F420474
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 356 | 182 | 356 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10017280|Ga0111539_100172806 |
| Length | 343 |
| Sequence | MNADRICVHLRKSAVQIRETYMPFQDIDEVTPLEHPRPAPSRVEKLLRRIFLEDWSLKLLSLAIAIVLWLLVTGQNEPVTAHVNVQLNLIRPPSLEISNDPPRTVDVMLTGSRNKLDDLTTLDLVATVDISDQRAGERVLRLADKAQISLPQGIKVNGFQPSAIPIRLEPILERQVPVEPKLEGKPADGFEVYAIHPSKGSVTVRGPESRVNALQKVVTESIWLAGHKERFTATNLALDVPDPKLDLLEPIISVDVEIGEQRTEKNFSGVNVSTADGGKVQPETTSVTLSGATSLLDSLKAEDIKIVLDAVGSNLEPRLELPQPLNGKVFLKSVHASKFVPLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 144 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 145 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 149 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 150 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 151 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 152 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 153 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 154 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 156 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 157 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 158 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 159 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 160 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 163 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 164 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 165 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 166 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 167 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 169 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 170 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 171 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 172 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 173 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 174 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.12 |
| Rhizosphere | 98.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000057 | 3300002459 | Bacteria | 62893 |
| 2 | JGI24751J29686_10000130 | 3300002459 | Bacteria | 37822 |
| 3 | JGI25406J46586_10004357 | 3300003203 | Bacteria | 6604 |
| 4 | rootL2_10167105 | 3300003322 | Unclassified | 2917 |
| 5 | Ga0065714_10002185 | 3300005288 | Bacteria | 199213 |
| 6 | Ga0065704_10097241 | 3300005289 | Bacteria | 2403 |
| 7 | Ga0065712_10036144 | 3300005290 | Bacteria | 1689 |
| 8 | Ga0065712_10067734 | 3300005290 | Bacteria | 110577 |
| 9 | Ga0065715_10036894 | 3300005293 | Unclassified | 1315 |
| 10 | Ga0065715_10096492 | 3300005293 | Bacteria | 3869 |
| 11 | Ga0065715_10177516 | 3300005293 | Bacteria | 1500 |
| 12 | Ga0065707_10001542 | 3300005295 | Bacteria | 9328 |
| 13 | Ga0065707_10186804 | 3300005295 | Bacteria | 1384 |
| 14 | Ga0070690_100008632 | 3300005330 | Bacteria | 5876 |
| 15 | Ga0070670_100003910 | 3300005331 | Bacteria | 12427 |
| 16 | Ga0070670_100041661 | 3300005331 | Bacteria | 3946 |
| 17 | Ga0070670_100104593 | 3300005331 | Bacteria | 2439 |
| 18 | Ga0070670_100217216 | 3300005331 | Bacteria | 1663 |
| 19 | Ga0068869_100053743 | 3300005334 | Unclassified | 2929 |
| 20 | Ga0068869_100054607 | 3300005334 | Bacteria | 2909 |
| 21 | Ga0068869_100172609 | 3300005334 | Bacteria | 1690 |
| 22 | Ga0070680_100084412 | 3300005336 | Bacteria | 2623 |
| 23 | Ga0070680_100346968 | 3300005336 | Bacteria | 1262 |
| 24 | Ga0070682_100173109 | 3300005337 | Bacteria | 1502 |
| 25 | Ga0070689_100002248 | 3300005340 | Bacteria | 12540 |
| 26 | Ga0070689_100214400 | 3300005340 | Bacteria | 1577 |
| 27 | Ga0070661_100037219 | 3300005344 | Bacteria | 3539 |
| 28 | Ga0070692_10023236 | 3300005345 | Bacteria | 3036 |
| 29 | Ga0070692_10066840 | 3300005345 | Bacteria | 1906 |
| 30 | Ga0070692_10099788 | 3300005345 | Bacteria | 1590 |
| 31 | Ga0070675_100037129 | 3300005354 | Bacteria | 3967 |
| 32 | Ga0070673_100025218 | 3300005364 | Bacteria | 4372 |
| 33 | Ga0070673_100063701 | 3300005364 | Bacteria | 2934 |
| 34 | Ga0070673_100180785 | 3300005364 | Bacteria | 1805 |
| 35 | Ga0070688_100076777 | 3300005365 | Bacteria | 2151 |
| 36 | Ga0070659_100003892 | 3300005366 | Bacteria | 10636 |
| 37 | Ga0070659_100315712 | 3300005366 | Bacteria | 1305 |
| 38 | Ga0070703_10001808 | 3300005406 | Bacteria | 6321 |
| 39 | Ga0070701_10076805 | 3300005438 | Bacteria | 1798 |
| 40 | Ga0070705_100032271 | 3300005440 | Bacteria | 2908 |
| 41 | Ga0070700_100000160 | 3300005441 | Bacteria | 38863 |
| 42 | Ga0070700_100087771 | 3300005441 | Bacteria | 2022 |
| 43 | Ga0070700_100267262 | 3300005441 | Bacteria | 1234 |
| 44 | Ga0070694_100012039 | 3300005444 | Bacteria | 5371 |
| 45 | Ga0070694_100015044 | 3300005444 | Bacteria | 4850 |
| 46 | Ga0070694_100041698 | 3300005444 | Bacteria | 3063 |
| 47 | Ga0070694_100093373 | 3300005444 | Bacteria | 2115 |
| 48 | Ga0070694_100104014 | 3300005444 | Unclassified | 2013 |
| 49 | Ga0070663_100086481 | 3300005455 | Unclassified | 2315 |
| 50 | Ga0070678_100015951 | 3300005456 | Bacteria | 4788 |
| 51 | Ga0070681_10017184 | 3300005458 | Bacteria | 7233 |
| 52 | Ga0070681_10291255 | 3300005458 | Bacteria | 1542 |
| 53 | Ga0068867_100055578 | 3300005459 | Bacteria | 2927 |
| 54 | Ga0068867_100172728 | 3300005459 | Bacteria | 1713 |
| 55 | Ga0070706_100001130 | 3300005467 | Bacteria | 28845 |
| 56 | Ga0070698_100046287 | 3300005471 | Bacteria | 4448 |
| 57 | Ga0070698_100048160 | 3300005471 | Bacteria | 4356 |
| 58 | Ga0070698_100063904 | 3300005471 | Bacteria | 3710 |
| 59 | Ga0070699_100119242 | 3300005518 | Bacteria | 2319 |
| 60 | Ga0070699_100184468 | 3300005518 | Bacteria | 1852 |
| 61 | Ga0070699_100325867 | 3300005518 | Bacteria | 1381 |
| 62 | Ga0068853_100047085 | 3300005539 | Bacteria | 3700 |
| 63 | Ga0070672_100004840 | 3300005543 | Bacteria | 8848 |
| 64 | Ga0070686_100087879 | 3300005544 | Bacteria | 2073 |
| 65 | Ga0070695_100023604 | 3300005545 | Bacteria | 3783 |
| 66 | Ga0070695_100127667 | 3300005545 | Bacteria | 1748 |
| 67 | Ga0070696_100179994 | 3300005546 | Unclassified | 1568 |
| 68 | Ga0070693_100010817 | 3300005547 | Bacteria | 4579 |
| 69 | Ga0070693_100024221 | 3300005547 | Bacteria | 3253 |
| 70 | Ga0070704_100015680 | 3300005549 | Bacteria | 4768 |
| 71 | Ga0070664_100048673 | 3300005564 | Bacteria | 3582 |
| 72 | Ga0070664_100196528 | 3300005564 | Bacteria | 1798 |
| 73 | Ga0070664_100545719 | 3300005564 | Bacteria | 1072 |
| 74 | Ga0068857_100005840 | 3300005577 | Bacteria | 10511 |
| 75 | Ga0068857_100399078 | 3300005577 | Unclassified | 1279 |
| 76 | Ga0070702_100004186 | 3300005615 | Bacteria | 6563 |
| 77 | Ga0070702_100018148 | 3300005615 | Bacteria | 3644 |
| 78 | Ga0070702_100034498 | 3300005615 | Bacteria | 2789 |
| 79 | Ga0068852_100093068 | 3300005616 | Bacteria | 2701 |
| 80 | Ga0068859_100054620 | 3300005617 | Bacteria | 4018 |
| 81 | Ga0068859_100073963 | 3300005617 | Bacteria | 3446 |
| 82 | Ga0068859_100076256 | 3300005617 | Bacteria | 3393 |
| 83 | Ga0068859_100141953 | 3300005617 | Bacteria | 2475 |
| 84 | Ga0068859_100386909 | 3300005617 | Bacteria | 1494 |
| 85 | Ga0068864_100047566 | 3300005618 | Bacteria | 3685 |
| 86 | Ga0068864_100052197 | 3300005618 | Bacteria | 3524 |
| 87 | Ga0068864_100053054 | 3300005618 | Bacteria | 3496 |
| 88 | Ga0068864_100108175 | 3300005618 | Bacteria | 2474 |
| 89 | Ga0068864_100159215 | 3300005618 | Bacteria | 2051 |
| 90 | Ga0068864_100478517 | 3300005618 | Bacteria | 1195 |
| 91 | Ga0068861_100015521 | 3300005719 | Bacteria | 5369 |
| 92 | Ga0068851_10001944 | 3300005834 | Bacteria | 9081 |
| 93 | Ga0068870_10025568 | 3300005840 | Bacteria | 2932 |
| 94 | Ga0068870_10057325 | 3300005840 | Bacteria | 2082 |
| 95 | Ga0068863_100006594 | 3300005841 | Bacteria | 11390 |
| 96 | Ga0068863_100038012 | 3300005841 | Bacteria | 4580 |
| 97 | Ga0068863_100062800 | 3300005841 | Bacteria | 3513 |
| 98 | Ga0068863_100085367 | 3300005841 | Bacteria | 2991 |
| 99 | Ga0068863_100173901 | 3300005841 | Bacteria | 2066 |
| 100 | Ga0068858_100085282 | 3300005842 | Bacteria | 2938 |
| 101 | Ga0068858_100137246 | 3300005842 | Bacteria | 2295 |
| 102 | Ga0068858_100233429 | 3300005842 | Bacteria | 1744 |
| 103 | Ga0068858_100334038 | 3300005842 | Bacteria | 1450 |
| 104 | Ga0068858_100411057 | 3300005842 | Unclassified | 1301 |
| 105 | Ga0068860_100071551 | 3300005843 | Bacteria | 3295 |
| 106 | Ga0068860_100080741 | 3300005843 | Bacteria | 3092 |
| 107 | Ga0068860_100093848 | 3300005843 | Bacteria | 2860 |
| 108 | Ga0068860_100161920 | 3300005843 | Bacteria | 2158 |
| 109 | Ga0068860_100228683 | 3300005843 | Bacteria | 1807 |
| 110 | Ga0068860_100508399 | 3300005843 | Bacteria | 1203 |
| 111 | Ga0068862_100208036 | 3300005844 | Bacteria | 1767 |
| 112 | Ga0068862_100338263 | 3300005844 | Bacteria | 1393 |
| 113 | Ga0081539_10000600 | 3300005985 | Bacteria | 73358 |
| 114 | Ga0081539_10001856 | 3300005985 | Bacteria | 33258 |
| 115 | Ga0070716_100033895 | 3300006173 | Bacteria | 2796 |
| 116 | Ga0070716_100070643 | 3300006173 | Bacteria | 2051 |
| 117 | Ga0097621_100003003 | 3300006237 | Bacteria | 11587 |
| 118 | Ga0097621_100019873 | 3300006237 | Bacteria | 5166 |
| 119 | Ga0097621_100028707 | 3300006237 | Bacteria | 4387 |
| 120 | Ga0068871_100053723 | 3300006358 | Bacteria | 3266 |
| 121 | Ga0075428_100114279 | 3300006844 | Bacteria | 2941 |
| 122 | Ga0075430_100022535 | 3300006846 | Bacteria | 5360 |
| 123 | Ga0075430_100078262 | 3300006846 | Bacteria | 2772 |
| 124 | Ga0075431_100023531 | 3300006847 | Bacteria | 6304 |
| 125 | Ga0075431_100080531 | 3300006847 | Bacteria | 3362 |
| 126 | Ga0075433_10082616 | 3300006852 | Bacteria | 2833 |
| 127 | Ga0075434_100083014 | 3300006871 | Bacteria | 3202 |
| 128 | Ga0075434_100176480 | 3300006871 | Bacteria | 2156 |
| 129 | Ga0075434_100381430 | 3300006871 | Bacteria | 1430 |
| 130 | Ga0075429_100018127 | 3300006880 | Bacteria | 6092 |
| 131 | Ga0075429_100046039 | 3300006880 | Bacteria | 3796 |
| 132 | Ga0075429_100069147 | 3300006880 | Unclassified | 3074 |
| 133 | Ga0068865_100022500 | 3300006881 | Bacteria | 4113 |
| 134 | Ga0097620_100054618 | 3300006931 | Bacteria | 4018 |
| 135 | Ga0097620_100073963 | 3300006931 | Bacteria | 3446 |
| 136 | Ga0097620_100076252 | 3300006931 | Bacteria | 3393 |
| 137 | Ga0097620_100141955 | 3300006931 | Bacteria | 2475 |
| 138 | Ga0097620_100386928 | 3300006931 | Bacteria | 1494 |
| 139 | Ga0075435_100023232 | 3300007076 | Bacteria | 4792 |
| 140 | Ga0105240_10111832 | 3300009093 | Bacteria | 3303 |
| 141 | Ga0111539_10005784 | 3300009094 | Bacteria | 15980 |
| 142 | Ga0111539_10017280 | 3300009094 | Bacteria | 8927 |
| 143 | Ga0111539_10118594 | 3300009094 | Bacteria | 3102 |
| 144 | Ga0111539_10226096 | 3300009094 | Bacteria | 2179 |
| 145 | Ga0105247_10045269 | 3300009101 | Bacteria | 2699 |
| 146 | Ga0114129_10024802 | 3300009147 | Bacteria | 8501 |
| 147 | Ga0114129_10047028 | 3300009147 | Bacteria | 6064 |
| 148 | Ga0114129_10071520 | 3300009147 | Bacteria | 4837 |
| 149 | Ga0114129_10537220 | 3300009147 | Bacteria | 1522 |
| 150 | Ga0105243_10033416 | 3300009148 | Bacteria | 3978 |
| 151 | Ga0105243_10134637 | 3300009148 | Bacteria | 2101 |
| 152 | Ga0105243_10150301 | 3300009148 | Bacteria | 1997 |
| 153 | Ga0105241_10016414 | 3300009174 | Bacteria | 5431 |
| 154 | Ga0105241_10037956 | 3300009174 | Bacteria | 3632 |
| 155 | Ga0105241_10119011 | 3300009174 | Bacteria | 2124 |
| 156 | Ga0105241_10186033 | 3300009174 | Bacteria | 1726 |
| 157 | Ga0105241_10408504 | 3300009174 | Bacteria | 1193 |
| 158 | Ga0105242_10024809 | 3300009176 | Bacteria | 4738 |
| 159 | Ga0105242_10241376 | 3300009176 | Bacteria | 1624 |
| 160 | Ga0105242_10276169 | 3300009176 | Bacteria | 1524 |
| 161 | Ga0105248_10017920 | 3300009177 | Bacteria | 7814 |
| 162 | Ga0105248_10122099 | 3300009177 | Bacteria | 2938 |
| 163 | Ga0105248_10123035 | 3300009177 | Bacteria | 2927 |
| 164 | Ga0105248_10137132 | 3300009177 | Bacteria | 2760 |
| 165 | Ga0105248_10281678 | 3300009177 | Bacteria | 1872 |
| 166 | Ga0105237_10016717 | 3300009545 | Bacteria | 7617 |
| 167 | Ga0105238_10118452 | 3300009551 | Bacteria | 2628 |
| 168 | Ga0105238_10175196 | 3300009551 | Bacteria | 2122 |
| 169 | Ga0105249_10139567 | 3300009553 | Bacteria | 2322 |
| 170 | Ga0105239_10659571 | 3300010375 | Bacteria | 1195 |
| 171 | Ga0105246_10046511 | 3300011119 | Bacteria | 2960 |
| 172 | Ga0105246_10074343 | 3300011119 | Bacteria | 2402 |
| 173 | Ga0157373_10002635 | 3300013100 | Bacteria | 13612 |
| 174 | Ga0157373_10017404 | 3300013100 | Bacteria | 5236 |
| 175 | Ga0157373_10033182 | 3300013100 | Bacteria | 3715 |
| 176 | Ga0157373_10299884 | 3300013100 | Bacteria | 1140 |
| 177 | Ga0157374_10454326 | 3300013296 | Bacteria | 1283 |
| 178 | Ga0157378_10010686 | 3300013297 | Bacteria | 8024 |
| 179 | Ga0163162_10009830 | 3300013306 | Bacteria | 9305 |
| 180 | Ga0163162_10086422 | 3300013306 | Bacteria | 3214 |
| 181 | Ga0163162_10138136 | 3300013306 | Bacteria | 2548 |
| 182 | Ga0163162_10441219 | 3300013306 | Bacteria | 1434 |
| 183 | Ga0157372_10063147 | 3300013307 | Bacteria | 4152 |
| 184 | Ga0157372_10406711 | 3300013307 | Bacteria | 1586 |
| 185 | Ga0157375_10190710 | 3300013308 | Bacteria | 2204 |
| 186 | Ga0163163_10025292 | 3300014325 | Bacteria | 5660 |
| 187 | Ga0163163_10072233 | 3300014325 | Bacteria | 3440 |
| 188 | Ga0163163_10107855 | 3300014325 | Bacteria | 2811 |
| 189 | Ga0163163_10119252 | 3300014325 | Bacteria | 2671 |
| 190 | Ga0163163_10126716 | 3300014325 | Bacteria | 2591 |
| 191 | Ga0157380_10024015 | 3300014326 | Bacteria | 4608 |
| 192 | Ga0157380_10067960 | 3300014326 | Bacteria | 2871 |
| 193 | Ga0157380_10100088 | 3300014326 | Bacteria | 2412 |
| 194 | Ga0157377_10060073 | 3300014745 | Bacteria | 2169 |
| 195 | Ga0157377_10195276 | 3300014745 | Unclassified | 1281 |
| 196 | Ga0157379_10151373 | 3300014968 | Bacteria | 2093 |
| 197 | Ga0157376_10139568 | 3300014969 | Bacteria | 2173 |
| 198 | Ga0163161_10039470 | 3300017792 | Bacteria | 3389 |
| 199 | Ga0207656_10003633 | 3300025321 | Bacteria | 5327 |
| 200 | Ga0207653_10002464 | 3300025885 | Bacteria | 5882 |
| 201 | Ga0207710_10066006 | 3300025900 | Bacteria | 1650 |
| 202 | Ga0207647_10003641 | 3300025904 | Bacteria | 11526 |
| 203 | Ga0207647_10160895 | 3300025904 | Bacteria | 1310 |
| 204 | Ga0207643_10001960 | 3300025908 | Bacteria | 11372 |
| 205 | Ga0207643_10011980 | 3300025908 | Bacteria | 4682 |
| 206 | Ga0207643_10024585 | 3300025908 | Bacteria | 3324 |
| 207 | Ga0207684_10000023 | 3300025910 | Bacteria | 334838 |
| 208 | Ga0207654_10106836 | 3300025911 | Bacteria | 1734 |
| 209 | Ga0207707_10000335 | 3300025912 | Bacteria | 49647 |
| 210 | Ga0207695_10102848 | 3300025913 | Bacteria | 2849 |
| 211 | Ga0207671_10002078 | 3300025914 | Bacteria | 21911 |
| 212 | Ga0207662_10004086 | 3300025918 | Bacteria | 7626 |
| 213 | Ga0207662_10067481 | 3300025918 | Bacteria | 2157 |
| 214 | Ga0207652_10049232 | 3300025921 | Bacteria | 3607 |
| 215 | Ga0207652_10103510 | 3300025921 | Bacteria | 2517 |
| 216 | Ga0207646_10192023 | 3300025922 | Bacteria | 1844 |
| 217 | Ga0207681_10194361 | 3300025923 | Bacteria | 1554 |
| 218 | Ga0207694_10008080 | 3300025924 | Bacteria | 7951 |
| 219 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 220 | Ga0207650_10076194 | 3300025925 | Bacteria | 2534 |
| 221 | Ga0207650_10090633 | 3300025925 | Bacteria | 2335 |
| 222 | Ga0207690_10008850 | 3300025932 | Bacteria | 5974 |
| 223 | Ga0207706_10078287 | 3300025933 | Unclassified | 2908 |
| 224 | Ga0207706_10194649 | 3300025933 | Unclassified | 1779 |
| 225 | Ga0207686_10161034 | 3300025934 | Bacteria | 1573 |
| 226 | Ga0207709_10050976 | 3300025935 | Bacteria | 2534 |
| 227 | Ga0207709_10078605 | 3300025935 | Bacteria | 2118 |
| 228 | Ga0207709_10105364 | 3300025935 | Bacteria | 1873 |
| 229 | Ga0207670_10000533 | 3300025936 | Bacteria | 20906 |
| 230 | Ga0207670_10140128 | 3300025936 | Bacteria | 1783 |
| 231 | Ga0207704_10044101 | 3300025938 | Bacteria | 2639 |
| 232 | Ga0207665_10037935 | 3300025939 | Bacteria | 3207 |
| 233 | Ga0207665_10176105 | 3300025939 | Bacteria | 1547 |
| 234 | Ga0207691_10032858 | 3300025940 | Bacteria | 4835 |
| 235 | Ga0207711_10001579 | 3300025941 | Bacteria | 21034 |
| 236 | Ga0207711_10030135 | 3300025941 | Bacteria | 4576 |
| 237 | Ga0207711_10211992 | 3300025941 | Bacteria | 1769 |
| 238 | Ga0207711_10228264 | 3300025941 | Bacteria | 1705 |
| 239 | Ga0207689_10000667 | 3300025942 | Bacteria | 32744 |
| 240 | Ga0207689_10028956 | 3300025942 | Bacteria | 4630 |
| 241 | Ga0207689_10068685 | 3300025942 | Unclassified | 2912 |
| 242 | Ga0207689_10265004 | 3300025942 | Bacteria | 1422 |
| 243 | Ga0207689_10277651 | 3300025942 | Bacteria | 1387 |
| 244 | Ga0207689_10405376 | 3300025942 | Unclassified | 1137 |
| 245 | Ga0207679_10209776 | 3300025945 | Bacteria | 1633 |
| 246 | Ga0207667_10272884 | 3300025949 | Bacteria | 1729 |
| 247 | Ga0207712_10006513 | 3300025961 | Bacteria | 7366 |
| 248 | Ga0207712_10173000 | 3300025961 | Bacteria | 1690 |
| 249 | Ga0207640_10079534 | 3300025981 | Bacteria | 2235 |
| 250 | Ga0207640_10091290 | 3300025981 | Bacteria | 2110 |
| 251 | Ga0207658_10033902 | 3300025986 | Bacteria | 3645 |
| 252 | Ga0207703_10328492 | 3300026035 | Bacteria | 1402 |
| 253 | Ga0207703_10474718 | 3300026035 | Unclassified | 1171 |
| 254 | Ga0207639_10037227 | 3300026041 | Bacteria | 3612 |
| 255 | Ga0207639_10095496 | 3300026041 | Bacteria | 2389 |
| 256 | Ga0207708_10003087 | 3300026075 | Bacteria | 12263 |
| 257 | Ga0207708_10151255 | 3300026075 | Bacteria | 1827 |
| 258 | Ga0207641_10048368 | 3300026088 | Bacteria | 3589 |
| 259 | Ga0207641_10094629 | 3300026088 | Bacteria | 2620 |
| 260 | Ga0207641_10104771 | 3300026088 | Bacteria | 2497 |
| 261 | Ga0207641_10223109 | 3300026088 | Bacteria | 1749 |
| 262 | Ga0207648_10051326 | 3300026089 | Bacteria | 3604 |
| 263 | Ga0207648_10260649 | 3300026089 | Bacteria | 1547 |
| 264 | Ga0207648_10351440 | 3300026089 | Bacteria | 1329 |
| 265 | Ga0207676_10042237 | 3300026095 | Bacteria | 3506 |
| 266 | Ga0207676_10081221 | 3300026095 | Bacteria | 2633 |
| 267 | Ga0207676_10112982 | 3300026095 | Bacteria | 2276 |
| 268 | Ga0207676_10155943 | 3300026095 | Bacteria | 1972 |
| 269 | Ga0207676_10196436 | 3300026095 | Bacteria | 1779 |
| 270 | Ga0207676_10231325 | 3300026095 | Unclassified | 1653 |
| 271 | Ga0207676_10234537 | 3300026095 | Bacteria | 1642 |
| 272 | Ga0207676_10249280 | 3300026095 | Bacteria | 1597 |
| 273 | Ga0207676_10441152 | 3300026095 | Bacteria | 1225 |
| 274 | Ga0207674_10000077 | 3300026116 | Bacteria | 104302 |
| 275 | Ga0207674_10127199 | 3300026116 | Bacteria | 2513 |
| 276 | Ga0207674_10273117 | 3300026116 | Bacteria | 1638 |
| 277 | Ga0207674_10487615 | 3300026116 | Bacteria | 1191 |
| 278 | Ga0207675_100026967 | 3300026118 | Bacteria | 5348 |
| 279 | Ga0207675_100045697 | 3300026118 | Bacteria | 4091 |
| 280 | Ga0207675_100108525 | 3300026118 | Bacteria | 2618 |
| 281 | Ga0207683_10029817 | 3300026121 | Bacteria | 4724 |
| 282 | Ga0207698_10056181 | 3300026142 | Bacteria | 3038 |
| 283 | Ga0207698_10250408 | 3300026142 | Bacteria | 1620 |
| 284 | Ga0207428_10053068 | 3300027907 | Bacteria | 3234 |
| 285 | Ga0268265_10031265 | 3300028380 | Bacteria | 3843 |
| 286 | Ga0268265_10099671 | 3300028380 | Bacteria | 2343 |
| 287 | Ga0268265_10120948 | 3300028380 | Bacteria | 2157 |
| 288 | Ga0268264_10072847 | 3300028381 | Bacteria | 2914 |
| 289 | Ga0268264_10210226 | 3300028381 | Bacteria | 1786 |
| 290 | Ga0268264_10291918 | 3300028381 | Bacteria | 1532 |
| 291 | Ga0307410_10046665 | 3300031852 | Bacteria | 2891 |
| 292 | Ga0307406_10017630 | 3300031901 | Bacteria | 4160 |
| 293 | Ga0307406_10081326 | 3300031901 | Bacteria | 2154 |
| 294 | Ga0307412_10443109 | 3300031911 | Unclassified | 1068 |
| 295 | Ga0307416_100014278 | 3300032002 | Bacteria | 5434 |
| 296 | Ga0307416_100345024 | 3300032002 | Bacteria | 1504 |
| 297 | Ga0307414_10192223 | 3300032004 | Bacteria | 1652 |
| 298 | Ga0307415_100022212 | 3300032126 | Bacteria | 3911 |
| 299 | Ga0373951_0000768 | 3300035091 | Bacteria | 8795 |
| 300 | Ga0395901_0168082 | 3300038443 | Unclassified | 2302 |
| 301 | Ga0439455_0004820 | 3300042012 | Bacteria | 2699 |
| 302 | Ga0453683_0178337 | 3300044673 | Unclassified | 1347 |
| 303 | Ga0495643_0035171 | 3300046522 | Bacteria | 2760 |
| 304 | Ga0496106_0439517 | 3300048909 | Bacteria | 1048 |
| 305 | Ga0496108_0044798 | 3300048911 | Bacteria | 3694 |
| 306 | Ga0496112_0106364 | 3300048915 | Bacteria | 2776 |
| 307 | Ga0496112_0194442 | 3300048915 | Bacteria | 1990 |
| 308 | Ga0501291_008280 | 3300049514 | Bacteria | 1433 |
| 309 | Ga0501296_004996 | 3300049519 | Unclassified | 1465 |
| 310 | Ga0501297_004023 | 3300049520 | Bacteria | 1486 |
| 311 | Ga0501298_000628 | 3300049521 | Bacteria | 4858 |
| 312 | Ga0501298_002419 | 3300049521 | Unclassified | 2821 |
| 313 | Ga0501299_002052 | 3300049522 | Bacteria | 2742 |
| 314 | Ga0501299_003286 | 3300049522 | Unclassified | 2329 |
| 315 | Ga0501038_0008718 | 3300049574 | Bacteria | 9306 |
| 316 | Ga0501202_002092 | 3300049652 | Bacteria | 3313 |
| 317 | Ga0501207_002042 | 3300049654 | Bacteria | 2581 |
| 318 | Ga0501216_003076 | 3300049660 | Bacteria | 2415 |
| 319 | Ga0501216_008457 | 3300049660 | Bacteria | 1620 |
| 320 | Ga0501217_001684 | 3300049661 | Bacteria | 4205 |
| 321 | Ga0501217_012520 | 3300049661 | Bacteria | 1891 |
| 322 | Ga0501217_012576 | 3300049661 | Unclassified | 1888 |
| 323 | Ga0501224_001333 | 3300049664 | Bacteria | 3264 |
| 324 | Ga0501227_007444 | 3300049665 | Bacteria | 2344 |
| 325 | Ga0501227_015060 | 3300049665 | Bacteria | 1725 |
| 326 | Ga0501233_005021 | 3300049668 | Bacteria | 2448 |
| 327 | Ga0501235_002924 | 3300049669 | Bacteria | 3678 |
| 328 | Ga0501235_018898 | 3300049669 | Unclassified | 1529 |
| 329 | Ga0501243_006724 | 3300049675 | Unclassified | 1748 |
| 330 | Ga0501257_019295 | 3300049686 | Unclassified | 1594 |
| 331 | Ga0501259_001350 | 3300049688 | Bacteria | 4113 |
| 332 | Ga0501260_001411 | 3300049689 | Bacteria | 1977 |
| 333 | Ga0501225_0002845 | 3300049705 | Bacteria | 5311 |
| 334 | Ga0501229_003663 | 3300049706 | Bacteria | 1845 |
| 335 | Ga0501234_005774 | 3300049707 | Bacteria | 1934 |
| 336 | Ga0501279_008151 | 3300049775 | Unclassified | 1397 |
| 337 | Ga0501283_010128 | 3300049779 | Unclassified | 1384 |
| 338 | Ga0501212_007510 | 3300049851 | Unclassified | 1496 |
| 339 | Ga0501226_000729 | 3300049853 | Bacteria | 4463 |
| 340 | nmdc:mga05p37_316098_c1 | 3300050507 | Bacteria | 1850 |
| 341 | nmdc:mga05p37_444695_c1 | 3300050507 | Bacteria | 1502 |
| 342 | nmdc:mga05p37_89185_c1 | 3300050507 | Bacteria | 3800 |
| 343 | nmdc:mga09592_46916_c1 | 3300050508 | Bacteria | 3640 |
| 344 | nmdc:mga09592_47223_c1 | 3300050508 | Bacteria | 3628 |
| 345 | nmdc:mga09592_68998_c1 | 3300050508 | Bacteria | 2999 |
| 346 | nmdc:mga0qj67_18189_c1 | 3300050509 | Bacteria | 5354 |
| 347 | nmdc:mga06r32_411054_c1 | 3300050510 | Bacteria | 1335 |
| 348 | nmdc:mga08y16_111655_c1 | 3300050511 | Bacteria | 2846 |
| 349 | nmdc:mga08y16_430160_c1 | 3300050511 | Bacteria | 1348 |
| 350 | nmdc:mga08y16_46322_c1 | 3300050511 | Bacteria | 4552 |
| 351 | nmdc:mga0n895_300856_c1 | 3300050512 | Bacteria | 1626 |
| 352 | nmdc:mga0n895_477019_c1 | 3300050512 | Bacteria | 1258 |
| 353 | nmdc:mga0rr50_18492_c1 | 3300050513 | Bacteria | 4683 |
| 354 | nmdc:mga08x19_133836_c1 | 3300050514 | Viruses | 1670 |
| 355 | nmdc:mga0a205_520429_c1 | 3300050515 | Bacteria | 1046 |
| 356 | nmdc:mga0a205_80497_c1 | 3300050515 | Bacteria | 3147 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100054607 | Ga0068869_1000546072 | 267 |
| 2 | 3300005336 | Ga0070680_100346968 | Ga0070680_1003469682 | 275 |
| 3 | 3300005364 | Ga0070673_100063701 | Ga0070673_1000637012 | 277 |
| 4 | 3300005444 | Ga0070694_100104014 | Ga0070694_1001040142 | 277 |
| 5 | 3300014326 | Ga0157380_10024015 | Ga0157380_100240154 | 277 |
| 6 | 3300025933 | Ga0207706_10078287 | Ga0207706_100782872 | 277 |
| 7 | 3300025981 | Ga0207640_10079534 | Ga0207640_100795342 | 277 |
| 8 | 3300009147 | Ga0114129_10047028 | Ga0114129_100470282 | 278 |
| 9 | 3300005719 | Ga0068861_100015521 | Ga0068861_1000155214 | 279 |
| 10 | 3300026118 | Ga0207675_100026967 | Ga0207675_1000269672 | 279 |
| 11 | 3300049669 | Ga0501235_018898 | Ga0501235_018898_48_929 | 288 |
| 12 | 3300013100 | Ga0157373_10299884 | Ga0157373_102998842 | 289 |
| 13 | 3300005564 | Ga0070664_100545719 | Ga0070664_1005457191 | 294 |
| 14 | 3300026116 | Ga0207674_10273117 | Ga0207674_102731172 | 294 |
| 15 | 3300005340 | Ga0070689_100214400 | Ga0070689_1002144001 | 295 |
| 16 | 3300025936 | Ga0207670_10140128 | Ga0207670_101401282 | 295 |
| 17 | 3300013100 | Ga0157373_10033182 | Ga0157373_100331823 | 297 |
| 18 | 3300025981 | Ga0207640_10091290 | Ga0207640_100912902 | 297 |
| 19 | 3300009094 | Ga0111539_10118594 | Ga0111539_101185942 | 299 |
| 20 | 3300005334 | Ga0068869_100172609 | Ga0068869_1001726092 | 300 |
| 21 | 3300005441 | Ga0070700_100267262 | Ga0070700_1002672621 | 300 |
| 22 | 3300005841 | Ga0068863_100173901 | Ga0068863_1001739012 | 300 |
| 23 | 3300025942 | Ga0207689_10265004 | Ga0207689_102650042 | 300 |
| 24 | 3300026088 | Ga0207641_10094629 | Ga0207641_100946292 | 300 |
| 25 | 3300005617 | Ga0068859_100073963 | Ga0068859_1000739632 | 301 |
| 26 | 3300006931 | Ga0097620_100073963 | Ga0097620_1000739632 | 301 |
| 27 | 3300009177 | Ga0105248_10137132 | Ga0105248_101371322 | 301 |
| 28 | 3300025941 | Ga0207711_10030135 | Ga0207711_100301353 | 301 |
| 29 | 3300006173 | Ga0070716_100070643 | Ga0070716_1000706432 | 302 |
| 30 | 3300006880 | Ga0075429_100046039 | Ga0075429_1000460392 | 302 |
| 31 | 3300009147 | Ga0114129_10071520 | Ga0114129_100715202 | 302 |
| 32 | 3300025918 | Ga0207662_10067481 | Ga0207662_100674812 | 302 |
| 33 | 3300025933 | Ga0207706_10194649 | Ga0207706_101946492 | 302 |
| 34 | 3300025939 | Ga0207665_10176105 | Ga0207665_101761052 | 302 |
| 35 | 3300050508 | nmdc:mga09592_68998_c1 | nmdc:mga09592_68998_c1_1532_2485 | 302 |
| 36 | 3300005290 | Ga0065712_10036144 | Ga0065712_100361442 | 303 |
| 37 | 3300005364 | Ga0070673_100180785 | Ga0070673_1001807852 | 303 |
| 38 | 3300005444 | Ga0070694_100041698 | Ga0070694_1000416982 | 303 |
| 39 | 3300005471 | Ga0070698_100048160 | Ga0070698_1000481604 | 303 |
| 40 | 3300005547 | Ga0070693_100010817 | Ga0070693_1000108173 | 303 |
| 41 | 3300005617 | Ga0068859_100141953 | Ga0068859_1001419533 | 303 |
| 42 | 3300005842 | Ga0068858_100334038 | Ga0068858_1003340382 | 303 |
| 43 | 3300006931 | Ga0097620_100141955 | Ga0097620_1001419553 | 303 |
| 44 | 3300009174 | Ga0105241_10016414 | Ga0105241_100164144 | 303 |
| 45 | 3300050507 | nmdc:mga05p37_444695_c1 | nmdc:mga05p37_444695_c1_373_1335 | 304 |
| 46 | 3300005549 | Ga0070704_100015680 | Ga0070704_1000156802 | 305 |
| 47 | 3300009174 | Ga0105241_10119011 | Ga0105241_101190112 | 305 |
| 48 | 3300014326 | Ga0157380_10100088 | Ga0157380_101000883 | 305 |
| 49 | 3300003322 | rootL2_10167105 | rootL2_101671052 | 306 |
| 50 | 3300005564 | Ga0070664_100196528 | Ga0070664_1001965282 | 306 |
| 51 | 3300005618 | Ga0068864_100478517 | Ga0068864_1004785171 | 306 |
| 52 | 3300005844 | Ga0068862_100208036 | Ga0068862_1002080362 | 306 |
| 53 | 3300025945 | Ga0207679_10209776 | Ga0207679_102097761 | 306 |
| 54 | 3300032002 | Ga0307416_100345024 | Ga0307416_1003450242 | 306 |
| 55 | 3300049779 | Ga0501283_010128 | Ga0501283_010128_285_1241 | 306 |
| 56 | 3300009148 | Ga0105243_10150301 | Ga0105243_101503012 | 307 |
| 57 | 3300025935 | Ga0207709_10078605 | Ga0207709_100786052 | 307 |
| 58 | 3300026095 | Ga0207676_10231325 | Ga0207676_102313251 | 307 |
| 59 | 3300049514 | Ga0501291_008280 | Ga0501291_008280_151_1110 | 307 |
| 60 | 3300049522 | Ga0501299_003286 | Ga0501299_003286_1140_2099 | 307 |
| 61 | 3300049660 | Ga0501216_008457 | Ga0501216_008457_130_1089 | 307 |
| 62 | 3300049675 | Ga0501243_006724 | Ga0501243_006724_263_1222 | 307 |
| 63 | 3300049775 | Ga0501279_008151 | Ga0501279_008151_94_1053 | 307 |
| 64 | 3300049851 | Ga0501212_007510 | Ga0501212_007510_478_1437 | 307 |
| 65 | 3300009094 | Ga0111539_10226096 | Ga0111539_102260962 | 308 |
| 66 | 3300049686 | Ga0501257_019295 | Ga0501257_019295_210_1166 | 308 |
| 67 | 3300050511 | nmdc:mga08y16_46322_c1 | nmdc:mga08y16_46322_c1_1610_2578 | 308 |
| 68 | 3300006846 | Ga0075430_100022535 | Ga0075430_1000225352 | 309 |
| 69 | 3300006847 | Ga0075431_100023531 | Ga0075431_1000235315 | 309 |
| 70 | 3300006880 | Ga0075429_100018127 | Ga0075429_1000181274 | 309 |
| 71 | 3300009147 | Ga0114129_10024802 | Ga0114129_100248022 | 309 |
| 72 | 3300050507 | nmdc:mga05p37_89185_c1 | nmdc:mga05p37_89185_c1_341_1294 | 309 |
| 73 | 3300050508 | nmdc:mga09592_46916_c1 | nmdc:mga09592_46916_c1_181_1134 | 309 |
| 74 | 3300050509 | nmdc:mga0qj67_18189_c1 | nmdc:mga0qj67_18189_c1_2666_3619 | 309 |
| 75 | 3300026088 | Ga0207641_10223109 | Ga0207641_102231091 | 310 |
| 76 | 3300026118 | Ga0207675_100108525 | Ga0207675_1001085253 | 310 |
| 77 | 3300048911 | Ga0496108_0044798 | Ga0496108_0044798_1857_2816 | 310 |
| 78 | 3300005293 | Ga0065715_10036894 | Ga0065715_100368942 | 311 |
| 79 | 3300005293 | Ga0065715_10177516 | Ga0065715_101775162 | 311 |
| 80 | 3300005471 | Ga0070698_100046287 | Ga0070698_1000462872 | 311 |
| 81 | 3300005615 | Ga0070702_100018148 | Ga0070702_1000181483 | 311 |
| 82 | 3300005617 | Ga0068859_100076256 | Ga0068859_1000762562 | 311 |
| 83 | 3300005842 | Ga0068858_100411057 | Ga0068858_1004110572 | 311 |
| 84 | 3300005843 | Ga0068860_100080741 | Ga0068860_1000807412 | 311 |
| 85 | 3300006931 | Ga0097620_100076252 | Ga0097620_1000762522 | 311 |
| 86 | 3300009101 | Ga0105247_10045269 | Ga0105247_100452692 | 311 |
| 87 | 3300009177 | Ga0105248_10122099 | Ga0105248_101220992 | 311 |
| 88 | 3300025900 | Ga0207710_10066006 | Ga0207710_100660062 | 311 |
| 89 | 3300025941 | Ga0207711_10228264 | Ga0207711_102282642 | 311 |
| 90 | 3300025942 | Ga0207689_10028956 | Ga0207689_100289562 | 311 |
| 91 | 3300005289 | Ga0065704_10097241 | Ga0065704_100972412 | 312 |
| 92 | 3300005295 | Ga0065707_10001542 | Ga0065707_100015422 | 312 |
| 93 | 3300005330 | Ga0070690_100008632 | Ga0070690_1000086322 | 312 |
| 94 | 3300005331 | Ga0070670_100041661 | Ga0070670_1000416613 | 312 |
| 95 | 3300005331 | Ga0070670_100217216 | Ga0070670_1002172162 | 312 |
| 96 | 3300005334 | Ga0068869_100053743 | Ga0068869_1000537432 | 312 |
| 97 | 3300005340 | Ga0070689_100002248 | Ga0070689_1000022483 | 312 |
| 98 | 3300005354 | Ga0070675_100037129 | Ga0070675_1000371293 | 312 |
| 99 | 3300005364 | Ga0070673_100025218 | Ga0070673_1000252183 | 312 |
| 100 | 3300005365 | Ga0070688_100076777 | Ga0070688_1000767772 | 312 |
| 101 | 3300005438 | Ga0070701_10076805 | Ga0070701_100768052 | 312 |
| 102 | 3300005456 | Ga0070678_100015951 | Ga0070678_1000159512 | 312 |
| 103 | 3300005459 | Ga0068867_100055578 | Ga0068867_1000555782 | 312 |
| 104 | 3300005459 | Ga0068867_100172728 | Ga0068867_1001727282 | 312 |
| 105 | 3300005543 | Ga0070672_100004840 | Ga0070672_1000048402 | 312 |
| 106 | 3300005544 | Ga0070686_100087879 | Ga0070686_1000878792 | 312 |
| 107 | 3300005546 | Ga0070696_100179994 | Ga0070696_1001799942 | 312 |
| 108 | 3300005615 | Ga0070702_100004186 | Ga0070702_1000041862 | 312 |
| 109 | 3300005618 | Ga0068864_100053054 | Ga0068864_1000530543 | 312 |
| 110 | 3300005840 | Ga0068870_10025568 | Ga0068870_100255683 | 312 |
| 111 | 3300005840 | Ga0068870_10057325 | Ga0068870_100573252 | 312 |
| 112 | 3300005841 | Ga0068863_100006594 | Ga0068863_1000065948 | 312 |
| 113 | 3300005841 | Ga0068863_100038012 | Ga0068863_1000380122 | 312 |
| 114 | 3300005842 | Ga0068858_100085282 | Ga0068858_1000852822 | 312 |
| 115 | 3300005843 | Ga0068860_100161920 | Ga0068860_1001619202 | 312 |
| 116 | 3300005844 | Ga0068862_100338263 | Ga0068862_1003382632 | 312 |
| 117 | 3300006173 | Ga0070716_100033895 | Ga0070716_1000338952 | 312 |
| 118 | 3300006237 | Ga0097621_100028707 | Ga0097621_1000287073 | 312 |
| 119 | 3300006846 | Ga0075430_100078262 | Ga0075430_1000782623 | 312 |
| 120 | 3300006847 | Ga0075431_100080531 | Ga0075431_1000805311 | 312 |
| 121 | 3300006871 | Ga0075434_100176480 | Ga0075434_1001764802 | 312 |
| 122 | 3300006880 | Ga0075429_100069147 | Ga0075429_1000691473 | 312 |
| 123 | 3300006881 | Ga0068865_100022500 | Ga0068865_1000225003 | 312 |
| 124 | 3300009094 | Ga0111539_10005784 | Ga0111539_1000578413 | 312 |
| 125 | 3300009148 | Ga0105243_10033416 | Ga0105243_100334163 | 312 |
| 126 | 3300009174 | Ga0105241_10186033 | Ga0105241_101860332 | 312 |
| 127 | 3300009176 | Ga0105242_10024809 | Ga0105242_100248094 | 312 |
| 128 | 3300009176 | Ga0105242_10276169 | Ga0105242_102761691 | 312 |
| 129 | 3300009177 | Ga0105248_10281678 | Ga0105248_102816781 | 312 |
| 130 | 3300011119 | Ga0105246_10046511 | Ga0105246_100465113 | 312 |
| 131 | 3300013296 | Ga0157374_10454326 | Ga0157374_104543261 | 312 |
| 132 | 3300013297 | Ga0157378_10010686 | Ga0157378_100106862 | 312 |
| 133 | 3300013308 | Ga0157375_10190710 | Ga0157375_101907102 | 312 |
| 134 | 3300014325 | Ga0163163_10126716 | Ga0163163_101267162 | 312 |
| 135 | 3300014326 | Ga0157380_10067960 | Ga0157380_100679603 | 312 |
| 136 | 3300014745 | Ga0157377_10060073 | Ga0157377_100600732 | 312 |
| 137 | 3300014969 | Ga0157376_10139568 | Ga0157376_101395682 | 312 |
| 138 | 3300017792 | Ga0163161_10039470 | Ga0163161_100394702 | 312 |
| 139 | 3300025908 | Ga0207643_10001960 | Ga0207643_100019608 | 312 |
| 140 | 3300025908 | Ga0207643_10024585 | Ga0207643_100245852 | 312 |
| 141 | 3300025911 | Ga0207654_10106836 | Ga0207654_101068362 | 312 |
| 142 | 3300025918 | Ga0207662_10004086 | Ga0207662_100040866 | 312 |
| 143 | 3300025925 | Ga0207650_10090633 | Ga0207650_100906332 | 312 |
| 144 | 3300025935 | Ga0207709_10050976 | Ga0207709_100509763 | 312 |
| 145 | 3300025936 | Ga0207670_10000533 | Ga0207670_100005336 | 312 |
| 146 | 3300025938 | Ga0207704_10044101 | Ga0207704_100441012 | 312 |
| 147 | 3300025939 | Ga0207665_10037935 | Ga0207665_100379353 | 312 |
| 148 | 3300025940 | Ga0207691_10032858 | Ga0207691_100328582 | 312 |
| 149 | 3300025941 | Ga0207711_10211992 | Ga0207711_102119922 | 312 |
| 150 | 3300025942 | Ga0207689_10000667 | Ga0207689_1000066729 | 312 |
| 151 | 3300025942 | Ga0207689_10068685 | Ga0207689_100686852 | 312 |
| 152 | 3300025961 | Ga0207712_10173000 | Ga0207712_101730002 | 312 |
| 153 | 3300025986 | Ga0207658_10033902 | Ga0207658_100339023 | 312 |
| 154 | 3300026035 | Ga0207703_10328492 | Ga0207703_103284922 | 312 |
| 155 | 3300026088 | Ga0207641_10048368 | Ga0207641_100483681 | 312 |
| 156 | 3300026088 | Ga0207641_10104771 | Ga0207641_101047712 | 312 |
| 157 | 3300026089 | Ga0207648_10051326 | Ga0207648_100513263 | 312 |
| 158 | 3300026089 | Ga0207648_10260649 | Ga0207648_102606492 | 312 |
| 159 | 3300026095 | Ga0207676_10155943 | Ga0207676_101559432 | 312 |
| 160 | 3300026095 | Ga0207676_10196436 | Ga0207676_101964362 | 312 |
| 161 | 3300026095 | Ga0207676_10249280 | Ga0207676_102492802 | 312 |
| 162 | 3300026121 | Ga0207683_10029817 | Ga0207683_100298172 | 312 |
| 163 | 3300026142 | Ga0207698_10056181 | Ga0207698_100561813 | 312 |
| 164 | 3300027907 | Ga0207428_10053068 | Ga0207428_100530682 | 312 |
| 165 | 3300028380 | Ga0268265_10031265 | Ga0268265_100312653 | 312 |
| 166 | 3300028380 | Ga0268265_10120948 | Ga0268265_101209482 | 312 |
| 167 | 3300046522 | Ga0495643_0035171 | Ga0495643_0035171_285_1238 | 312 |
| 168 | 3300048909 | Ga0496106_0439517 | Ga0496106_0439517_59_1015 | 312 |
| 169 | 3300048915 | Ga0496112_0106364 | Ga0496112_0106364_681_1637 | 312 |
| 170 | 3300049519 | Ga0501296_004996 | Ga0501296_004996_68_1024 | 312 |
| 171 | 3300049520 | Ga0501297_004023 | Ga0501297_004023_205_1161 | 312 |
| 172 | 3300049521 | Ga0501298_000628 | Ga0501298_000628_940_1896 | 312 |
| 173 | 3300049521 | Ga0501298_002419 | Ga0501298_002419_526_1485 | 312 |
| 174 | 3300049522 | Ga0501299_002052 | Ga0501299_002052_610_1566 | 312 |
| 175 | 3300049574 | Ga0501038_0008718 | Ga0501038_0008718_3176_4132 | 312 |
| 176 | 3300049661 | Ga0501217_012576 | Ga0501217_012576_291_1250 | 312 |
| 177 | 3300049669 | Ga0501235_002924 | Ga0501235_002924_451_1407 | 312 |
| 178 | 3300050508 | nmdc:mga09592_47223_c1 | nmdc:mga09592_47223_c1_1154_2110 | 312 |
| 179 | 3300050510 | nmdc:mga06r32_411054_c1 | nmdc:mga06r32_411054_c1_250_1206 | 312 |
| 180 | 3300050511 | nmdc:mga08y16_111655_c1 | nmdc:mga08y16_111655_c1_669_1622 | 312 |
| 181 | 3300050512 | nmdc:mga0n895_477019_c1 | nmdc:mga0n895_477019_c1_158_1117 | 312 |
| 182 | 3300050514 | nmdc:mga08x19_133836_c1 | nmdc:mga08x19_133836_c1_448_1407 | 312 |
| 183 | 3300005336 | Ga0070680_100084412 | Ga0070680_1000844122 | 313 |
| 184 | 3300005344 | Ga0070661_100037219 | Ga0070661_1000372192 | 313 |
| 185 | 3300005345 | Ga0070692_10099788 | Ga0070692_100997882 | 313 |
| 186 | 3300005366 | Ga0070659_100003892 | Ga0070659_1000038923 | 313 |
| 187 | 3300005441 | Ga0070700_100000160 | Ga0070700_10000016029 | 313 |
| 188 | 3300005444 | Ga0070694_100012039 | Ga0070694_1000120394 | 313 |
| 189 | 3300005444 | Ga0070694_100093373 | Ga0070694_1000933732 | 313 |
| 190 | 3300005455 | Ga0070663_100086481 | Ga0070663_1000864812 | 313 |
| 191 | 3300005458 | Ga0070681_10017184 | Ga0070681_100171842 | 313 |
| 192 | 3300005539 | Ga0068853_100047085 | Ga0068853_1000470852 | 313 |
| 193 | 3300005545 | Ga0070695_100127667 | Ga0070695_1001276672 | 313 |
| 194 | 3300005564 | Ga0070664_100048673 | Ga0070664_1000486732 | 313 |
| 195 | 3300005577 | Ga0068857_100005840 | Ga0068857_1000058407 | 313 |
| 196 | 3300005577 | Ga0068857_100399078 | Ga0068857_1003990782 | 313 |
| 197 | 3300005617 | Ga0068859_100054620 | Ga0068859_1000546203 | 313 |
| 198 | 3300005617 | Ga0068859_100386909 | Ga0068859_1003869092 | 313 |
| 199 | 3300005618 | Ga0068864_100052197 | Ga0068864_1000521972 | 313 |
| 200 | 3300005985 | Ga0081539_10000600 | Ga0081539_1000060040 | 313 |
| 201 | 3300006931 | Ga0097620_100054618 | Ga0097620_1000546182 | 313 |
| 202 | 3300006931 | Ga0097620_100386928 | Ga0097620_1003869282 | 313 |
| 203 | 3300009177 | Ga0105248_10017920 | Ga0105248_100179206 | 313 |
| 204 | 3300009177 | Ga0105248_10123035 | Ga0105248_101230353 | 313 |
| 205 | 3300010375 | Ga0105239_10659571 | Ga0105239_106595711 | 313 |
| 206 | 3300013100 | Ga0157373_10017404 | Ga0157373_100174044 | 313 |
| 207 | 3300013306 | Ga0163162_10009830 | Ga0163162_100098303 | 313 |
| 208 | 3300013307 | Ga0157372_10063147 | Ga0157372_100631473 | 313 |
| 209 | 3300013307 | Ga0157372_10406711 | Ga0157372_104067112 | 313 |
| 210 | 3300014325 | Ga0163163_10025292 | Ga0163163_100252925 | 313 |
| 211 | 3300014968 | Ga0157379_10151373 | Ga0157379_101513732 | 313 |
| 212 | 3300025912 | Ga0207707_10000335 | Ga0207707_1000033541 | 313 |
| 213 | 3300025921 | Ga0207652_10049232 | Ga0207652_100492323 | 313 |
| 214 | 3300025932 | Ga0207690_10008850 | Ga0207690_100088502 | 313 |
| 215 | 3300025941 | Ga0207711_10001579 | Ga0207711_1000157911 | 313 |
| 216 | 3300026041 | Ga0207639_10037227 | Ga0207639_100372273 | 313 |
| 217 | 3300026075 | Ga0207708_10003087 | Ga0207708_100030879 | 313 |
| 218 | 3300026095 | Ga0207676_10042237 | Ga0207676_100422372 | 313 |
| 219 | 3300026116 | Ga0207674_10000077 | Ga0207674_1000007780 | 313 |
| 220 | 3300026116 | Ga0207674_10127199 | Ga0207674_101271992 | 313 |
| 221 | 3300028381 | Ga0268264_10291918 | Ga0268264_102919182 | 313 |
| 222 | 3300031852 | Ga0307410_10046665 | Ga0307410_100466653 | 313 |
| 223 | 3300031901 | Ga0307406_10017630 | Ga0307406_100176304 | 313 |
| 224 | 3300032002 | Ga0307416_100014278 | Ga0307416_1000142783 | 313 |
| 225 | 3300032004 | Ga0307414_10192223 | Ga0307414_101922232 | 313 |
| 226 | 3300032126 | Ga0307415_100022212 | Ga0307415_1000222123 | 313 |
| 227 | 3300042012 | Ga0439455_0004820 | Ga0439455_0004820_35_991 | 313 |
| 228 | 3300048915 | Ga0496112_0194442 | Ga0496112_0194442_321_1277 | 313 |
| 229 | 3300049652 | Ga0501202_002092 | Ga0501202_002092_1613_2569 | 313 |
| 230 | 3300049654 | Ga0501207_002042 | Ga0501207_002042_1454_2410 | 313 |
| 231 | 3300049660 | Ga0501216_003076 | Ga0501216_003076_13_969 | 313 |
| 232 | 3300049661 | Ga0501217_001684 | Ga0501217_001684_1682_2638 | 313 |
| 233 | 3300049665 | Ga0501227_007444 | Ga0501227_007444_514_1470 | 313 |
| 234 | 3300049668 | Ga0501233_005021 | Ga0501233_005021_1052_2008 | 313 |
| 235 | 3300049688 | Ga0501259_001350 | Ga0501259_001350_3146_4102 | 313 |
| 236 | 3300049689 | Ga0501260_001411 | Ga0501260_001411_999_1955 | 313 |
| 237 | 3300049705 | Ga0501225_0002845 | Ga0501225_0002845_950_1906 | 313 |
| 238 | 3300049706 | Ga0501229_003663 | Ga0501229_003663_692_1648 | 313 |
| 239 | 3300049853 | Ga0501226_000729 | Ga0501226_000729_2611_3567 | 313 |
| 240 | 3300002459 | JGI24751J29686_10000057 | JGI24751J29686_100000578 | 314 |
| 241 | 3300002459 | JGI24751J29686_10000130 | JGI24751J29686_1000013011 | 314 |
| 242 | 3300003203 | JGI25406J46586_10004357 | JGI25406J46586_100043573 | 314 |
| 243 | 3300005288 | Ga0065714_10002185 | Ga0065714_1000218576 | 314 |
| 244 | 3300005290 | Ga0065712_10067734 | Ga0065712_1006773485 | 314 |
| 245 | 3300005293 | Ga0065715_10096492 | Ga0065715_100964923 | 314 |
| 246 | 3300005295 | Ga0065707_10186804 | Ga0065707_101868042 | 314 |
| 247 | 3300005331 | Ga0070670_100003910 | Ga0070670_1000039108 | 314 |
| 248 | 3300005331 | Ga0070670_100104593 | Ga0070670_1001045932 | 314 |
| 249 | 3300005337 | Ga0070682_100173109 | Ga0070682_1001731092 | 314 |
| 250 | 3300005345 | Ga0070692_10023236 | Ga0070692_100232362 | 314 |
| 251 | 3300005345 | Ga0070692_10066840 | Ga0070692_100668402 | 314 |
| 252 | 3300005366 | Ga0070659_100315712 | Ga0070659_1003157122 | 314 |
| 253 | 3300005406 | Ga0070703_10001808 | Ga0070703_100018083 | 314 |
| 254 | 3300005440 | Ga0070705_100032271 | Ga0070705_1000322713 | 314 |
| 255 | 3300005441 | Ga0070700_100087771 | Ga0070700_1000877712 | 314 |
| 256 | 3300005444 | Ga0070694_100015044 | Ga0070694_1000150444 | 314 |
| 257 | 3300005458 | Ga0070681_10291255 | Ga0070681_102912552 | 314 |
| 258 | 3300005467 | Ga0070706_100001130 | Ga0070706_1000011302 | 314 |
| 259 | 3300005471 | Ga0070698_100063904 | Ga0070698_1000639042 | 314 |
| 260 | 3300005518 | Ga0070699_100119242 | Ga0070699_1001192422 | 314 |
| 261 | 3300005518 | Ga0070699_100184468 | Ga0070699_1001844682 | 314 |
| 262 | 3300005518 | Ga0070699_100325867 | Ga0070699_1003258672 | 314 |
| 263 | 3300005545 | Ga0070695_100023604 | Ga0070695_1000236042 | 314 |
| 264 | 3300005547 | Ga0070693_100024221 | Ga0070693_1000242213 | 314 |
| 265 | 3300005615 | Ga0070702_100034498 | Ga0070702_1000344983 | 314 |
| 266 | 3300005616 | Ga0068852_100093068 | Ga0068852_1000930682 | 314 |
| 267 | 3300005618 | Ga0068864_100047566 | Ga0068864_1000475662 | 314 |
| 268 | 3300005618 | Ga0068864_100108175 | Ga0068864_1001081752 | 314 |
| 269 | 3300005618 | Ga0068864_100159215 | Ga0068864_1001592152 | 314 |
| 270 | 3300005834 | Ga0068851_10001944 | Ga0068851_100019442 | 314 |
| 271 | 3300005841 | Ga0068863_100062800 | Ga0068863_1000628003 | 314 |
| 272 | 3300005841 | Ga0068863_100085367 | Ga0068863_1000853672 | 314 |
| 273 | 3300005842 | Ga0068858_100137246 | Ga0068858_1001372462 | 314 |
| 274 | 3300005842 | Ga0068858_100233429 | Ga0068858_1002334292 | 314 |
| 275 | 3300005843 | Ga0068860_100071551 | Ga0068860_1000715513 | 314 |
| 276 | 3300005843 | Ga0068860_100093848 | Ga0068860_1000938482 | 314 |
| 277 | 3300005843 | Ga0068860_100228683 | Ga0068860_1002286832 | 314 |
| 278 | 3300005843 | Ga0068860_100508399 | Ga0068860_1005083991 | 314 |
| 279 | 3300005985 | Ga0081539_10001856 | Ga0081539_100018562 | 314 |
| 280 | 3300006237 | Ga0097621_100003003 | Ga0097621_1000030033 | 314 |
| 281 | 3300006237 | Ga0097621_100019873 | Ga0097621_1000198732 | 314 |
| 282 | 3300006358 | Ga0068871_100053723 | Ga0068871_1000537232 | 314 |
| 283 | 3300006844 | Ga0075428_100114279 | Ga0075428_1001142792 | 314 |
| 284 | 3300006852 | Ga0075433_10082616 | Ga0075433_100826162 | 314 |
| 285 | 3300006871 | Ga0075434_100083014 | Ga0075434_1000830143 | 314 |
| 286 | 3300006871 | Ga0075434_100381430 | Ga0075434_1003814302 | 314 |
| 287 | 3300007076 | Ga0075435_100023232 | Ga0075435_1000232324 | 314 |
| 288 | 3300009093 | Ga0105240_10111832 | Ga0105240_101118322 | 314 |
| 289 | 3300009094 | Ga0111539_10017280 | Ga0111539_100172806 | 314 |
| 290 | 3300009147 | Ga0114129_10537220 | Ga0114129_105372202 | 314 |
| 291 | 3300009148 | Ga0105243_10134637 | Ga0105243_101346372 | 314 |
| 292 | 3300009174 | Ga0105241_10037956 | Ga0105241_100379563 | 314 |
| 293 | 3300009174 | Ga0105241_10408504 | Ga0105241_104085042 | 314 |
| 294 | 3300009176 | Ga0105242_10241376 | Ga0105242_102413762 | 314 |
| 295 | 3300009545 | Ga0105237_10016717 | Ga0105237_100167176 | 314 |
| 296 | 3300009551 | Ga0105238_10118452 | Ga0105238_101184522 | 314 |
| 297 | 3300009551 | Ga0105238_10175196 | Ga0105238_101751962 | 314 |
| 298 | 3300009553 | Ga0105249_10139567 | Ga0105249_101395673 | 314 |
| 299 | 3300011119 | Ga0105246_10074343 | Ga0105246_100743432 | 314 |
| 300 | 3300013100 | Ga0157373_10002635 | Ga0157373_1000263510 | 314 |
| 301 | 3300013306 | Ga0163162_10086422 | Ga0163162_100864224 | 314 |
| 302 | 3300013306 | Ga0163162_10138136 | Ga0163162_101381363 | 314 |
| 303 | 3300013306 | Ga0163162_10441219 | Ga0163162_104412192 | 314 |
| 304 | 3300014325 | Ga0163163_10072233 | Ga0163163_100722332 | 314 |
| 305 | 3300014325 | Ga0163163_10107855 | Ga0163163_101078552 | 314 |
| 306 | 3300014325 | Ga0163163_10119252 | Ga0163163_101192522 | 314 |
| 307 | 3300014745 | Ga0157377_10195276 | Ga0157377_101952762 | 314 |
| 308 | 3300025321 | Ga0207656_10003633 | Ga0207656_100036335 | 314 |
| 309 | 3300025885 | Ga0207653_10002464 | Ga0207653_100024644 | 314 |
| 310 | 3300025904 | Ga0207647_10003641 | Ga0207647_100036413 | 314 |
| 311 | 3300025904 | Ga0207647_10160895 | Ga0207647_101608951 | 314 |
| 312 | 3300025908 | Ga0207643_10011980 | Ga0207643_100119802 | 314 |
| 313 | 3300025910 | Ga0207684_10000023 | Ga0207684_10000023252 | 314 |
| 314 | 3300025913 | Ga0207695_10102848 | Ga0207695_101028482 | 314 |
| 315 | 3300025914 | Ga0207671_10002078 | Ga0207671_1000207812 | 314 |
| 316 | 3300025921 | Ga0207652_10103510 | Ga0207652_101035102 | 314 |
| 317 | 3300025922 | Ga0207646_10192023 | Ga0207646_101920232 | 314 |
| 318 | 3300025923 | Ga0207681_10194361 | Ga0207681_101943611 | 314 |
| 319 | 3300025924 | Ga0207694_10008080 | Ga0207694_100080806 | 314 |
| 320 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001621 | 314 |
| 321 | 3300025925 | Ga0207650_10076194 | Ga0207650_100761942 | 314 |
| 322 | 3300025934 | Ga0207686_10161034 | Ga0207686_101610342 | 314 |
| 323 | 3300025935 | Ga0207709_10105364 | Ga0207709_101053642 | 314 |
| 324 | 3300025942 | Ga0207689_10277651 | Ga0207689_102776511 | 314 |
| 325 | 3300025942 | Ga0207689_10405376 | Ga0207689_104053762 | 314 |
| 326 | 3300025949 | Ga0207667_10272884 | Ga0207667_102728842 | 314 |
| 327 | 3300025961 | Ga0207712_10006513 | Ga0207712_100065132 | 314 |
| 328 | 3300026035 | Ga0207703_10474718 | Ga0207703_104747182 | 314 |
| 329 | 3300026041 | Ga0207639_10095496 | Ga0207639_100954962 | 314 |
| 330 | 3300026075 | Ga0207708_10151255 | Ga0207708_101512552 | 314 |
| 331 | 3300026089 | Ga0207648_10351440 | Ga0207648_103514401 | 314 |
| 332 | 3300026095 | Ga0207676_10081221 | Ga0207676_100812213 | 314 |
| 333 | 3300026095 | Ga0207676_10112982 | Ga0207676_101129822 | 314 |
| 334 | 3300026095 | Ga0207676_10234537 | Ga0207676_102345372 | 314 |
| 335 | 3300026095 | Ga0207676_10441152 | Ga0207676_104411522 | 314 |
| 336 | 3300026116 | Ga0207674_10487615 | Ga0207674_104876152 | 314 |
| 337 | 3300026118 | Ga0207675_100045697 | Ga0207675_1000456973 | 314 |
| 338 | 3300026142 | Ga0207698_10250408 | Ga0207698_102504082 | 314 |
| 339 | 3300028380 | Ga0268265_10099671 | Ga0268265_100996712 | 314 |
| 340 | 3300028381 | Ga0268264_10072847 | Ga0268264_100728472 | 314 |
| 341 | 3300028381 | Ga0268264_10210226 | Ga0268264_102102262 | 314 |
| 342 | 3300031901 | Ga0307406_10081326 | Ga0307406_100813262 | 314 |
| 343 | 3300031911 | Ga0307412_10443109 | Ga0307412_104431091 | 314 |
| 344 | 3300035091 | Ga0373951_0000768 | Ga0373951_0000768_4436_5395 | 314 |
| 345 | 3300038443 | Ga0395901_0168082 | Ga0395901_0168082_78_1043 | 314 |
| 346 | 3300044673 | Ga0453683_0178337 | Ga0453683_0178337_185_1153 | 314 |
| 347 | 3300049661 | Ga0501217_012520 | Ga0501217_012520_439_1407 | 314 |
| 348 | 3300049664 | Ga0501224_001333 | Ga0501224_001333_1412_2380 | 314 |
| 349 | 3300049665 | Ga0501227_015060 | Ga0501227_015060_153_1121 | 314 |
| 350 | 3300049707 | Ga0501234_005774 | Ga0501234_005774_612_1580 | 314 |
| 351 | 3300050507 | nmdc:mga05p37_316098_c1 | nmdc:mga05p37_316098_c1_358_1389 | 314 |
| 352 | 3300050511 | nmdc:mga08y16_430160_c1 | nmdc:mga08y16_430160_c1_23_991 | 314 |
| 353 | 3300050512 | nmdc:mga0n895_300856_c1 | nmdc:mga0n895_300856_c1_219_1190 | 314 |
| 354 | 3300050513 | nmdc:mga0rr50_18492_c1 | nmdc:mga0rr50_18492_c1_3048_4013 | 314 |
| 355 | 3300050515 | nmdc:mga0a205_520429_c1 | nmdc:mga0a205_520429_c1_69_1034 | 314 |
| 356 | 3300050515 | nmdc:mga0a205_80497_c1 | nmdc:mga0a205_80497_c1_923_1894 | 314 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar