F420474

General Info

Members Datasets Scaffolds Average Seq Length
356 182 356 318

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10017280|Ga0111539_100172806
Length 343
Sequence MNADRICVHLRKSAVQIRETYMPFQDIDEVTPLEHPRPAPSRVEKLLRRIFLEDWSLKLLSLAIAIVLWLLVTGQNEPVTAHVNVQLNLIRPPSLEISNDPPRTVDVMLTGSRNKLDDLTTLDLVATVDISDQRAGERVLRLADKAQISLPQGIKVNGFQPSAIPIRLEPILERQVPVEPKLEGKPADGFEVYAIHPSKGSVTVRGPESRVNALQKVVTESIWLAGHKERFTATNLALDVPDPKLDLLEPIISVDVEIGEQRTEKNFSGVNVSTADGGKVQPETTSVTLSGATSLLDSLKAEDIKIVLDAVGSNLEPRLELPQPLNGKVFLKSVHASKFVPLR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
150 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
151 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
157 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
160 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
163 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
164 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
165 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
166 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
169 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
170 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
171 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
172 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
173 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.6
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000057 3300002459 Bacteria 62893
2 JGI24751J29686_10000130 3300002459 Bacteria 37822
3 JGI25406J46586_10004357 3300003203 Bacteria 6604
4 rootL2_10167105 3300003322 Unclassified 2917
5 Ga0065714_10002185 3300005288 Bacteria 199213
6 Ga0065704_10097241 3300005289 Bacteria 2403
7 Ga0065712_10036144 3300005290 Bacteria 1689
8 Ga0065712_10067734 3300005290 Bacteria 110577
9 Ga0065715_10036894 3300005293 Unclassified 1315
10 Ga0065715_10096492 3300005293 Bacteria 3869
11 Ga0065715_10177516 3300005293 Bacteria 1500
12 Ga0065707_10001542 3300005295 Bacteria 9328
13 Ga0065707_10186804 3300005295 Bacteria 1384
14 Ga0070690_100008632 3300005330 Bacteria 5876
15 Ga0070670_100003910 3300005331 Bacteria 12427
16 Ga0070670_100041661 3300005331 Bacteria 3946
17 Ga0070670_100104593 3300005331 Bacteria 2439
18 Ga0070670_100217216 3300005331 Bacteria 1663
19 Ga0068869_100053743 3300005334 Unclassified 2929
20 Ga0068869_100054607 3300005334 Bacteria 2909
21 Ga0068869_100172609 3300005334 Bacteria 1690
22 Ga0070680_100084412 3300005336 Bacteria 2623
23 Ga0070680_100346968 3300005336 Bacteria 1262
24 Ga0070682_100173109 3300005337 Bacteria 1502
25 Ga0070689_100002248 3300005340 Bacteria 12540
26 Ga0070689_100214400 3300005340 Bacteria 1577
27 Ga0070661_100037219 3300005344 Bacteria 3539
28 Ga0070692_10023236 3300005345 Bacteria 3036
29 Ga0070692_10066840 3300005345 Bacteria 1906
30 Ga0070692_10099788 3300005345 Bacteria 1590
31 Ga0070675_100037129 3300005354 Bacteria 3967
32 Ga0070673_100025218 3300005364 Bacteria 4372
33 Ga0070673_100063701 3300005364 Bacteria 2934
34 Ga0070673_100180785 3300005364 Bacteria 1805
35 Ga0070688_100076777 3300005365 Bacteria 2151
36 Ga0070659_100003892 3300005366 Bacteria 10636
37 Ga0070659_100315712 3300005366 Bacteria 1305
38 Ga0070703_10001808 3300005406 Bacteria 6321
39 Ga0070701_10076805 3300005438 Bacteria 1798
40 Ga0070705_100032271 3300005440 Bacteria 2908
41 Ga0070700_100000160 3300005441 Bacteria 38863
42 Ga0070700_100087771 3300005441 Bacteria 2022
43 Ga0070700_100267262 3300005441 Bacteria 1234
44 Ga0070694_100012039 3300005444 Bacteria 5371
45 Ga0070694_100015044 3300005444 Bacteria 4850
46 Ga0070694_100041698 3300005444 Bacteria 3063
47 Ga0070694_100093373 3300005444 Bacteria 2115
48 Ga0070694_100104014 3300005444 Unclassified 2013
49 Ga0070663_100086481 3300005455 Unclassified 2315
50 Ga0070678_100015951 3300005456 Bacteria 4788
51 Ga0070681_10017184 3300005458 Bacteria 7233
52 Ga0070681_10291255 3300005458 Bacteria 1542
53 Ga0068867_100055578 3300005459 Bacteria 2927
54 Ga0068867_100172728 3300005459 Bacteria 1713
55 Ga0070706_100001130 3300005467 Bacteria 28845
56 Ga0070698_100046287 3300005471 Bacteria 4448
57 Ga0070698_100048160 3300005471 Bacteria 4356
58 Ga0070698_100063904 3300005471 Bacteria 3710
59 Ga0070699_100119242 3300005518 Bacteria 2319
60 Ga0070699_100184468 3300005518 Bacteria 1852
61 Ga0070699_100325867 3300005518 Bacteria 1381
62 Ga0068853_100047085 3300005539 Bacteria 3700
63 Ga0070672_100004840 3300005543 Bacteria 8848
64 Ga0070686_100087879 3300005544 Bacteria 2073
65 Ga0070695_100023604 3300005545 Bacteria 3783
66 Ga0070695_100127667 3300005545 Bacteria 1748
67 Ga0070696_100179994 3300005546 Unclassified 1568
68 Ga0070693_100010817 3300005547 Bacteria 4579
69 Ga0070693_100024221 3300005547 Bacteria 3253
70 Ga0070704_100015680 3300005549 Bacteria 4768
71 Ga0070664_100048673 3300005564 Bacteria 3582
72 Ga0070664_100196528 3300005564 Bacteria 1798
73 Ga0070664_100545719 3300005564 Bacteria 1072
74 Ga0068857_100005840 3300005577 Bacteria 10511
75 Ga0068857_100399078 3300005577 Unclassified 1279
76 Ga0070702_100004186 3300005615 Bacteria 6563
77 Ga0070702_100018148 3300005615 Bacteria 3644
78 Ga0070702_100034498 3300005615 Bacteria 2789
79 Ga0068852_100093068 3300005616 Bacteria 2701
80 Ga0068859_100054620 3300005617 Bacteria 4018
81 Ga0068859_100073963 3300005617 Bacteria 3446
82 Ga0068859_100076256 3300005617 Bacteria 3393
83 Ga0068859_100141953 3300005617 Bacteria 2475
84 Ga0068859_100386909 3300005617 Bacteria 1494
85 Ga0068864_100047566 3300005618 Bacteria 3685
86 Ga0068864_100052197 3300005618 Bacteria 3524
87 Ga0068864_100053054 3300005618 Bacteria 3496
88 Ga0068864_100108175 3300005618 Bacteria 2474
89 Ga0068864_100159215 3300005618 Bacteria 2051
90 Ga0068864_100478517 3300005618 Bacteria 1195
91 Ga0068861_100015521 3300005719 Bacteria 5369
92 Ga0068851_10001944 3300005834 Bacteria 9081
93 Ga0068870_10025568 3300005840 Bacteria 2932
94 Ga0068870_10057325 3300005840 Bacteria 2082
95 Ga0068863_100006594 3300005841 Bacteria 11390
96 Ga0068863_100038012 3300005841 Bacteria 4580
97 Ga0068863_100062800 3300005841 Bacteria 3513
98 Ga0068863_100085367 3300005841 Bacteria 2991
99 Ga0068863_100173901 3300005841 Bacteria 2066
100 Ga0068858_100085282 3300005842 Bacteria 2938
101 Ga0068858_100137246 3300005842 Bacteria 2295
102 Ga0068858_100233429 3300005842 Bacteria 1744
103 Ga0068858_100334038 3300005842 Bacteria 1450
104 Ga0068858_100411057 3300005842 Unclassified 1301
105 Ga0068860_100071551 3300005843 Bacteria 3295
106 Ga0068860_100080741 3300005843 Bacteria 3092
107 Ga0068860_100093848 3300005843 Bacteria 2860
108 Ga0068860_100161920 3300005843 Bacteria 2158
109 Ga0068860_100228683 3300005843 Bacteria 1807
110 Ga0068860_100508399 3300005843 Bacteria 1203
111 Ga0068862_100208036 3300005844 Bacteria 1767
112 Ga0068862_100338263 3300005844 Bacteria 1393
113 Ga0081539_10000600 3300005985 Bacteria 73358
114 Ga0081539_10001856 3300005985 Bacteria 33258
115 Ga0070716_100033895 3300006173 Bacteria 2796
116 Ga0070716_100070643 3300006173 Bacteria 2051
117 Ga0097621_100003003 3300006237 Bacteria 11587
118 Ga0097621_100019873 3300006237 Bacteria 5166
119 Ga0097621_100028707 3300006237 Bacteria 4387
120 Ga0068871_100053723 3300006358 Bacteria 3266
121 Ga0075428_100114279 3300006844 Bacteria 2941
122 Ga0075430_100022535 3300006846 Bacteria 5360
123 Ga0075430_100078262 3300006846 Bacteria 2772
124 Ga0075431_100023531 3300006847 Bacteria 6304
125 Ga0075431_100080531 3300006847 Bacteria 3362
126 Ga0075433_10082616 3300006852 Bacteria 2833
127 Ga0075434_100083014 3300006871 Bacteria 3202
128 Ga0075434_100176480 3300006871 Bacteria 2156
129 Ga0075434_100381430 3300006871 Bacteria 1430
130 Ga0075429_100018127 3300006880 Bacteria 6092
131 Ga0075429_100046039 3300006880 Bacteria 3796
132 Ga0075429_100069147 3300006880 Unclassified 3074
133 Ga0068865_100022500 3300006881 Bacteria 4113
134 Ga0097620_100054618 3300006931 Bacteria 4018
135 Ga0097620_100073963 3300006931 Bacteria 3446
136 Ga0097620_100076252 3300006931 Bacteria 3393
137 Ga0097620_100141955 3300006931 Bacteria 2475
138 Ga0097620_100386928 3300006931 Bacteria 1494
139 Ga0075435_100023232 3300007076 Bacteria 4792
140 Ga0105240_10111832 3300009093 Bacteria 3303
141 Ga0111539_10005784 3300009094 Bacteria 15980
142 Ga0111539_10017280 3300009094 Bacteria 8927
143 Ga0111539_10118594 3300009094 Bacteria 3102
144 Ga0111539_10226096 3300009094 Bacteria 2179
145 Ga0105247_10045269 3300009101 Bacteria 2699
146 Ga0114129_10024802 3300009147 Bacteria 8501
147 Ga0114129_10047028 3300009147 Bacteria 6064
148 Ga0114129_10071520 3300009147 Bacteria 4837
149 Ga0114129_10537220 3300009147 Bacteria 1522
150 Ga0105243_10033416 3300009148 Bacteria 3978
151 Ga0105243_10134637 3300009148 Bacteria 2101
152 Ga0105243_10150301 3300009148 Bacteria 1997
153 Ga0105241_10016414 3300009174 Bacteria 5431
154 Ga0105241_10037956 3300009174 Bacteria 3632
155 Ga0105241_10119011 3300009174 Bacteria 2124
156 Ga0105241_10186033 3300009174 Bacteria 1726
157 Ga0105241_10408504 3300009174 Bacteria 1193
158 Ga0105242_10024809 3300009176 Bacteria 4738
159 Ga0105242_10241376 3300009176 Bacteria 1624
160 Ga0105242_10276169 3300009176 Bacteria 1524
161 Ga0105248_10017920 3300009177 Bacteria 7814
162 Ga0105248_10122099 3300009177 Bacteria 2938
163 Ga0105248_10123035 3300009177 Bacteria 2927
164 Ga0105248_10137132 3300009177 Bacteria 2760
165 Ga0105248_10281678 3300009177 Bacteria 1872
166 Ga0105237_10016717 3300009545 Bacteria 7617
167 Ga0105238_10118452 3300009551 Bacteria 2628
168 Ga0105238_10175196 3300009551 Bacteria 2122
169 Ga0105249_10139567 3300009553 Bacteria 2322
170 Ga0105239_10659571 3300010375 Bacteria 1195
171 Ga0105246_10046511 3300011119 Bacteria 2960
172 Ga0105246_10074343 3300011119 Bacteria 2402
173 Ga0157373_10002635 3300013100 Bacteria 13612
174 Ga0157373_10017404 3300013100 Bacteria 5236
175 Ga0157373_10033182 3300013100 Bacteria 3715
176 Ga0157373_10299884 3300013100 Bacteria 1140
177 Ga0157374_10454326 3300013296 Bacteria 1283
178 Ga0157378_10010686 3300013297 Bacteria 8024
179 Ga0163162_10009830 3300013306 Bacteria 9305
180 Ga0163162_10086422 3300013306 Bacteria 3214
181 Ga0163162_10138136 3300013306 Bacteria 2548
182 Ga0163162_10441219 3300013306 Bacteria 1434
183 Ga0157372_10063147 3300013307 Bacteria 4152
184 Ga0157372_10406711 3300013307 Bacteria 1586
185 Ga0157375_10190710 3300013308 Bacteria 2204
186 Ga0163163_10025292 3300014325 Bacteria 5660
187 Ga0163163_10072233 3300014325 Bacteria 3440
188 Ga0163163_10107855 3300014325 Bacteria 2811
189 Ga0163163_10119252 3300014325 Bacteria 2671
190 Ga0163163_10126716 3300014325 Bacteria 2591
191 Ga0157380_10024015 3300014326 Bacteria 4608
192 Ga0157380_10067960 3300014326 Bacteria 2871
193 Ga0157380_10100088 3300014326 Bacteria 2412
194 Ga0157377_10060073 3300014745 Bacteria 2169
195 Ga0157377_10195276 3300014745 Unclassified 1281
196 Ga0157379_10151373 3300014968 Bacteria 2093
197 Ga0157376_10139568 3300014969 Bacteria 2173
198 Ga0163161_10039470 3300017792 Bacteria 3389
199 Ga0207656_10003633 3300025321 Bacteria 5327
200 Ga0207653_10002464 3300025885 Bacteria 5882
201 Ga0207710_10066006 3300025900 Bacteria 1650
202 Ga0207647_10003641 3300025904 Bacteria 11526
203 Ga0207647_10160895 3300025904 Bacteria 1310
204 Ga0207643_10001960 3300025908 Bacteria 11372
205 Ga0207643_10011980 3300025908 Bacteria 4682
206 Ga0207643_10024585 3300025908 Bacteria 3324
207 Ga0207684_10000023 3300025910 Bacteria 334838
208 Ga0207654_10106836 3300025911 Bacteria 1734
209 Ga0207707_10000335 3300025912 Bacteria 49647
210 Ga0207695_10102848 3300025913 Bacteria 2849
211 Ga0207671_10002078 3300025914 Bacteria 21911
212 Ga0207662_10004086 3300025918 Bacteria 7626
213 Ga0207662_10067481 3300025918 Bacteria 2157
214 Ga0207652_10049232 3300025921 Bacteria 3607
215 Ga0207652_10103510 3300025921 Bacteria 2517
216 Ga0207646_10192023 3300025922 Bacteria 1844
217 Ga0207681_10194361 3300025923 Bacteria 1554
218 Ga0207694_10008080 3300025924 Bacteria 7951
219 Ga0207650_10000001 3300025925 Bacteria 1545726
220 Ga0207650_10076194 3300025925 Bacteria 2534
221 Ga0207650_10090633 3300025925 Bacteria 2335
222 Ga0207690_10008850 3300025932 Bacteria 5974
223 Ga0207706_10078287 3300025933 Unclassified 2908
224 Ga0207706_10194649 3300025933 Unclassified 1779
225 Ga0207686_10161034 3300025934 Bacteria 1573
226 Ga0207709_10050976 3300025935 Bacteria 2534
227 Ga0207709_10078605 3300025935 Bacteria 2118
228 Ga0207709_10105364 3300025935 Bacteria 1873
229 Ga0207670_10000533 3300025936 Bacteria 20906
230 Ga0207670_10140128 3300025936 Bacteria 1783
231 Ga0207704_10044101 3300025938 Bacteria 2639
232 Ga0207665_10037935 3300025939 Bacteria 3207
233 Ga0207665_10176105 3300025939 Bacteria 1547
234 Ga0207691_10032858 3300025940 Bacteria 4835
235 Ga0207711_10001579 3300025941 Bacteria 21034
236 Ga0207711_10030135 3300025941 Bacteria 4576
237 Ga0207711_10211992 3300025941 Bacteria 1769
238 Ga0207711_10228264 3300025941 Bacteria 1705
239 Ga0207689_10000667 3300025942 Bacteria 32744
240 Ga0207689_10028956 3300025942 Bacteria 4630
241 Ga0207689_10068685 3300025942 Unclassified 2912
242 Ga0207689_10265004 3300025942 Bacteria 1422
243 Ga0207689_10277651 3300025942 Bacteria 1387
244 Ga0207689_10405376 3300025942 Unclassified 1137
245 Ga0207679_10209776 3300025945 Bacteria 1633
246 Ga0207667_10272884 3300025949 Bacteria 1729
247 Ga0207712_10006513 3300025961 Bacteria 7366
248 Ga0207712_10173000 3300025961 Bacteria 1690
249 Ga0207640_10079534 3300025981 Bacteria 2235
250 Ga0207640_10091290 3300025981 Bacteria 2110
251 Ga0207658_10033902 3300025986 Bacteria 3645
252 Ga0207703_10328492 3300026035 Bacteria 1402
253 Ga0207703_10474718 3300026035 Unclassified 1171
254 Ga0207639_10037227 3300026041 Bacteria 3612
255 Ga0207639_10095496 3300026041 Bacteria 2389
256 Ga0207708_10003087 3300026075 Bacteria 12263
257 Ga0207708_10151255 3300026075 Bacteria 1827
258 Ga0207641_10048368 3300026088 Bacteria 3589
259 Ga0207641_10094629 3300026088 Bacteria 2620
260 Ga0207641_10104771 3300026088 Bacteria 2497
261 Ga0207641_10223109 3300026088 Bacteria 1749
262 Ga0207648_10051326 3300026089 Bacteria 3604
263 Ga0207648_10260649 3300026089 Bacteria 1547
264 Ga0207648_10351440 3300026089 Bacteria 1329
265 Ga0207676_10042237 3300026095 Bacteria 3506
266 Ga0207676_10081221 3300026095 Bacteria 2633
267 Ga0207676_10112982 3300026095 Bacteria 2276
268 Ga0207676_10155943 3300026095 Bacteria 1972
269 Ga0207676_10196436 3300026095 Bacteria 1779
270 Ga0207676_10231325 3300026095 Unclassified 1653
271 Ga0207676_10234537 3300026095 Bacteria 1642
272 Ga0207676_10249280 3300026095 Bacteria 1597
273 Ga0207676_10441152 3300026095 Bacteria 1225
274 Ga0207674_10000077 3300026116 Bacteria 104302
275 Ga0207674_10127199 3300026116 Bacteria 2513
276 Ga0207674_10273117 3300026116 Bacteria 1638
277 Ga0207674_10487615 3300026116 Bacteria 1191
278 Ga0207675_100026967 3300026118 Bacteria 5348
279 Ga0207675_100045697 3300026118 Bacteria 4091
280 Ga0207675_100108525 3300026118 Bacteria 2618
281 Ga0207683_10029817 3300026121 Bacteria 4724
282 Ga0207698_10056181 3300026142 Bacteria 3038
283 Ga0207698_10250408 3300026142 Bacteria 1620
284 Ga0207428_10053068 3300027907 Bacteria 3234
285 Ga0268265_10031265 3300028380 Bacteria 3843
286 Ga0268265_10099671 3300028380 Bacteria 2343
287 Ga0268265_10120948 3300028380 Bacteria 2157
288 Ga0268264_10072847 3300028381 Bacteria 2914
289 Ga0268264_10210226 3300028381 Bacteria 1786
290 Ga0268264_10291918 3300028381 Bacteria 1532
291 Ga0307410_10046665 3300031852 Bacteria 2891
292 Ga0307406_10017630 3300031901 Bacteria 4160
293 Ga0307406_10081326 3300031901 Bacteria 2154
294 Ga0307412_10443109 3300031911 Unclassified 1068
295 Ga0307416_100014278 3300032002 Bacteria 5434
296 Ga0307416_100345024 3300032002 Bacteria 1504
297 Ga0307414_10192223 3300032004 Bacteria 1652
298 Ga0307415_100022212 3300032126 Bacteria 3911
299 Ga0373951_0000768 3300035091 Bacteria 8795
300 Ga0395901_0168082 3300038443 Unclassified 2302
301 Ga0439455_0004820 3300042012 Bacteria 2699
302 Ga0453683_0178337 3300044673 Unclassified 1347
303 Ga0495643_0035171 3300046522 Bacteria 2760
304 Ga0496106_0439517 3300048909 Bacteria 1048
305 Ga0496108_0044798 3300048911 Bacteria 3694
306 Ga0496112_0106364 3300048915 Bacteria 2776
307 Ga0496112_0194442 3300048915 Bacteria 1990
308 Ga0501291_008280 3300049514 Bacteria 1433
309 Ga0501296_004996 3300049519 Unclassified 1465
310 Ga0501297_004023 3300049520 Bacteria 1486
311 Ga0501298_000628 3300049521 Bacteria 4858
312 Ga0501298_002419 3300049521 Unclassified 2821
313 Ga0501299_002052 3300049522 Bacteria 2742
314 Ga0501299_003286 3300049522 Unclassified 2329
315 Ga0501038_0008718 3300049574 Bacteria 9306
316 Ga0501202_002092 3300049652 Bacteria 3313
317 Ga0501207_002042 3300049654 Bacteria 2581
318 Ga0501216_003076 3300049660 Bacteria 2415
319 Ga0501216_008457 3300049660 Bacteria 1620
320 Ga0501217_001684 3300049661 Bacteria 4205
321 Ga0501217_012520 3300049661 Bacteria 1891
322 Ga0501217_012576 3300049661 Unclassified 1888
323 Ga0501224_001333 3300049664 Bacteria 3264
324 Ga0501227_007444 3300049665 Bacteria 2344
325 Ga0501227_015060 3300049665 Bacteria 1725
326 Ga0501233_005021 3300049668 Bacteria 2448
327 Ga0501235_002924 3300049669 Bacteria 3678
328 Ga0501235_018898 3300049669 Unclassified 1529
329 Ga0501243_006724 3300049675 Unclassified 1748
330 Ga0501257_019295 3300049686 Unclassified 1594
331 Ga0501259_001350 3300049688 Bacteria 4113
332 Ga0501260_001411 3300049689 Bacteria 1977
333 Ga0501225_0002845 3300049705 Bacteria 5311
334 Ga0501229_003663 3300049706 Bacteria 1845
335 Ga0501234_005774 3300049707 Bacteria 1934
336 Ga0501279_008151 3300049775 Unclassified 1397
337 Ga0501283_010128 3300049779 Unclassified 1384
338 Ga0501212_007510 3300049851 Unclassified 1496
339 Ga0501226_000729 3300049853 Bacteria 4463
340 nmdc:mga05p37_316098_c1 3300050507 Bacteria 1850
341 nmdc:mga05p37_444695_c1 3300050507 Bacteria 1502
342 nmdc:mga05p37_89185_c1 3300050507 Bacteria 3800
343 nmdc:mga09592_46916_c1 3300050508 Bacteria 3640
344 nmdc:mga09592_47223_c1 3300050508 Bacteria 3628
345 nmdc:mga09592_68998_c1 3300050508 Bacteria 2999
346 nmdc:mga0qj67_18189_c1 3300050509 Bacteria 5354
347 nmdc:mga06r32_411054_c1 3300050510 Bacteria 1335
348 nmdc:mga08y16_111655_c1 3300050511 Bacteria 2846
349 nmdc:mga08y16_430160_c1 3300050511 Bacteria 1348
350 nmdc:mga08y16_46322_c1 3300050511 Bacteria 4552
351 nmdc:mga0n895_300856_c1 3300050512 Bacteria 1626
352 nmdc:mga0n895_477019_c1 3300050512 Bacteria 1258
353 nmdc:mga0rr50_18492_c1 3300050513 Bacteria 4683
354 nmdc:mga08x19_133836_c1 3300050514 Viruses 1670
355 nmdc:mga0a205_520429_c1 3300050515 Bacteria 1046
356 nmdc:mga0a205_80497_c1 3300050515 Bacteria 3147

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100054607 Ga0068869_1000546072 267
2 3300005336 Ga0070680_100346968 Ga0070680_1003469682 275
3 3300005364 Ga0070673_100063701 Ga0070673_1000637012 277
4 3300005444 Ga0070694_100104014 Ga0070694_1001040142 277
5 3300014326 Ga0157380_10024015 Ga0157380_100240154 277
6 3300025933 Ga0207706_10078287 Ga0207706_100782872 277
7 3300025981 Ga0207640_10079534 Ga0207640_100795342 277
8 3300009147 Ga0114129_10047028 Ga0114129_100470282 278
9 3300005719 Ga0068861_100015521 Ga0068861_1000155214 279
10 3300026118 Ga0207675_100026967 Ga0207675_1000269672 279
11 3300049669 Ga0501235_018898 Ga0501235_018898_48_929 288
12 3300013100 Ga0157373_10299884 Ga0157373_102998842 289
13 3300005564 Ga0070664_100545719 Ga0070664_1005457191 294
14 3300026116 Ga0207674_10273117 Ga0207674_102731172 294
15 3300005340 Ga0070689_100214400 Ga0070689_1002144001 295
16 3300025936 Ga0207670_10140128 Ga0207670_101401282 295
17 3300013100 Ga0157373_10033182 Ga0157373_100331823 297
18 3300025981 Ga0207640_10091290 Ga0207640_100912902 297
19 3300009094 Ga0111539_10118594 Ga0111539_101185942 299
20 3300005334 Ga0068869_100172609 Ga0068869_1001726092 300
21 3300005441 Ga0070700_100267262 Ga0070700_1002672621 300
22 3300005841 Ga0068863_100173901 Ga0068863_1001739012 300
23 3300025942 Ga0207689_10265004 Ga0207689_102650042 300
24 3300026088 Ga0207641_10094629 Ga0207641_100946292 300
25 3300005617 Ga0068859_100073963 Ga0068859_1000739632 301
26 3300006931 Ga0097620_100073963 Ga0097620_1000739632 301
27 3300009177 Ga0105248_10137132 Ga0105248_101371322 301
28 3300025941 Ga0207711_10030135 Ga0207711_100301353 301
29 3300006173 Ga0070716_100070643 Ga0070716_1000706432 302
30 3300006880 Ga0075429_100046039 Ga0075429_1000460392 302
31 3300009147 Ga0114129_10071520 Ga0114129_100715202 302
32 3300025918 Ga0207662_10067481 Ga0207662_100674812 302
33 3300025933 Ga0207706_10194649 Ga0207706_101946492 302
34 3300025939 Ga0207665_10176105 Ga0207665_101761052 302
35 3300050508 nmdc:mga09592_68998_c1 nmdc:mga09592_68998_c1_1532_2485 302
36 3300005290 Ga0065712_10036144 Ga0065712_100361442 303
37 3300005364 Ga0070673_100180785 Ga0070673_1001807852 303
38 3300005444 Ga0070694_100041698 Ga0070694_1000416982 303
39 3300005471 Ga0070698_100048160 Ga0070698_1000481604 303
40 3300005547 Ga0070693_100010817 Ga0070693_1000108173 303
41 3300005617 Ga0068859_100141953 Ga0068859_1001419533 303
42 3300005842 Ga0068858_100334038 Ga0068858_1003340382 303
43 3300006931 Ga0097620_100141955 Ga0097620_1001419553 303
44 3300009174 Ga0105241_10016414 Ga0105241_100164144 303
45 3300050507 nmdc:mga05p37_444695_c1 nmdc:mga05p37_444695_c1_373_1335 304
46 3300005549 Ga0070704_100015680 Ga0070704_1000156802 305
47 3300009174 Ga0105241_10119011 Ga0105241_101190112 305
48 3300014326 Ga0157380_10100088 Ga0157380_101000883 305
49 3300003322 rootL2_10167105 rootL2_101671052 306
50 3300005564 Ga0070664_100196528 Ga0070664_1001965282 306
51 3300005618 Ga0068864_100478517 Ga0068864_1004785171 306
52 3300005844 Ga0068862_100208036 Ga0068862_1002080362 306
53 3300025945 Ga0207679_10209776 Ga0207679_102097761 306
54 3300032002 Ga0307416_100345024 Ga0307416_1003450242 306
55 3300049779 Ga0501283_010128 Ga0501283_010128_285_1241 306
56 3300009148 Ga0105243_10150301 Ga0105243_101503012 307
57 3300025935 Ga0207709_10078605 Ga0207709_100786052 307
58 3300026095 Ga0207676_10231325 Ga0207676_102313251 307
59 3300049514 Ga0501291_008280 Ga0501291_008280_151_1110 307
60 3300049522 Ga0501299_003286 Ga0501299_003286_1140_2099 307
61 3300049660 Ga0501216_008457 Ga0501216_008457_130_1089 307
62 3300049675 Ga0501243_006724 Ga0501243_006724_263_1222 307
63 3300049775 Ga0501279_008151 Ga0501279_008151_94_1053 307
64 3300049851 Ga0501212_007510 Ga0501212_007510_478_1437 307
65 3300009094 Ga0111539_10226096 Ga0111539_102260962 308
66 3300049686 Ga0501257_019295 Ga0501257_019295_210_1166 308
67 3300050511 nmdc:mga08y16_46322_c1 nmdc:mga08y16_46322_c1_1610_2578 308
68 3300006846 Ga0075430_100022535 Ga0075430_1000225352 309
69 3300006847 Ga0075431_100023531 Ga0075431_1000235315 309
70 3300006880 Ga0075429_100018127 Ga0075429_1000181274 309
71 3300009147 Ga0114129_10024802 Ga0114129_100248022 309
72 3300050507 nmdc:mga05p37_89185_c1 nmdc:mga05p37_89185_c1_341_1294 309
73 3300050508 nmdc:mga09592_46916_c1 nmdc:mga09592_46916_c1_181_1134 309
74 3300050509 nmdc:mga0qj67_18189_c1 nmdc:mga0qj67_18189_c1_2666_3619 309
75 3300026088 Ga0207641_10223109 Ga0207641_102231091 310
76 3300026118 Ga0207675_100108525 Ga0207675_1001085253 310
77 3300048911 Ga0496108_0044798 Ga0496108_0044798_1857_2816 310
78 3300005293 Ga0065715_10036894 Ga0065715_100368942 311
79 3300005293 Ga0065715_10177516 Ga0065715_101775162 311
80 3300005471 Ga0070698_100046287 Ga0070698_1000462872 311
81 3300005615 Ga0070702_100018148 Ga0070702_1000181483 311
82 3300005617 Ga0068859_100076256 Ga0068859_1000762562 311
83 3300005842 Ga0068858_100411057 Ga0068858_1004110572 311
84 3300005843 Ga0068860_100080741 Ga0068860_1000807412 311
85 3300006931 Ga0097620_100076252 Ga0097620_1000762522 311
86 3300009101 Ga0105247_10045269 Ga0105247_100452692 311
87 3300009177 Ga0105248_10122099 Ga0105248_101220992 311
88 3300025900 Ga0207710_10066006 Ga0207710_100660062 311
89 3300025941 Ga0207711_10228264 Ga0207711_102282642 311
90 3300025942 Ga0207689_10028956 Ga0207689_100289562 311
91 3300005289 Ga0065704_10097241 Ga0065704_100972412 312
92 3300005295 Ga0065707_10001542 Ga0065707_100015422 312
93 3300005330 Ga0070690_100008632 Ga0070690_1000086322 312
94 3300005331 Ga0070670_100041661 Ga0070670_1000416613 312
95 3300005331 Ga0070670_100217216 Ga0070670_1002172162 312
96 3300005334 Ga0068869_100053743 Ga0068869_1000537432 312
97 3300005340 Ga0070689_100002248 Ga0070689_1000022483 312
98 3300005354 Ga0070675_100037129 Ga0070675_1000371293 312
99 3300005364 Ga0070673_100025218 Ga0070673_1000252183 312
100 3300005365 Ga0070688_100076777 Ga0070688_1000767772 312
101 3300005438 Ga0070701_10076805 Ga0070701_100768052 312
102 3300005456 Ga0070678_100015951 Ga0070678_1000159512 312
103 3300005459 Ga0068867_100055578 Ga0068867_1000555782 312
104 3300005459 Ga0068867_100172728 Ga0068867_1001727282 312
105 3300005543 Ga0070672_100004840 Ga0070672_1000048402 312
106 3300005544 Ga0070686_100087879 Ga0070686_1000878792 312
107 3300005546 Ga0070696_100179994 Ga0070696_1001799942 312
108 3300005615 Ga0070702_100004186 Ga0070702_1000041862 312
109 3300005618 Ga0068864_100053054 Ga0068864_1000530543 312
110 3300005840 Ga0068870_10025568 Ga0068870_100255683 312
111 3300005840 Ga0068870_10057325 Ga0068870_100573252 312
112 3300005841 Ga0068863_100006594 Ga0068863_1000065948 312
113 3300005841 Ga0068863_100038012 Ga0068863_1000380122 312
114 3300005842 Ga0068858_100085282 Ga0068858_1000852822 312
115 3300005843 Ga0068860_100161920 Ga0068860_1001619202 312
116 3300005844 Ga0068862_100338263 Ga0068862_1003382632 312
117 3300006173 Ga0070716_100033895 Ga0070716_1000338952 312
118 3300006237 Ga0097621_100028707 Ga0097621_1000287073 312
119 3300006846 Ga0075430_100078262 Ga0075430_1000782623 312
120 3300006847 Ga0075431_100080531 Ga0075431_1000805311 312
121 3300006871 Ga0075434_100176480 Ga0075434_1001764802 312
122 3300006880 Ga0075429_100069147 Ga0075429_1000691473 312
123 3300006881 Ga0068865_100022500 Ga0068865_1000225003 312
124 3300009094 Ga0111539_10005784 Ga0111539_1000578413 312
125 3300009148 Ga0105243_10033416 Ga0105243_100334163 312
126 3300009174 Ga0105241_10186033 Ga0105241_101860332 312
127 3300009176 Ga0105242_10024809 Ga0105242_100248094 312
128 3300009176 Ga0105242_10276169 Ga0105242_102761691 312
129 3300009177 Ga0105248_10281678 Ga0105248_102816781 312
130 3300011119 Ga0105246_10046511 Ga0105246_100465113 312
131 3300013296 Ga0157374_10454326 Ga0157374_104543261 312
132 3300013297 Ga0157378_10010686 Ga0157378_100106862 312
133 3300013308 Ga0157375_10190710 Ga0157375_101907102 312
134 3300014325 Ga0163163_10126716 Ga0163163_101267162 312
135 3300014326 Ga0157380_10067960 Ga0157380_100679603 312
136 3300014745 Ga0157377_10060073 Ga0157377_100600732 312
137 3300014969 Ga0157376_10139568 Ga0157376_101395682 312
138 3300017792 Ga0163161_10039470 Ga0163161_100394702 312
139 3300025908 Ga0207643_10001960 Ga0207643_100019608 312
140 3300025908 Ga0207643_10024585 Ga0207643_100245852 312
141 3300025911 Ga0207654_10106836 Ga0207654_101068362 312
142 3300025918 Ga0207662_10004086 Ga0207662_100040866 312
143 3300025925 Ga0207650_10090633 Ga0207650_100906332 312
144 3300025935 Ga0207709_10050976 Ga0207709_100509763 312
145 3300025936 Ga0207670_10000533 Ga0207670_100005336 312
146 3300025938 Ga0207704_10044101 Ga0207704_100441012 312
147 3300025939 Ga0207665_10037935 Ga0207665_100379353 312
148 3300025940 Ga0207691_10032858 Ga0207691_100328582 312
149 3300025941 Ga0207711_10211992 Ga0207711_102119922 312
150 3300025942 Ga0207689_10000667 Ga0207689_1000066729 312
151 3300025942 Ga0207689_10068685 Ga0207689_100686852 312
152 3300025961 Ga0207712_10173000 Ga0207712_101730002 312
153 3300025986 Ga0207658_10033902 Ga0207658_100339023 312
154 3300026035 Ga0207703_10328492 Ga0207703_103284922 312
155 3300026088 Ga0207641_10048368 Ga0207641_100483681 312
156 3300026088 Ga0207641_10104771 Ga0207641_101047712 312
157 3300026089 Ga0207648_10051326 Ga0207648_100513263 312
158 3300026089 Ga0207648_10260649 Ga0207648_102606492 312
159 3300026095 Ga0207676_10155943 Ga0207676_101559432 312
160 3300026095 Ga0207676_10196436 Ga0207676_101964362 312
161 3300026095 Ga0207676_10249280 Ga0207676_102492802 312
162 3300026121 Ga0207683_10029817 Ga0207683_100298172 312
163 3300026142 Ga0207698_10056181 Ga0207698_100561813 312
164 3300027907 Ga0207428_10053068 Ga0207428_100530682 312
165 3300028380 Ga0268265_10031265 Ga0268265_100312653 312
166 3300028380 Ga0268265_10120948 Ga0268265_101209482 312
167 3300046522 Ga0495643_0035171 Ga0495643_0035171_285_1238 312
168 3300048909 Ga0496106_0439517 Ga0496106_0439517_59_1015 312
169 3300048915 Ga0496112_0106364 Ga0496112_0106364_681_1637 312
170 3300049519 Ga0501296_004996 Ga0501296_004996_68_1024 312
171 3300049520 Ga0501297_004023 Ga0501297_004023_205_1161 312
172 3300049521 Ga0501298_000628 Ga0501298_000628_940_1896 312
173 3300049521 Ga0501298_002419 Ga0501298_002419_526_1485 312
174 3300049522 Ga0501299_002052 Ga0501299_002052_610_1566 312
175 3300049574 Ga0501038_0008718 Ga0501038_0008718_3176_4132 312
176 3300049661 Ga0501217_012576 Ga0501217_012576_291_1250 312
177 3300049669 Ga0501235_002924 Ga0501235_002924_451_1407 312
178 3300050508 nmdc:mga09592_47223_c1 nmdc:mga09592_47223_c1_1154_2110 312
179 3300050510 nmdc:mga06r32_411054_c1 nmdc:mga06r32_411054_c1_250_1206 312
180 3300050511 nmdc:mga08y16_111655_c1 nmdc:mga08y16_111655_c1_669_1622 312
181 3300050512 nmdc:mga0n895_477019_c1 nmdc:mga0n895_477019_c1_158_1117 312
182 3300050514 nmdc:mga08x19_133836_c1 nmdc:mga08x19_133836_c1_448_1407 312
183 3300005336 Ga0070680_100084412 Ga0070680_1000844122 313
184 3300005344 Ga0070661_100037219 Ga0070661_1000372192 313
185 3300005345 Ga0070692_10099788 Ga0070692_100997882 313
186 3300005366 Ga0070659_100003892 Ga0070659_1000038923 313
187 3300005441 Ga0070700_100000160 Ga0070700_10000016029 313
188 3300005444 Ga0070694_100012039 Ga0070694_1000120394 313
189 3300005444 Ga0070694_100093373 Ga0070694_1000933732 313
190 3300005455 Ga0070663_100086481 Ga0070663_1000864812 313
191 3300005458 Ga0070681_10017184 Ga0070681_100171842 313
192 3300005539 Ga0068853_100047085 Ga0068853_1000470852 313
193 3300005545 Ga0070695_100127667 Ga0070695_1001276672 313
194 3300005564 Ga0070664_100048673 Ga0070664_1000486732 313
195 3300005577 Ga0068857_100005840 Ga0068857_1000058407 313
196 3300005577 Ga0068857_100399078 Ga0068857_1003990782 313
197 3300005617 Ga0068859_100054620 Ga0068859_1000546203 313
198 3300005617 Ga0068859_100386909 Ga0068859_1003869092 313
199 3300005618 Ga0068864_100052197 Ga0068864_1000521972 313
200 3300005985 Ga0081539_10000600 Ga0081539_1000060040 313
201 3300006931 Ga0097620_100054618 Ga0097620_1000546182 313
202 3300006931 Ga0097620_100386928 Ga0097620_1003869282 313
203 3300009177 Ga0105248_10017920 Ga0105248_100179206 313
204 3300009177 Ga0105248_10123035 Ga0105248_101230353 313
205 3300010375 Ga0105239_10659571 Ga0105239_106595711 313
206 3300013100 Ga0157373_10017404 Ga0157373_100174044 313
207 3300013306 Ga0163162_10009830 Ga0163162_100098303 313
208 3300013307 Ga0157372_10063147 Ga0157372_100631473 313
209 3300013307 Ga0157372_10406711 Ga0157372_104067112 313
210 3300014325 Ga0163163_10025292 Ga0163163_100252925 313
211 3300014968 Ga0157379_10151373 Ga0157379_101513732 313
212 3300025912 Ga0207707_10000335 Ga0207707_1000033541 313
213 3300025921 Ga0207652_10049232 Ga0207652_100492323 313
214 3300025932 Ga0207690_10008850 Ga0207690_100088502 313
215 3300025941 Ga0207711_10001579 Ga0207711_1000157911 313
216 3300026041 Ga0207639_10037227 Ga0207639_100372273 313
217 3300026075 Ga0207708_10003087 Ga0207708_100030879 313
218 3300026095 Ga0207676_10042237 Ga0207676_100422372 313
219 3300026116 Ga0207674_10000077 Ga0207674_1000007780 313
220 3300026116 Ga0207674_10127199 Ga0207674_101271992 313
221 3300028381 Ga0268264_10291918 Ga0268264_102919182 313
222 3300031852 Ga0307410_10046665 Ga0307410_100466653 313
223 3300031901 Ga0307406_10017630 Ga0307406_100176304 313
224 3300032002 Ga0307416_100014278 Ga0307416_1000142783 313
225 3300032004 Ga0307414_10192223 Ga0307414_101922232 313
226 3300032126 Ga0307415_100022212 Ga0307415_1000222123 313
227 3300042012 Ga0439455_0004820 Ga0439455_0004820_35_991 313
228 3300048915 Ga0496112_0194442 Ga0496112_0194442_321_1277 313
229 3300049652 Ga0501202_002092 Ga0501202_002092_1613_2569 313
230 3300049654 Ga0501207_002042 Ga0501207_002042_1454_2410 313
231 3300049660 Ga0501216_003076 Ga0501216_003076_13_969 313
232 3300049661 Ga0501217_001684 Ga0501217_001684_1682_2638 313
233 3300049665 Ga0501227_007444 Ga0501227_007444_514_1470 313
234 3300049668 Ga0501233_005021 Ga0501233_005021_1052_2008 313
235 3300049688 Ga0501259_001350 Ga0501259_001350_3146_4102 313
236 3300049689 Ga0501260_001411 Ga0501260_001411_999_1955 313
237 3300049705 Ga0501225_0002845 Ga0501225_0002845_950_1906 313
238 3300049706 Ga0501229_003663 Ga0501229_003663_692_1648 313
239 3300049853 Ga0501226_000729 Ga0501226_000729_2611_3567 313
240 3300002459 JGI24751J29686_10000057 JGI24751J29686_100000578 314
241 3300002459 JGI24751J29686_10000130 JGI24751J29686_1000013011 314
242 3300003203 JGI25406J46586_10004357 JGI25406J46586_100043573 314
243 3300005288 Ga0065714_10002185 Ga0065714_1000218576 314
244 3300005290 Ga0065712_10067734 Ga0065712_1006773485 314
245 3300005293 Ga0065715_10096492 Ga0065715_100964923 314
246 3300005295 Ga0065707_10186804 Ga0065707_101868042 314
247 3300005331 Ga0070670_100003910 Ga0070670_1000039108 314
248 3300005331 Ga0070670_100104593 Ga0070670_1001045932 314
249 3300005337 Ga0070682_100173109 Ga0070682_1001731092 314
250 3300005345 Ga0070692_10023236 Ga0070692_100232362 314
251 3300005345 Ga0070692_10066840 Ga0070692_100668402 314
252 3300005366 Ga0070659_100315712 Ga0070659_1003157122 314
253 3300005406 Ga0070703_10001808 Ga0070703_100018083 314
254 3300005440 Ga0070705_100032271 Ga0070705_1000322713 314
255 3300005441 Ga0070700_100087771 Ga0070700_1000877712 314
256 3300005444 Ga0070694_100015044 Ga0070694_1000150444 314
257 3300005458 Ga0070681_10291255 Ga0070681_102912552 314
258 3300005467 Ga0070706_100001130 Ga0070706_1000011302 314
259 3300005471 Ga0070698_100063904 Ga0070698_1000639042 314
260 3300005518 Ga0070699_100119242 Ga0070699_1001192422 314
261 3300005518 Ga0070699_100184468 Ga0070699_1001844682 314
262 3300005518 Ga0070699_100325867 Ga0070699_1003258672 314
263 3300005545 Ga0070695_100023604 Ga0070695_1000236042 314
264 3300005547 Ga0070693_100024221 Ga0070693_1000242213 314
265 3300005615 Ga0070702_100034498 Ga0070702_1000344983 314
266 3300005616 Ga0068852_100093068 Ga0068852_1000930682 314
267 3300005618 Ga0068864_100047566 Ga0068864_1000475662 314
268 3300005618 Ga0068864_100108175 Ga0068864_1001081752 314
269 3300005618 Ga0068864_100159215 Ga0068864_1001592152 314
270 3300005834 Ga0068851_10001944 Ga0068851_100019442 314
271 3300005841 Ga0068863_100062800 Ga0068863_1000628003 314
272 3300005841 Ga0068863_100085367 Ga0068863_1000853672 314
273 3300005842 Ga0068858_100137246 Ga0068858_1001372462 314
274 3300005842 Ga0068858_100233429 Ga0068858_1002334292 314
275 3300005843 Ga0068860_100071551 Ga0068860_1000715513 314
276 3300005843 Ga0068860_100093848 Ga0068860_1000938482 314
277 3300005843 Ga0068860_100228683 Ga0068860_1002286832 314
278 3300005843 Ga0068860_100508399 Ga0068860_1005083991 314
279 3300005985 Ga0081539_10001856 Ga0081539_100018562 314
280 3300006237 Ga0097621_100003003 Ga0097621_1000030033 314
281 3300006237 Ga0097621_100019873 Ga0097621_1000198732 314
282 3300006358 Ga0068871_100053723 Ga0068871_1000537232 314
283 3300006844 Ga0075428_100114279 Ga0075428_1001142792 314
284 3300006852 Ga0075433_10082616 Ga0075433_100826162 314
285 3300006871 Ga0075434_100083014 Ga0075434_1000830143 314
286 3300006871 Ga0075434_100381430 Ga0075434_1003814302 314
287 3300007076 Ga0075435_100023232 Ga0075435_1000232324 314
288 3300009093 Ga0105240_10111832 Ga0105240_101118322 314
289 3300009094 Ga0111539_10017280 Ga0111539_100172806 314
290 3300009147 Ga0114129_10537220 Ga0114129_105372202 314
291 3300009148 Ga0105243_10134637 Ga0105243_101346372 314
292 3300009174 Ga0105241_10037956 Ga0105241_100379563 314
293 3300009174 Ga0105241_10408504 Ga0105241_104085042 314
294 3300009176 Ga0105242_10241376 Ga0105242_102413762 314
295 3300009545 Ga0105237_10016717 Ga0105237_100167176 314
296 3300009551 Ga0105238_10118452 Ga0105238_101184522 314
297 3300009551 Ga0105238_10175196 Ga0105238_101751962 314
298 3300009553 Ga0105249_10139567 Ga0105249_101395673 314
299 3300011119 Ga0105246_10074343 Ga0105246_100743432 314
300 3300013100 Ga0157373_10002635 Ga0157373_1000263510 314
301 3300013306 Ga0163162_10086422 Ga0163162_100864224 314
302 3300013306 Ga0163162_10138136 Ga0163162_101381363 314
303 3300013306 Ga0163162_10441219 Ga0163162_104412192 314
304 3300014325 Ga0163163_10072233 Ga0163163_100722332 314
305 3300014325 Ga0163163_10107855 Ga0163163_101078552 314
306 3300014325 Ga0163163_10119252 Ga0163163_101192522 314
307 3300014745 Ga0157377_10195276 Ga0157377_101952762 314
308 3300025321 Ga0207656_10003633 Ga0207656_100036335 314
309 3300025885 Ga0207653_10002464 Ga0207653_100024644 314
310 3300025904 Ga0207647_10003641 Ga0207647_100036413 314
311 3300025904 Ga0207647_10160895 Ga0207647_101608951 314
312 3300025908 Ga0207643_10011980 Ga0207643_100119802 314
313 3300025910 Ga0207684_10000023 Ga0207684_10000023252 314
314 3300025913 Ga0207695_10102848 Ga0207695_101028482 314
315 3300025914 Ga0207671_10002078 Ga0207671_1000207812 314
316 3300025921 Ga0207652_10103510 Ga0207652_101035102 314
317 3300025922 Ga0207646_10192023 Ga0207646_101920232 314
318 3300025923 Ga0207681_10194361 Ga0207681_101943611 314
319 3300025924 Ga0207694_10008080 Ga0207694_100080806 314
320 3300025925 Ga0207650_10000001 Ga0207650_10000001621 314
321 3300025925 Ga0207650_10076194 Ga0207650_100761942 314
322 3300025934 Ga0207686_10161034 Ga0207686_101610342 314
323 3300025935 Ga0207709_10105364 Ga0207709_101053642 314
324 3300025942 Ga0207689_10277651 Ga0207689_102776511 314
325 3300025942 Ga0207689_10405376 Ga0207689_104053762 314
326 3300025949 Ga0207667_10272884 Ga0207667_102728842 314
327 3300025961 Ga0207712_10006513 Ga0207712_100065132 314
328 3300026035 Ga0207703_10474718 Ga0207703_104747182 314
329 3300026041 Ga0207639_10095496 Ga0207639_100954962 314
330 3300026075 Ga0207708_10151255 Ga0207708_101512552 314
331 3300026089 Ga0207648_10351440 Ga0207648_103514401 314
332 3300026095 Ga0207676_10081221 Ga0207676_100812213 314
333 3300026095 Ga0207676_10112982 Ga0207676_101129822 314
334 3300026095 Ga0207676_10234537 Ga0207676_102345372 314
335 3300026095 Ga0207676_10441152 Ga0207676_104411522 314
336 3300026116 Ga0207674_10487615 Ga0207674_104876152 314
337 3300026118 Ga0207675_100045697 Ga0207675_1000456973 314
338 3300026142 Ga0207698_10250408 Ga0207698_102504082 314
339 3300028380 Ga0268265_10099671 Ga0268265_100996712 314
340 3300028381 Ga0268264_10072847 Ga0268264_100728472 314
341 3300028381 Ga0268264_10210226 Ga0268264_102102262 314
342 3300031901 Ga0307406_10081326 Ga0307406_100813262 314
343 3300031911 Ga0307412_10443109 Ga0307412_104431091 314
344 3300035091 Ga0373951_0000768 Ga0373951_0000768_4436_5395 314
345 3300038443 Ga0395901_0168082 Ga0395901_0168082_78_1043 314
346 3300044673 Ga0453683_0178337 Ga0453683_0178337_185_1153 314
347 3300049661 Ga0501217_012520 Ga0501217_012520_439_1407 314
348 3300049664 Ga0501224_001333 Ga0501224_001333_1412_2380 314
349 3300049665 Ga0501227_015060 Ga0501227_015060_153_1121 314
350 3300049707 Ga0501234_005774 Ga0501234_005774_612_1580 314
351 3300050507 nmdc:mga05p37_316098_c1 nmdc:mga05p37_316098_c1_358_1389 314
352 3300050511 nmdc:mga08y16_430160_c1 nmdc:mga08y16_430160_c1_23_991 314
353 3300050512 nmdc:mga0n895_300856_c1 nmdc:mga0n895_300856_c1_219_1190 314
354 3300050513 nmdc:mga0rr50_18492_c1 nmdc:mga0rr50_18492_c1_3048_4013 314
355 3300050515 nmdc:mga0a205_520429_c1 nmdc:mga0a205_520429_c1_69_1034 314
356 3300050515 nmdc:mga0a205_80497_c1 nmdc:mga0a205_80497_c1_923_1894 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07949

YbbR

YbbR-like protein

176

258

0.84

PF07949

YbbR

YbbR-like protein

78

166

0.81

Feature Viewer

pLDDT pTM Quality
78.51 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map