F420481

General Info

Members Datasets Scaffolds Average Seq Length
356 197 356 211

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10049144|Ga0105242_100491442
Length 246
Sequence MDPFATDAPLNSSDTHPTQAEWERQWRSYGEAVAAHPPEPAVEGMRAKSFGEGYHPTVADRFGVWLSARQIHRHVRDFSGQRIGDFGCGFHAAFTRTLLDRVESAVLADVSLSPDLLVHPKVTAFQGPLPGLLPHLPSRTLDVILCISVLEHLWEPAQAIREFRRLLTPGGVCLLNVPSWRGKWFLEYSAFKLGLSPTDEMNDHKNYYDVKDLWPLLVRGGFRPSDIRCFQHKFGMNTFALCKAPQ

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 2.53
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10043717 3300003320 Bacteria 27020
2 rootH2_10268730 3300003320 Bacteria 1773
3 rootH1_10090693 3300003323 Bacteria 4356
4 Ga0070676_10104984 3300005328 Bacteria 1751
5 Ga0070683_100005683 3300005329 Bacteria 10414
6 Ga0070683_100482083 3300005329 Bacteria 1184
7 Ga0070683_100689977 3300005329 Bacteria 978
8 Ga0070690_100106931 3300005330 Bacteria 1862
9 Ga0070670_100131081 3300005331 Bacteria 2165
10 Ga0068869_100392499 3300005334 Bacteria 1140
11 Ga0070680_100394246 3300005336 Archaea 1180
12 Ga0070682_100008720 3300005337 Bacteria 5720
13 Ga0070682_100064225 3300005337 Bacteria 2330
14 Ga0070682_100172606 3300005337 Bacteria 1504
15 Ga0068868_100001607 3300005338 Bacteria 15410
16 Ga0068868_100114014 3300005338 Bacteria 2199
17 Ga0068868_100123602 3300005338 Unclassified 2112
18 Ga0068868_100412379 3300005338 Bacteria 1168
19 Ga0070689_100026979 3300005340 Bacteria 4328
20 Ga0070689_100148645 3300005340 Bacteria 1888
21 Ga0070691_10116663 3300005341 Unclassified 1340
22 Ga0070687_100010242 3300005343 Bacteria 4046
23 Ga0070687_100532142 3300005343 Bacteria 796
24 Ga0070661_100013729 3300005344 Bacteria 5690
25 Ga0070661_100560219 3300005344 Bacteria 920
26 Ga0070692_10117846 3300005345 Bacteria 1477
27 Ga0070668_100007661 3300005347 Bacteria 8013
28 Ga0070669_100008989 3300005353 Bacteria 7128
29 Ga0070675_100000944 3300005354 Bacteria 20701
30 Ga0070675_100164207 3300005354 Bacteria 1912
31 Ga0070675_100533767 3300005354 Bacteria 1060
32 Ga0070671_100092359 3300005355 Unclassified 2536
33 Ga0070674_100008437 3300005356 Bacteria 6136
34 Ga0070673_100006538 3300005364 Bacteria 7582
35 Ga0070673_100024674 3300005364 Bacteria 4413
36 Ga0070673_100082062 3300005364 Bacteria 2616
37 Ga0070673_100126236 3300005364 Bacteria 2141
38 Ga0070673_100232799 3300005364 Bacteria 1599
39 Ga0070688_100084546 3300005365 Bacteria 2061
40 Ga0070688_100329289 3300005365 Bacteria 1112
41 Ga0070688_100587541 3300005365 Unclassified 851
42 Ga0070667_100004849 3300005367 Bacteria 11270
43 Ga0070701_10059018 3300005438 Bacteria 2015
44 Ga0070700_100008584 3300005441 Bacteria 5567
45 Ga0070662_100128471 3300005457 Bacteria 1951
46 Ga0070681_10020780 3300005458 Bacteria 6577
47 Ga0070681_10039244 3300005458 Unclassified 4747
48 Ga0070681_10365992 3300005458 Archaea 1352
49 Ga0068867_100076877 3300005459 Bacteria 2507
50 Ga0070685_10114649 3300005466 Bacteria 1666
51 Ga0070685_10135824 3300005466 Unclassified 1543
52 Ga0070685_10422971 3300005466 Bacteria 927
53 Ga0070685_10434388 3300005466 Bacteria 916
54 Ga0070706_100332069 3300005467 Bacteria 1418
55 Ga0070707_100007182 3300005468 Bacteria 10331
56 Ga0070707_101176279 3300005468 Bacteria 733
57 Ga0070679_100186585 3300005530 Bacteria 2044
58 Ga0070679_100398812 3300005530 Archaea 1322
59 Ga0070684_100010583 3300005535 Bacteria 7313
60 Ga0070684_100021935 3300005535 Bacteria 5320
61 Ga0068853_100966842 3300005539 Bacteria 819
62 Ga0070672_100006737 3300005543 Bacteria 7747
63 Ga0070672_100102588 3300005543 Unclassified 2322
64 Ga0070672_100170770 3300005543 Bacteria 1808
65 Ga0070672_100523317 3300005543 Bacteria 1028
66 Ga0070686_100048663 3300005544 Bacteria 2686
67 Ga0070686_100056359 3300005544 Unclassified 2521
68 Ga0070686_100843285 3300005544 Unclassified 742
69 Ga0070665_100415652 3300005548 Bacteria 1354
70 Ga0070704_100196722 3300005549 Bacteria 1624
71 Ga0068855_100068790 3300005563 Bacteria 4121
72 Ga0068855_100111910 3300005563 Unclassified 3133
73 Ga0070664_100003782 3300005564 Bacteria 12209
74 Ga0068857_100013531 3300005577 Bacteria 7107
75 Ga0068856_100159739 3300005614 Bacteria 2264
76 Ga0068856_100164103 3300005614 Bacteria 2232
77 Ga0068856_100287168 3300005614 Bacteria 1662
78 Ga0070702_100337314 3300005615 Bacteria 1057
79 Ga0068859_100000313 3300005617 Bacteria 48465
80 Ga0068864_100167991 3300005618 Unclassified 1998
81 Ga0068864_100370971 3300005618 Bacteria 1354
82 Ga0068861_100062653 3300005719 Bacteria 2857
83 Ga0068851_10246501 3300005834 Unclassified 1012
84 Ga0068863_100052712 3300005841 Bacteria 3855
85 Ga0068863_100240732 3300005841 Bacteria 1746
86 Ga0068858_100058329 3300005842 Unclassified 3569
87 Ga0068858_100061771 3300005842 Bacteria 3464
88 Ga0068858_100139234 3300005842 Bacteria 2278
89 Ga0068860_100143653 3300005843 Bacteria 2295
90 Ga0068860_100152986 3300005843 Unclassified 2222
91 Ga0068860_100638186 3300005843 Bacteria 1072
92 Ga0068862_100935132 3300005844 Unclassified 854
93 Ga0081455_10008099 3300005937 Bacteria 10975
94 Ga0081455_10035326 3300005937 Archaea 4469
95 Ga0075432_10014968 3300006058 Bacteria 2644
96 Ga0075367_10264567 3300006178 Bacteria 1080
97 Ga0075369_10143701 3300006186 Unclassified 1089
98 Ga0097621_100070747 3300006237 Unclassified 2881
99 Ga0097621_100331755 3300006237 Unclassified 1349
100 Ga0097621_100344837 3300006237 Bacteria 1323
101 Ga0068871_100033245 3300006358 Bacteria 4083
102 Ga0068871_100110393 3300006358 Unclassified 2313
103 Ga0068871_100244535 3300006358 Unclassified 1561
104 Ga0068871_100405869 3300006358 Bacteria 1214
105 Ga0075428_100000584 3300006844 Bacteria 37247
106 Ga0075430_100002772 3300006846 Bacteria 14643
107 Ga0075431_100001654 3300006847 Bacteria 20885
108 Ga0075431_100848201 3300006847 Bacteria 885
109 Ga0075433_10174988 3300006852 Bacteria 1910
110 Ga0075434_100026221 3300006871 Bacteria 5708
111 Ga0075429_100001109 3300006880 Bacteria 21700
112 Ga0068865_100000979 3300006881 Bacteria 16334
113 Ga0068865_100209786 3300006881 Unclassified 1517
114 Ga0075436_100002926 3300006914 Bacteria 11709
115 Ga0097620_100000313 3300006931 Bacteria 48465
116 Ga0075435_100167812 3300007076 Bacteria 1851
117 Ga0105240_10049232 3300009093 Bacteria 5321
118 Ga0105240_10075536 3300009093 Bacteria 4156
119 Ga0105240_10165975 3300009093 Bacteria 2619
120 Ga0105240_10324032 3300009093 Bacteria 1755
121 Ga0105240_10419959 3300009093 Bacteria 1503
122 Ga0111539_10010859 3300009094 Bacteria 11460
123 Ga0111539_10016720 3300009094 Bacteria 9091
124 Ga0111539_10020759 3300009094 Bacteria 8086
125 Ga0111539_10069163 3300009094 Bacteria 4169
126 Ga0114129_10000770 3300009147 Bacteria 40863
127 Ga0114129_10046340 3300009147 Bacteria 6110
128 Ga0114129_10159308 3300009147 Bacteria 3085
129 Ga0114129_10427984 3300009147 Bacteria 1740
130 Ga0105242_10049144 3300009176 Bacteria 3431
131 Ga0105242_10239177 3300009176 Unclassified 1631
132 Ga0105242_10585977 3300009176 Bacteria 1075
133 Ga0105242_11102805 3300009176 Unclassified 808
134 Ga0105248_10018901 3300009177 Bacteria 7619
135 Ga0105248_10267668 3300009177 Unclassified 1924
136 Ga0105248_11152954 3300009177 Unclassified 876
137 Ga0105237_10618275 3300009545 Bacteria 1090
138 Ga0105237_10921933 3300009545 Bacteria 881
139 Ga0105249_10279422 3300009553 Bacteria 1667
140 Ga0105239_10291071 3300010375 Bacteria 1839
141 Ga0157374_10037203 3300013296 Unclassified 4465
142 Ga0157374_10127624 3300013296 Unclassified 2459
143 Ga0157374_10654420 3300013296 Bacteria 1063
144 Ga0157378_10300761 3300013297 Bacteria 1553
145 Ga0157378_10410195 3300013297 Bacteria 1337
146 Ga0157378_10568437 3300013297 Bacteria 1141
147 Ga0163162_10047647 3300013306 Unclassified 4295
148 Ga0163162_10241675 3300013306 Bacteria 1936
149 Ga0163162_10551398 3300013306 Unclassified 1281
150 Ga0163162_10631539 3300013306 Unclassified 1195
151 Ga0157372_10954229 3300013307 Bacteria 994
152 Ga0157375_10005505 3300013308 Bacteria 11018
153 Ga0163163_10004873 3300014325 Bacteria 11537
154 Ga0163163_10006428 3300014325 Bacteria 10272
155 Ga0163163_10008339 3300014325 Bacteria 9201
156 Ga0163163_10011968 3300014325 Bacteria 7894
157 Ga0163163_10022024 3300014325 Bacteria 6025
158 Ga0163163_10088288 3300014325 Bacteria 3112
159 Ga0163163_10313770 3300014325 Bacteria 1621
160 Ga0157380_10480202 3300014326 Unclassified 1202
161 Ga0157380_10809176 3300014326 Bacteria 955
162 Ga0157380_11543546 3300014326 Bacteria 718
163 Ga0157379_10435794 3300014968 Unclassified 1208
164 Ga0157379_10663037 3300014968 Unclassified 977
165 Ga0157376_10012108 3300014969 Bacteria 6388
166 Ga0163161_10404738 3300017792 Unclassified 1095
167 Ga0163161_10492524 3300017792 Unclassified 997
168 Ga0213874_10004751 3300021377 Unclassified 3128
169 Ga0207680_10013254 3300025903 Bacteria 4229
170 Ga0207707_10080689 3300025912 Bacteria 2841
171 Ga0207695_10022998 3300025913 Bacteria 7059
172 Ga0207695_10043528 3300025913 Bacteria 4784
173 Ga0207695_10048054 3300025913 Bacteria 4509
174 Ga0207695_10165326 3300025913 Bacteria 2141
175 Ga0207695_10348412 3300025913 Unclassified 1369
176 Ga0207671_10495179 3300025914 Bacteria 974
177 Ga0207660_10252688 3300025917 Archaea 1392
178 Ga0207662_10016428 3300025918 Bacteria 4178
179 Ga0207662_10452895 3300025918 Bacteria 878
180 Ga0207649_10167887 3300025920 Unclassified 1526
181 Ga0207652_10091119 3300025921 Bacteria 2680
182 Ga0207652_10329824 3300025921 Archaea 1378
183 Ga0207646_10131967 3300025922 Unclassified 2248
184 Ga0207646_10673664 3300025922 Bacteria 926
185 Ga0207694_10325786 3300025924 Unclassified 1268
186 Ga0207650_10006920 3300025925 Bacteria 7731
187 Ga0207659_10001338 3300025926 Bacteria 14749
188 Ga0207659_10127106 3300025926 Bacteria 1962
189 Ga0207644_10091749 3300025931 Unclassified 2265
190 Ga0207686_10273636 3300025934 Bacteria 1243
191 Ga0207704_10100081 3300025938 Unclassified 1930
192 Ga0207691_10012900 3300025940 Bacteria 8002
193 Ga0207691_10443842 3300025940 Bacteria 1104
194 Ga0207661_10013010 3300025944 Bacteria 6072
195 Ga0207661_10232017 3300025944 Unclassified 1635
196 Ga0207667_10080718 3300025949 Unclassified 3370
197 Ga0207651_10008420 3300025960 Bacteria 5571
198 Ga0207651_10009772 3300025960 Bacteria 5275
199 Ga0207651_10037479 3300025960 Bacteria 3177
200 Ga0207651_10341358 3300025960 Bacteria 1258
201 Ga0207712_10107705 3300025961 Unclassified 2084
202 Ga0207658_10023080 3300025986 Bacteria 4338
203 Ga0207658_10390625 3300025986 Bacteria 1221
204 Ga0207677_10114655 3300026023 Unclassified 2014
205 Ga0207677_10231460 3300026023 Bacteria 1489
206 Ga0207703_10002951 3300026035 Bacteria 14427
207 Ga0207703_10087974 3300026035 Unclassified 2606
208 Ga0207703_10967836 3300026035 Unclassified 816
209 Ga0207708_10585528 3300026075 Unclassified 944
210 Ga0207702_10040901 3300026078 Bacteria 3886
211 Ga0207702_10489669 3300026078 Bacteria 1198
212 Ga0207702_11402935 3300026078 Bacteria 692
213 Ga0207641_10179094 3300026088 Bacteria 1940
214 Ga0207648_10828475 3300026089 Bacteria 862
215 Ga0207676_10099906 3300026095 Unclassified 2402
216 Ga0207676_10180430 3300026095 Bacteria 1848
217 Ga0207674_10003515 3300026116 Bacteria 19132
218 Ga0207428_10027542 3300027907 Bacteria 4731
219 Ga0207428_10033500 3300027907 Bacteria 4219
220 Ga0268264_10133909 3300028381 Unclassified 2201
221 Ga0268264_10325017 3300028381 Bacteria 1456
222 Ga0265338_10013809 3300028800 Bacteria 9075
223 Ga0265338_10099617 3300028800 Unclassified 2373
224 Ga0265338_10200039 3300028800 Bacteria 1507
225 Ga0265338_10395973 3300028800 Unclassified 985
226 Ga0265332_10118037 3300031238 Bacteria 1115
227 Ga0265328_10002937 3300031239 Bacteria 7608
228 Ga0265320_10000778 3300031240 Bacteria 24380
229 Ga0265340_10010417 3300031247 Bacteria 4973
230 Ga0265340_10078892 3300031247 Bacteria 1552
231 Ga0265339_10003442 3300031249 Bacteria 11071
232 Ga0265339_10033762 3300031249 Bacteria 2878
233 Ga0265339_10053156 3300031249 Bacteria 2204
234 Ga0265316_10046481 3300031344 Bacteria 3439
235 Ga0265313_10058180 3300031595 Bacteria 1822
236 Ga0265313_10229753 3300031595 Unclassified 762
237 Ga0265314_10008280 3300031711 Bacteria 8924
238 Ga0265314_10063194 3300031711 Bacteria 2512
239 Ga0265342_10000951 3300031712 Bacteria 28826
240 Ga0265342_10114078 3300031712 Unclassified 1527
241 Ga0373950_0000016 3300034818 Bacteria 277879
242 Ga0373950_0000028 3300034818 Bacteria 168467
243 Ga0373953_0017026 3300035117 Bacteria 2664
244 Ga0373953_0030555 3300035117 Unclassified 2090
245 Ga0373954_0004489 3300035118 Bacteria 6007
246 Ga0373956_0023466 3300035119 Bacteria 2648
247 Ga0373957_0031124 3300035120 Bacteria 1959
248 Ga0373957_0040201 3300035120 Bacteria 1758
249 Ga0373955_0031112 3300035172 Bacteria 2794
250 Ga0373955_0062616 3300035172 Bacteria 2058
251 Ga0373955_0081330 3300035172 Bacteria 1831
252 Ga0373955_0243055 3300035172 Bacteria 1078
253 Ga0373955_0358024 3300035172 Unclassified 884
254 Ga0373924_0017871 3300035410 Bacteria 2727
255 Ga0373924_0066416 3300035410 Bacteria 1516
256 Ga0373933_0002025 3300035724 Bacteria 11663
257 Ga0373933_0222587 3300035724 Unclassified 1211
258 Ga0373937_0001395 3300036401 Bacteria 20166
259 Ga0373937_0035927 3300036401 Bacteria 4513
260 Ga0373937_0044835 3300036401 Bacteria 4040
261 Ga0373937_0230348 3300036401 Unclassified 1745
262 Ga0373937_0314635 3300036401 Bacteria 1481
263 Ga0436364_0058035 3300037853 Bacteria 5838
264 Ga0395901_1288511 3300038443 Bacteria 693
265 Ga0436363_1386076 3300039450 Unclassified 3413
266 Ga0453684_1292724 3300044712 Unclassified 761
267 Ga0495629_0115913 3300046459 Unclassified 1867
268 Ga0495638_0372532 3300046460 Unclassified 748
269 Ga0495653_0282074 3300046463 Bacteria 1090
270 Ga0495608_0095361 3300046511 Bacteria 1922
271 Ga0495618_0200294 3300046514 Unclassified 1264
272 Ga0495630_0247162 3300046517 Bacteria 1363
273 Ga0495630_0456178 3300046517 Unclassified 980
274 Ga0495652_0040393 3300046529 Unclassified 4033
275 Ga0495586_0064981 3300046535 Bacteria 1989
276 Ga0495587_0255070 3300046536 Bacteria 986
277 Ga0495645_0452986 3300046543 Unclassified 809
278 Ga0495667_0000567 3300046559 Bacteria 23568
279 Ga0495667_0147877 3300046559 Bacteria 1513
280 Ga0495657_0002884 3300046675 Bacteria 14271
281 Ga0495657_0241410 3300046675 Bacteria 1090
282 Ga0495599_0150451 3300046678 Unclassified 1442
283 Ga0495658_0092595 3300046683 Bacteria 1792
284 Ga0495658_0127076 3300046683 Unclassified 1548
285 Ga0495658_0203863 3300046683 Bacteria 1234
286 Ga0495613_0051617 3300046689 Bacteria 3030
287 Ga0495613_0081413 3300046689 Bacteria 2352
288 Ga0495613_0562195 3300046689 Bacteria 762
289 Ga0495604_0140861 3300047317 Bacteria 1723
290 Ga0495674_0564122 3300047319 Unclassified 905
291 Ga0495680_0241408 3300047322 Bacteria 1283
292 Ga0495684_0064094 3300047471 Bacteria 2793
293 Ga0495684_0083927 3300047471 Bacteria 2416
294 Ga0495684_0493452 3300047471 Unclassified 843
295 Ga0496104_0017875 3300048907 Bacteria 6465
296 Ga0496104_0493682 3300048907 Unclassified 1135
297 Ga0496104_0829951 3300048907 Unclassified 830
298 Ga0496105_0596812 3300048908 Bacteria 857
299 Ga0496108_0076992 3300048911 Bacteria 2820
300 Ga0496109_0237693 3300048912 Unclassified 1714
301 Ga0496114_0001311 3300048917 Bacteria 18846
302 Ga0496114_0031334 3300048917 Bacteria 4376
303 Ga0496114_0070705 3300048917 Bacteria 2932
304 Ga0501034_0000284 3300049571 Bacteria 90775
305 Ga0501036_0043998 3300049572 Bacteria 3781
306 Ga0501042_0330571 3300049578 Unclassified 1102
307 Ga0501043_0015493 3300049579 Bacteria 5972
308 Ga0501046_0001095 3300049580 Bacteria 26491
309 Ga0501047_0000128 3300049581 Bacteria 91838
310 Ga0501048_0004176 3300049582 Bacteria 11012
311 Ga0501067_0000629 3300049583 Bacteria 18931
312 Ga0501067_0001777 3300049583 Bacteria 11841
313 Ga0501067_0094891 3300049583 Bacteria 1656
314 Ga0501068_0016101 3300049584 Bacteria 4306
315 Ga0501068_0021348 3300049584 Bacteria 3781
316 Ga0501070_0003275 3300049586 Bacteria 14053
317 Ga0501070_0116656 3300049586 Bacteria 2205
318 Ga0501072_0000085 3300049588 Bacteria 68557
319 Ga0501073_0003813 3300049589 Bacteria 11313
320 Ga0501073_0004484 3300049589 Bacteria 10488
321 Ga0501073_0012198 3300049589 Bacteria 6275
322 Ga0501073_0095372 3300049589 Unclassified 2066
323 Ga0501074_0002030 3300049590 Bacteria 13968
324 Ga0501074_0045250 3300049590 Bacteria 3185
325 Ga0501079_0000080 3300049741 Bacteria 45678
326 Ga0501080_0048225 3300049742 Bacteria 3964
327 Ga0501080_0136880 3300049742 Bacteria 2266
328 Ga0501080_0441522 3300049742 Unclassified 1167
329 Ga0501083_0001919 3300049744 Bacteria 14291
330 Ga0501083_0109543 3300049744 Bacteria 1816
331 nmdc:mga05p37_145527_c1 3300050507 Bacteria 2902
332 nmdc:mga05p37_2435_c1 3300050507 Bacteria 21635
333 nmdc:mga05p37_33597_c1 3300050507 Bacteria 6283
334 nmdc:mga09592_433_c1 3300050508 Bacteria 30832
335 nmdc:mga09592_51075_c1 3300050508 Bacteria 3487
336 nmdc:mga0qj67_5150_c1 3300050509 Bacteria 9530
337 nmdc:mga06r32_509984_c1 3300050510 Bacteria 1179
338 nmdc:mga08y16_13263_c1 3300050511 Bacteria 8666
339 nmdc:mga08y16_184605_c1 3300050511 Unclassified 2165
340 nmdc:mga08y16_5131_c1 3300050511 Bacteria 13689
341 nmdc:mga0n895_432517_c1 3300050512 Unclassified 1330
342 nmdc:mga0rr50_313975_c1 3300050513 Bacteria 1313
343 nmdc:mga0rr50_317109_c1 3300050513 Unclassified 1306
344 nmdc:mga08x19_2756_c1 3300050514 Bacteria 10615
345 nmdc:mga0sz30_66966_c1 3300050516 Unclassified 1541
346 Ga0500610_0067590 3300053079 Unclassified 1864
347 Ga0500583_0216810 3300053092 Bacteria 949
348 Ga0500583_0290111 3300053092 Bacteria 802
349 Ga0500658_0074675 3300053134 Bacteria 1438
350 Ga0501084_0000095 3300054114 Bacteria 65258
351 Ga0590071_012299 3300059421 Unclassified 2006
352 Ga0590074_016241 3300059423 Unclassified 1267
353 Ga0590075_001362 3300059424 Bacteria 6136
354 Ga0501082_0000304 3300060353 Bacteria 43594
355 Ga0501082_0040970 3300060353 Bacteria 3993
356 Ga0501082_0090911 3300060353 Bacteria 2636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100013531 Ga0068857_1000135318 185
2 3300014325 Ga0163163_10011968 Ga0163163_100119683 185
3 3300026116 Ga0207674_10003515 Ga0207674_100035158 185
4 3300025913 Ga0207695_10022998 Ga0207695_100229987 193
5 3300005614 Ga0068856_100287168 Ga0068856_1002871682 195
6 3300013307 Ga0157372_10954229 Ga0157372_109542292 195
7 3300026078 Ga0207702_10489669 Ga0207702_104896692 195
8 3300048907 Ga0496104_0017875 Ga0496104_0017875_1097_1717 195
9 3300048908 Ga0496105_0596812 Ga0496105_0596812_107_727 195
10 3300005468 Ga0070707_100007182 Ga0070707_1000071823 200
11 3300006237 Ga0097621_100331755 Ga0097621_1003317552 200
12 3300009177 Ga0105248_10018901 Ga0105248_100189012 200
13 3300009177 Ga0105248_10267668 Ga0105248_102676682 200
14 3300013296 Ga0157374_10037203 Ga0157374_100372032 200
15 3300013306 Ga0163162_10047647 Ga0163162_100476474 200
16 3300013306 Ga0163162_10241675 Ga0163162_102416752 200
17 3300013308 Ga0157375_10005505 Ga0157375_100055052 200
18 3300014325 Ga0163163_10022024 Ga0163163_100220246 200
19 3300025903 Ga0207680_10013254 Ga0207680_100132545 200
20 3300025920 Ga0207649_10167887 Ga0207649_101678872 200
21 3300025922 Ga0207646_10131967 Ga0207646_101319672 200
22 3300046689 Ga0495613_0562195 Ga0495613_0562195_33_635 200
23 3300050512 nmdc:mga0n895_432517_c1 nmdc:mga0n895_432517_c1_28_630 200
24 3300005338 Ga0068868_100001607 Ga0068868_10000160714 201
25 3300005344 Ga0070661_100013729 Ga0070661_1000137296 201
26 3300005355 Ga0070671_100092359 Ga0070671_1000923592 201
27 3300005364 Ga0070673_100024674 Ga0070673_1000246743 201
28 3300005365 Ga0070688_100329289 Ga0070688_1003292892 201
29 3300005367 Ga0070667_100004849 Ga0070667_10000484912 201
30 3300005466 Ga0070685_10434388 Ga0070685_104343881 201
31 3300005468 Ga0070707_101176279 Ga0070707_1011762791 201
32 3300005539 Ga0068853_100966842 Ga0068853_1009668421 201
33 3300005543 Ga0070672_100006737 Ga0070672_1000067378 201
34 3300005544 Ga0070686_100056359 Ga0070686_1000563593 201
35 3300005564 Ga0070664_100003782 Ga0070664_1000037826 201
36 3300005618 Ga0068864_100167991 Ga0068864_1001679912 201
37 3300005834 Ga0068851_10246501 Ga0068851_102465011 201
38 3300005841 Ga0068863_100240732 Ga0068863_1002407322 201
39 3300005842 Ga0068858_100058329 Ga0068858_1000583292 201
40 3300005843 Ga0068860_100152986 Ga0068860_1001529862 201
41 3300005844 Ga0068862_100935132 Ga0068862_1009351322 201
42 3300006178 Ga0075367_10264567 Ga0075367_102645672 201
43 3300006186 Ga0075369_10143701 Ga0075369_101437012 201
44 3300006358 Ga0068871_100110393 Ga0068871_1001103932 201
45 3300006871 Ga0075434_100026221 Ga0075434_1000262212 201
46 3300009094 Ga0111539_10010859 Ga0111539_100108595 201
47 3300013297 Ga0157378_10410195 Ga0157378_104101952 201
48 3300014325 Ga0163163_10006428 Ga0163163_100064289 201
49 3300014969 Ga0157376_10012108 Ga0157376_100121084 201
50 3300017792 Ga0163161_10404738 Ga0163161_104047382 201
51 3300017792 Ga0163161_10492524 Ga0163161_104925242 201
52 3300021377 Ga0213874_10004751 Ga0213874_100047512 201
53 3300025922 Ga0207646_10673664 Ga0207646_106736642 201
54 3300025925 Ga0207650_10006920 Ga0207650_100069202 201
55 3300025931 Ga0207644_10091749 Ga0207644_100917492 201
56 3300025940 Ga0207691_10012900 Ga0207691_100129008 201
57 3300025960 Ga0207651_10008420 Ga0207651_100084202 201
58 3300025986 Ga0207658_10023080 Ga0207658_100230804 201
59 3300026035 Ga0207703_10087974 Ga0207703_100879742 201
60 3300026035 Ga0207703_10967836 Ga0207703_109678362 201
61 3300026095 Ga0207676_10099906 Ga0207676_100999062 201
62 3300028381 Ga0268264_10133909 Ga0268264_101339092 201
63 3300035172 Ga0373955_0243055 Ga0373955_0243055_382_1011 201
64 3300039450 Ga0436363_1386076 Ga0436363_1386076_538_1173 201
65 3300046459 Ga0495629_0115913 Ga0495629_0115913_906_1559 201
66 3300046460 Ga0495638_0372532 Ga0495638_0372532_25_651 201
67 3300046517 Ga0495630_0456178 Ga0495630_0456178_75_728 201
68 3300046535 Ga0495586_0064981 Ga0495586_0064981_1326_1979 201
69 3300046683 Ga0495658_0092595 Ga0495658_0092595_83_736 201
70 3300046683 Ga0495658_0127076 Ga0495658_0127076_778_1431 201
71 3300046683 Ga0495658_0203863 Ga0495658_0203863_83_697 201
72 3300046689 Ga0495613_0051617 Ga0495613_0051617_1346_1999 201
73 3300046689 Ga0495613_0081413 Ga0495613_0081413_618_1232 201
74 3300047319 Ga0495674_0564122 Ga0495674_0564122_155_808 201
75 3300047471 Ga0495684_0064094 Ga0495684_0064094_664_1317 201
76 3300050511 nmdc:mga08y16_184605_c1 nmdc:mga08y16_184605_c1_38_661 201
77 3300050516 nmdc:mga0sz30_66966_c1 nmdc:mga0sz30_66966_c1_106_732 201
78 3300053079 Ga0500610_0067590 Ga0500610_0067590_1221_1847 201
79 3300053092 Ga0500583_0216810 Ga0500583_0216810_289_915 201
80 3300053092 Ga0500583_0290111 Ga0500583_0290111_142_768 201
81 3300053134 Ga0500658_0074675 Ga0500658_0074675_662_1288 201
82 3300005336 Ga0070680_100394246 Ga0070680_1003942462 202
83 3300005338 Ga0068868_100123602 Ga0068868_1001236023 202
84 3300005365 Ga0070688_100587541 Ga0070688_1005875412 202
85 3300005458 Ga0070681_10020780 Ga0070681_100207803 202
86 3300005458 Ga0070681_10039244 Ga0070681_100392444 202
87 3300005458 Ga0070681_10365992 Ga0070681_103659922 202
88 3300005466 Ga0070685_10422971 Ga0070685_104229712 202
89 3300005530 Ga0070679_100186585 Ga0070679_1001865852 202
90 3300005530 Ga0070679_100398812 Ga0070679_1003988122 202
91 3300005563 Ga0068855_100068790 Ga0068855_1000687904 202
92 3300005563 Ga0068855_100111910 Ga0068855_1001119102 202
93 3300005842 Ga0068858_100061771 Ga0068858_1000617713 202
94 3300006358 Ga0068871_100244535 Ga0068871_1002445352 202
95 3300006881 Ga0068865_100209786 Ga0068865_1002097862 202
96 3300009093 Ga0105240_10049232 Ga0105240_100492324 202
97 3300009093 Ga0105240_10324032 Ga0105240_103240322 202
98 3300009093 Ga0105240_10419959 Ga0105240_104199592 202
99 3300009176 Ga0105242_10049144 Ga0105242_100491442 202
100 3300009176 Ga0105242_11102805 Ga0105242_111028051 202
101 3300009545 Ga0105237_10618275 Ga0105237_106182752 202
102 3300010375 Ga0105239_10291071 Ga0105239_102910713 202
103 3300013297 Ga0157378_10568437 Ga0157378_105684371 202
104 3300013306 Ga0163162_10631539 Ga0163162_106315392 202
105 3300014325 Ga0163163_10004873 Ga0163163_100048738 202
106 3300014325 Ga0163163_10008339 Ga0163163_100083397 202
107 3300014325 Ga0163163_10088288 Ga0163163_100882882 202
108 3300014326 Ga0157380_10480202 Ga0157380_104802022 202
109 3300014968 Ga0157379_10435794 Ga0157379_104357942 202
110 3300014968 Ga0157379_10663037 Ga0157379_106630372 202
111 3300025912 Ga0207707_10080689 Ga0207707_100806892 202
112 3300025913 Ga0207695_10043528 Ga0207695_100435284 202
113 3300025913 Ga0207695_10348412 Ga0207695_103484121 202
114 3300025914 Ga0207671_10495179 Ga0207671_104951792 202
115 3300025917 Ga0207660_10252688 Ga0207660_102526882 202
116 3300025921 Ga0207652_10091119 Ga0207652_100911192 202
117 3300025921 Ga0207652_10329824 Ga0207652_103298242 202
118 3300025924 Ga0207694_10325786 Ga0207694_103257862 202
119 3300025934 Ga0207686_10273636 Ga0207686_102736361 202
120 3300025938 Ga0207704_10100081 Ga0207704_101000812 202
121 3300025944 Ga0207661_10232017 Ga0207661_102320171 202
122 3300025961 Ga0207712_10107705 Ga0207712_101077052 202
123 3300026023 Ga0207677_10114655 Ga0207677_101146553 202
124 3300026035 Ga0207703_10002951 Ga0207703_100029513 202
125 3300028800 Ga0265338_10013809 Ga0265338_100138099 202
126 3300028800 Ga0265338_10395973 Ga0265338_103959732 202
127 3300031239 Ga0265328_10002937 Ga0265328_100029377 202
128 3300031240 Ga0265320_10000778 Ga0265320_100007789 202
129 3300031249 Ga0265339_10033762 Ga0265339_100337622 202
130 3300031344 Ga0265316_10046481 Ga0265316_100464812 202
131 3300031595 Ga0265313_10229753 Ga0265313_102297531 202
132 3300031711 Ga0265314_10008280 Ga0265314_100082805 202
133 3300031711 Ga0265314_10063194 Ga0265314_100631942 202
134 3300031712 Ga0265342_10000951 Ga0265342_100009513 202
135 3300035117 Ga0373953_0017026 Ga0373953_0017026_484_1095 202
136 3300035118 Ga0373954_0004489 Ga0373954_0004489_4395_5006 202
137 3300035119 Ga0373956_0023466 Ga0373956_0023466_622_1233 202
138 3300035120 Ga0373957_0040201 Ga0373957_0040201_1063_1674 202
139 3300035172 Ga0373955_0062616 Ga0373955_0062616_888_1514 202
140 3300035172 Ga0373955_0081330 Ga0373955_0081330_24_635 202
141 3300035410 Ga0373924_0066416 Ga0373924_0066416_731_1342 202
142 3300036401 Ga0373937_0001395 Ga0373937_0001395_18860_19471 202
143 3300036401 Ga0373937_0044835 Ga0373937_0044835_602_1228 202
144 3300038443 Ga0395901_1288511 Ga0395901_1288511_17_652 202
145 3300044712 Ga0453684_1292724 Ga0453684_1292724_12_635 202
146 3300046463 Ga0495653_0282074 Ga0495653_0282074_435_1061 202
147 3300046529 Ga0495652_0040393 Ga0495652_0040393_542_1165 202
148 3300046559 Ga0495667_0147877 Ga0495667_0147877_490_1113 202
149 3300046675 Ga0495657_0241410 Ga0495657_0241410_41_652 202
150 3300046678 Ga0495599_0150451 Ga0495599_0150451_458_1084 202
151 3300047317 Ga0495604_0140861 Ga0495604_0140861_869_1492 202
152 3300047471 Ga0495684_0083927 Ga0495684_0083927_1128_1751 202
153 3300048917 Ga0496114_0001311 Ga0496114_0001311_18140_18751 202
154 3300003320 rootH2_10043717 rootH2_100437179 203
155 3300003320 rootH2_10268730 rootH2_102687302 203
156 3300003323 rootH1_10090693 rootH1_100906934 203
157 3300005328 Ga0070676_10104984 Ga0070676_101049842 203
158 3300005329 Ga0070683_100005683 Ga0070683_1000056832 203
159 3300005329 Ga0070683_100482083 Ga0070683_1004820832 203
160 3300005329 Ga0070683_100689977 Ga0070683_1006899771 203
161 3300005330 Ga0070690_100106931 Ga0070690_1001069312 203
162 3300005331 Ga0070670_100131081 Ga0070670_1001310812 203
163 3300005334 Ga0068869_100392499 Ga0068869_1003924992 203
164 3300005337 Ga0070682_100008720 Ga0070682_1000087202 203
165 3300005337 Ga0070682_100064225 Ga0070682_1000642253 203
166 3300005337 Ga0070682_100172606 Ga0070682_1001726062 203
167 3300005338 Ga0068868_100114014 Ga0068868_1001140142 203
168 3300005338 Ga0068868_100412379 Ga0068868_1004123792 203
169 3300005340 Ga0070689_100026979 Ga0070689_1000269792 203
170 3300005340 Ga0070689_100148645 Ga0070689_1001486452 203
171 3300005341 Ga0070691_10116663 Ga0070691_101166632 203
172 3300005343 Ga0070687_100010242 Ga0070687_1000102423 203
173 3300005343 Ga0070687_100532142 Ga0070687_1005321421 203
174 3300005344 Ga0070661_100560219 Ga0070661_1005602192 203
175 3300005345 Ga0070692_10117846 Ga0070692_101178462 203
176 3300005347 Ga0070668_100007661 Ga0070668_1000076617 203
177 3300005353 Ga0070669_100008989 Ga0070669_1000089894 203
178 3300005354 Ga0070675_100000944 Ga0070675_1000009448 203
179 3300005354 Ga0070675_100164207 Ga0070675_1001642072 203
180 3300005354 Ga0070675_100533767 Ga0070675_1005337672 203
181 3300005356 Ga0070674_100008437 Ga0070674_1000084372 203
182 3300005364 Ga0070673_100006538 Ga0070673_1000065384 203
183 3300005364 Ga0070673_100082062 Ga0070673_1000820622 203
184 3300005364 Ga0070673_100126236 Ga0070673_1001262362 203
185 3300005364 Ga0070673_100232799 Ga0070673_1002327992 203
186 3300005365 Ga0070688_100084546 Ga0070688_1000845462 203
187 3300005438 Ga0070701_10059018 Ga0070701_100590182 203
188 3300005441 Ga0070700_100008584 Ga0070700_1000085843 203
189 3300005457 Ga0070662_100128471 Ga0070662_1001284712 203
190 3300005459 Ga0068867_100076877 Ga0068867_1000768772 203
191 3300005466 Ga0070685_10114649 Ga0070685_101146492 203
192 3300005466 Ga0070685_10135824 Ga0070685_101358242 203
193 3300005467 Ga0070706_100332069 Ga0070706_1003320692 203
194 3300005535 Ga0070684_100010583 Ga0070684_1000105833 203
195 3300005535 Ga0070684_100021935 Ga0070684_1000219353 203
196 3300005543 Ga0070672_100102588 Ga0070672_1001025882 203
197 3300005543 Ga0070672_100170770 Ga0070672_1001707702 203
198 3300005543 Ga0070672_100523317 Ga0070672_1005233172 203
199 3300005544 Ga0070686_100048663 Ga0070686_1000486632 203
200 3300005544 Ga0070686_100843285 Ga0070686_1008432851 203
201 3300005548 Ga0070665_100415652 Ga0070665_1004156522 203
202 3300005549 Ga0070704_100196722 Ga0070704_1001967222 203
203 3300005614 Ga0068856_100159739 Ga0068856_1001597392 203
204 3300005614 Ga0068856_100164103 Ga0068856_1001641033 203
205 3300005615 Ga0070702_100337314 Ga0070702_1003373142 203
206 3300005617 Ga0068859_100000313 Ga0068859_10000031319 203
207 3300005618 Ga0068864_100370971 Ga0068864_1003709712 203
208 3300005719 Ga0068861_100062653 Ga0068861_1000626532 203
209 3300005841 Ga0068863_100052712 Ga0068863_1000527123 203
210 3300005842 Ga0068858_100139234 Ga0068858_1001392342 203
211 3300005843 Ga0068860_100143653 Ga0068860_1001436532 203
212 3300005843 Ga0068860_100638186 Ga0068860_1006381862 203
213 3300005937 Ga0081455_10008099 Ga0081455_100080994 203
214 3300005937 Ga0081455_10035326 Ga0081455_100353266 203
215 3300006058 Ga0075432_10014968 Ga0075432_100149682 203
216 3300006237 Ga0097621_100070747 Ga0097621_1000707472 203
217 3300006237 Ga0097621_100344837 Ga0097621_1003448372 203
218 3300006358 Ga0068871_100033245 Ga0068871_1000332452 203
219 3300006358 Ga0068871_100405869 Ga0068871_1004058692 203
220 3300006844 Ga0075428_100000584 Ga0075428_1000005848 203
221 3300006846 Ga0075430_100002772 Ga0075430_1000027729 203
222 3300006847 Ga0075431_100001654 Ga0075431_1000016547 203
223 3300006847 Ga0075431_100848201 Ga0075431_1008482012 203
224 3300006852 Ga0075433_10174988 Ga0075433_101749882 203
225 3300006880 Ga0075429_100001109 Ga0075429_1000011097 203
226 3300006881 Ga0068865_100000979 Ga0068865_10000097914 203
227 3300006914 Ga0075436_100002926 Ga0075436_1000029269 203
228 3300006931 Ga0097620_100000313 Ga0097620_10000031319 203
229 3300007076 Ga0075435_100167812 Ga0075435_1001678122 203
230 3300009093 Ga0105240_10075536 Ga0105240_100755362 203
231 3300009093 Ga0105240_10165975 Ga0105240_101659753 203
232 3300009094 Ga0111539_10016720 Ga0111539_100167204 203
233 3300009094 Ga0111539_10020759 Ga0111539_100207594 203
234 3300009094 Ga0111539_10069163 Ga0111539_100691632 203
235 3300009147 Ga0114129_10000770 Ga0114129_1000077017 203
236 3300009147 Ga0114129_10046340 Ga0114129_100463405 203
237 3300009147 Ga0114129_10159308 Ga0114129_101593083 203
238 3300009147 Ga0114129_10427984 Ga0114129_104279842 203
239 3300009176 Ga0105242_10239177 Ga0105242_102391772 203
240 3300009176 Ga0105242_10585977 Ga0105242_105859772 203
241 3300009177 Ga0105248_11152954 Ga0105248_111529542 203
242 3300009545 Ga0105237_10921933 Ga0105237_109219332 203
243 3300009553 Ga0105249_10279422 Ga0105249_102794222 203
244 3300013296 Ga0157374_10127624 Ga0157374_101276242 203
245 3300013296 Ga0157374_10654420 Ga0157374_106544202 203
246 3300013297 Ga0157378_10300761 Ga0157378_103007612 203
247 3300013306 Ga0163162_10551398 Ga0163162_105513982 203
248 3300014325 Ga0163163_10313770 Ga0163163_103137702 203
249 3300014326 Ga0157380_10809176 Ga0157380_108091762 203
250 3300014326 Ga0157380_11543546 Ga0157380_115435461 203
251 3300025913 Ga0207695_10048054 Ga0207695_100480545 203
252 3300025913 Ga0207695_10165326 Ga0207695_101653262 203
253 3300025918 Ga0207662_10016428 Ga0207662_100164284 203
254 3300025918 Ga0207662_10452895 Ga0207662_104528952 203
255 3300025926 Ga0207659_10001338 Ga0207659_100013382 203
256 3300025926 Ga0207659_10127106 Ga0207659_101271062 203
257 3300025940 Ga0207691_10443842 Ga0207691_104438422 203
258 3300025944 Ga0207661_10013010 Ga0207661_100130104 203
259 3300025949 Ga0207667_10080718 Ga0207667_100807184 203
260 3300025960 Ga0207651_10009772 Ga0207651_100097722 203
261 3300025960 Ga0207651_10037479 Ga0207651_100374792 203
262 3300025960 Ga0207651_10341358 Ga0207651_103413582 203
263 3300025986 Ga0207658_10390625 Ga0207658_103906252 203
264 3300026023 Ga0207677_10231460 Ga0207677_102314602 203
265 3300026075 Ga0207708_10585528 Ga0207708_105855281 203
266 3300026078 Ga0207702_10040901 Ga0207702_100409012 203
267 3300026078 Ga0207702_11402935 Ga0207702_114029351 203
268 3300026088 Ga0207641_10179094 Ga0207641_101790942 203
269 3300026089 Ga0207648_10828475 Ga0207648_108284752 203
270 3300026095 Ga0207676_10180430 Ga0207676_101804303 203
271 3300027907 Ga0207428_10027542 Ga0207428_100275422 203
272 3300027907 Ga0207428_10033500 Ga0207428_100335002 203
273 3300028381 Ga0268264_10325017 Ga0268264_103250172 203
274 3300028800 Ga0265338_10099617 Ga0265338_100996173 203
275 3300028800 Ga0265338_10200039 Ga0265338_102000392 203
276 3300031238 Ga0265332_10118037 Ga0265332_101180371 203
277 3300031247 Ga0265340_10010417 Ga0265340_100104174 203
278 3300031247 Ga0265340_10078892 Ga0265340_100788923 203
279 3300031249 Ga0265339_10003442 Ga0265339_100034428 203
280 3300031249 Ga0265339_10053156 Ga0265339_100531562 203
281 3300031595 Ga0265313_10058180 Ga0265313_100581802 203
282 3300031712 Ga0265342_10114078 Ga0265342_101140782 203
283 3300034818 Ga0373950_0000016 Ga0373950_0000016_193609_194235 203
284 3300034818 Ga0373950_0000028 Ga0373950_0000028_88786_89409 203
285 3300035117 Ga0373953_0030555 Ga0373953_0030555_851_1525 203
286 3300035120 Ga0373957_0031124 Ga0373957_0031124_891_1565 203
287 3300035172 Ga0373955_0031112 Ga0373955_0031112_511_1128 203
288 3300035172 Ga0373955_0358024 Ga0373955_0358024_31_705 203
289 3300035410 Ga0373924_0017871 Ga0373924_0017871_1298_1972 203
290 3300035724 Ga0373933_0002025 Ga0373933_0002025_10317_10967 203
291 3300035724 Ga0373933_0222587 Ga0373933_0222587_74_748 203
292 3300036401 Ga0373937_0035927 Ga0373937_0035927_2763_3413 203
293 3300036401 Ga0373937_0230348 Ga0373937_0230348_959_1636 203
294 3300036401 Ga0373937_0314635 Ga0373937_0314635_546_1163 203
295 3300037853 Ga0436364_0058035 Ga0436364_0058035_4234_4890 203
296 3300046511 Ga0495608_0095361 Ga0495608_0095361_646_1320 203
297 3300046514 Ga0495618_0200294 Ga0495618_0200294_365_1042 203
298 3300046517 Ga0495630_0247162 Ga0495630_0247162_400_1074 203
299 3300046536 Ga0495587_0255070 Ga0495587_0255070_98_775 203
300 3300046543 Ga0495645_0452986 Ga0495645_0452986_55_732 203
301 3300046559 Ga0495667_0000567 Ga0495667_0000567_9905_10579 203
302 3300046675 Ga0495657_0002884 Ga0495657_0002884_11122_11796 203
303 3300047322 Ga0495680_0241408 Ga0495680_0241408_168_785 203
304 3300047471 Ga0495684_0493452 Ga0495684_0493452_108_785 203
305 3300048907 Ga0496104_0493682 Ga0496104_0493682_44_661 203
306 3300048907 Ga0496104_0829951 Ga0496104_0829951_125_787 203
307 3300048911 Ga0496108_0076992 Ga0496108_0076992_333_947 203
308 3300048912 Ga0496109_0237693 Ga0496109_0237693_417_1031 203
309 3300048917 Ga0496114_0031334 Ga0496114_0031334_3362_3979 203
310 3300048917 Ga0496114_0070705 Ga0496114_0070705_363_986 203
311 3300049571 Ga0501034_0000284 Ga0501034_0000284_1149_1772 203
312 3300049572 Ga0501036_0043998 Ga0501036_0043998_1222_1857 203
313 3300049578 Ga0501042_0330571 Ga0501042_0330571_398_1021 203
314 3300049579 Ga0501043_0015493 Ga0501043_0015493_901_1524 203
315 3300049580 Ga0501046_0001095 Ga0501046_0001095_1149_1772 203
316 3300049581 Ga0501047_0000128 Ga0501047_0000128_88620_89243 203
317 3300049582 Ga0501048_0004176 Ga0501048_0004176_7822_8445 203
318 3300049583 Ga0501067_0000629 Ga0501067_0000629_11100_11726 203
319 3300049583 Ga0501067_0001777 Ga0501067_0001777_6008_6622 203
320 3300049583 Ga0501067_0094891 Ga0501067_0094891_891_1508 203
321 3300049584 Ga0501068_0016101 Ga0501068_0016101_2472_3095 203
322 3300049584 Ga0501068_0021348 Ga0501068_0021348_1565_2188 203
323 3300049586 Ga0501070_0003275 Ga0501070_0003275_780_1403 203
324 3300049586 Ga0501070_0116656 Ga0501070_0116656_395_1018 203
325 3300049588 Ga0501072_0000085 Ga0501072_0000085_62738_63361 203
326 3300049589 Ga0501073_0003813 Ga0501073_0003813_9911_10534 203
327 3300049589 Ga0501073_0004484 Ga0501073_0004484_7186_7812 203
328 3300049589 Ga0501073_0012198 Ga0501073_0012198_1565_2179 203
329 3300049589 Ga0501073_0095372 Ga0501073_0095372_360_974 203
330 3300049590 Ga0501074_0002030 Ga0501074_0002030_12370_12993 203
331 3300049590 Ga0501074_0045250 Ga0501074_0045250_724_1347 203
332 3300049741 Ga0501079_0000080 Ga0501079_0000080_43774_44397 203
333 3300049742 Ga0501080_0048225 Ga0501080_0048225_2193_2816 203
334 3300049742 Ga0501080_0136880 Ga0501080_0136880_1431_2054 203
335 3300049742 Ga0501080_0441522 Ga0501080_0441522_137_760 203
336 3300049744 Ga0501083_0001919 Ga0501083_0001919_12520_13143 203
337 3300049744 Ga0501083_0109543 Ga0501083_0109543_483_1106 203
338 3300050507 nmdc:mga05p37_145527_c1 nmdc:mga05p37_145527_c1_758_1438 203
339 3300050507 nmdc:mga05p37_2435_c1 nmdc:mga05p37_2435_c1_8909_9565 203
340 3300050507 nmdc:mga05p37_33597_c1 nmdc:mga05p37_33597_c1_1529_2212 203
341 3300050508 nmdc:mga09592_433_c1 nmdc:mga09592_433_c1_9790_10446 203
342 3300050508 nmdc:mga09592_51075_c1 nmdc:mga09592_51075_c1_40_723 203
343 3300050509 nmdc:mga0qj67_5150_c1 nmdc:mga0qj67_5150_c1_8011_8667 203
344 3300050510 nmdc:mga06r32_509984_c1 nmdc:mga06r32_509984_c1_96_731 203
345 3300050511 nmdc:mga08y16_13263_c1 nmdc:mga08y16_13263_c1_3320_3934 203
346 3300050511 nmdc:mga08y16_5131_c1 nmdc:mga08y16_5131_c1_11951_12634 203
347 3300050513 nmdc:mga0rr50_313975_c1 nmdc:mga0rr50_313975_c1_413_1033 203
348 3300050513 nmdc:mga0rr50_317109_c1 nmdc:mga0rr50_317109_c1_423_1106 203
349 3300050514 nmdc:mga08x19_2756_c1 nmdc:mga08x19_2756_c1_3872_4492 203
350 3300054114 Ga0501084_0000095 Ga0501084_0000095_1833_2456 203
351 3300059421 Ga0590071_012299 Ga0590071_012299_838_1455 203
352 3300059423 Ga0590074_016241 Ga0590074_016241_227_844 203
353 3300059424 Ga0590075_001362 Ga0590075_001362_5377_5994 203
354 3300060353 Ga0501082_0000304 Ga0501082_0000304_1149_1772 203
355 3300060353 Ga0501082_0040970 Ga0501082_0040970_755_1372 203
356 3300060353 Ga0501082_0090911 Ga0501082_0090911_1207_1830 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13489

Methyltransf_23

Methyltransferase domain

59

225

0.81

PF08241

Methyltransf_11

Methyltransferase domain

84

175

0.79

PF08242

Methyltransf_12

Methyltransferase domain

85

173

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p9d-assembly1.cif.gz_A-2 crystal structure of chlamydomonas reinhardtii nadph dependent thioredoxin reductase 1 domain 0.778 35 81
6f5z-assembly1.cif.gz_A complex between the haloferax volcanii trm112 methyltransferase activator and the hvo_0019 putative methyltransferase 0.7694 22 203
4o5q-assembly1.cif.gz_A crystal structure of the alkylhydroperoxide reductase ahpf from escherichia coli 0.7591 35 82
5w4c-assembly1.cif.gz_A crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation) 0.7533 29 82
4kri-assembly1.cif.gz_A haemonchus contortus phospholethanolamine n-methyltransferase 2 in complex with phosphomonomethylethanolamine and s-adenosylhomocysteine 0.7442 22 203
ID Description Score Start End Superfamily
af_Q54CP1_214_390_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7851 20 202 3.40.50.150
af_Q7K2B0_198_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7827 24 203 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7806 15 202 3.40.50.150
af_O07253_9_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.773 16 200 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7699 30 202 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A537W6R2-F1-model_v4 Methyltransferase domain-containing protein 0.9817 87 203 GO:0008757
GO:0032259
AF-A0A2V8JPU9-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9812 3 203 GO:0008757
AF-A0A537W6R2-F1-model_v4 Methyltransferase domain-containing protein 0.9734 87 203 GO:0008757
GO:0032259
AF-A0A2V8JPU9-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9669 3 203 GO:0008757
AF-A0A2W6AG56-F1-model_v4 Class I SAM-dependent methyltransferase 0.9598 1 202

Feature Viewer

pLDDT pTM Quality
91.61 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map