga08y16_207463_c1
696 nmdc:mga08y16_30095_c1
697 nmdc:mga0n895_12638_c1
698 nmdc:mga0n895_289795_c1
699 nmdc:mga0rr50_236813_c1
700 nmdc:mga0rr50_9528_c1
701 nmdc:mga0a205_10453_c1
702 nmdc:mga0a205_372727_c1
703 nmdc:mga0a205_5900_c1
704 Ga0495601_0073456
705 Ga0495601_0136943
706 Ga0495595_0083506
707 Ga0495619_0074884
708 Ga0495619_0104678
709 Ga0495619_0320793
710 Ga0495619_0358529
711 Ga0501084_0041148
712 Ga0587114_006187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zpw-assembly2.cif.gz_D crystal structure of pizza6-tsk-tsh with silicotungstic acid (sta) polyoxometalate 0.7556 33 358
6qsd-assembly1.cif.gz_A crystal structure of pizza6s 0.7488 33 358
7zpw-assembly2.cif.gz_D crystal structure of pizza6-tsk-tsh with silicotungstic acid (sta) polyoxometalate 0.7395 33 358
6rli-assembly1.cif.gz_A the structure of the self-assembled 3fpizza6-sh crystal 0.7384 33 358
6qsd-assembly1.cif.gz_A crystal structure of pizza6s 0.7358 33 358
ID Description Score Start End Superfamily
af_Q79FU0_283_386_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7986 50 150 2.40.10.500
af_Q9VGE3_257_409_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7684 131 258 2.110.10.10
af_F1Q9A6_243_506_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7302 65 346 2.120.10.30
af_Q6VVB1_109_340_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7299 156 348 2.120.10.30
af_Q84W55_362_518_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7241 166 305 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A534JXD1-F1-model_v4 TIGR03118 family protein 0.9875 248 358
AF-A0A534KWZ3-F1-model_v4 TIGR03118 family protein 0.9846 219 360
AF-A0A536QXC9-F1-model_v4 TIGR03118 family protein 0.983 197 360
AF-A0A535IPU7-F1-model_v4 TIGR03118 family protein 0.9799 200 360
AF-A0A538D0J0-F1-model_v4 TIGR03118 family protein 0.9644 157 360

Map