F420472

General Info

Members Datasets Scaffolds Average Seq Length
356 212 708 341

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000090|Ga0105240_10000090168
Length 368
Sequence MNQSDTSEHGVRRDLPGRADALSASFGASYAGILAFVAVASEGSFTKAAERLGVGRPAVSRNVQKLEAQLSTRLFQRTTRMTELTCEGQRFFENCHQGVAQIVEAMNDMLELREGPPRGLIRISSAVGFGRKVVAPLLETFANAYPDIVIDLLLDDRPIDLVAERIDVSFRNGRIEDSSIIARQLIPMQMALCAAPSYVARHGLPQHLEDLARHECINFRLASGRIFEWEFNVDGRVQKYLPTSRLTFNDTDLVLRAVLSGSGIAQMAGYQIRDHIASNELVVALAKHVPDDRGHYICYLSRQHLPTRIRIFVDFMTEQIRALDLNCMTRFNPDSPDASPAELAARRSGGRGPSGPVHAVPHPIALRR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
95 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
179 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
180 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
181 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
182 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
183 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
184 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
185 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
186 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
187 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
188 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
189 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
190 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
191 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
192 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
193 2818991450 Burkholderia sp. 604 Isolate Unclassified
194 2818991452 Burkholderia cepacia 561 Isolate Unclassified
195 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
196 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
197 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
198 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
199 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
200 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
201 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
202 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
203 2928163908 Burkholderia sp. 567 Isolate Unclassified
204 2928170801 Burkholderia sp. 572 Isolate Unclassified
205 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
206 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
207 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
208 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
209 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
210 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
211 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
212 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.92
Metatranscriptomes 1.12
Isolates 10.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.29
Nodule 2.25
Rhizoplane 5.62
Rhizosphere 65.73
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000090 3300009093 Bacteria 184256
2 JGI24736J21556_1012392 3300001904 Bacteria 1381
3 JGI24739J22299_10008485 3300001989 Bacteria 3836
4 JGI24739J22299_10009107 3300001989 Bacteria 3702
5 JGI24739J22299_10055542 3300001989 Bacteria 1265
6 JGI24737J22298_10009761 3300001990 Bacteria 3181
7 JGI24735J21928_10000222 3300002067 Bacteria 19981
8 JGI25151J46595_10004021 3300003187 Bacteria 7898
9 JGI25151J46595_10014999 3300003187 Bacteria 3437
10 rootH1_10076234 3300003316 Bacteria 10546
11 JGI25160J50197_1000037 3300003354 Bacteria 162757
12 Ga0055532_1000137 3300003758 Bacteria 71979
13 Ga0055532_1000309 3300003758 Bacteria 29584
14 Ga0055527_1000286 3300003760 Bacteria 29584
15 Ga0055535_1000605 3300003761 Bacteria 29584
16 Ga0055529_1002104 3300003763 Bacteria 4237
17 Ga0055526_1000116 3300003771 Bacteria 70518
18 Ga0055526_1006222 3300003771 Bacteria 6550
19 Ga0055526_1007888 3300003771 Bacteria 5425
20 Ga0055526_1017492 3300003771 Bacteria 2733
21 Ga0055537_1000902 3300003773 Bacteria 14025
22 Ga0055537_1004209 3300003773 Bacteria 4169
23 Ga0055524_1000131 3300003775 Bacteria 88545
24 Ga0055524_1000599 3300003775 Bacteria 25887
25 Ga0055536_1000069 3300003781 Bacteria 94802
26 Ga0055534_1000445 3300003784 Bacteria 24372
27 Ga0055534_1002926 3300003784 Bacteria 5658
28 Ga0065707_10102722 3300005295 Bacteria 2788
29 Ga0070658_10240549 3300005327 Bacteria 1534
30 Ga0070660_100000146 3300005339 Bacteria 45502
31 Ga0070660_100018532 3300005339 Bacteria 5088
32 Ga0070659_100000212 3300005366 Bacteria 44866
33 Ga0070667_100070228 3300005367 Bacteria 2981
34 Ga0070663_100000722 3300005455 Bacteria 17814
35 Ga0068855_100005899 3300005563 Bacteria 14933
36 Ga0068856_100053730 3300005614 Bacteria 3972
37 Ga0068852_100083835 3300005616 Bacteria 2835
38 Ga0099826_10000009 3300006948 Bacteria 336081
39 Ga0105251_10000765 3300009011 Bacteria 29243
40 Ga0105240_10000934 3300009093 Bacteria 51919
41 Ga0105241_10010465 3300009174 Bacteria 6804
42 Ga0105237_10014863 3300009545 Bacteria 8122
43 Ga0105237_10022046 3300009545 Bacteria 6537
44 Ga0105237_10158860 3300009545 Bacteria 2258
45 Ga0105238_10076779 3300009551 Bacteria 3332
46 Ga0105238_10113275 3300009551 Bacteria 2692
47 Ga0105239_10004680 3300010375 Bacteria 16245
48 Ga0157373_10018734 3300013100 Bacteria 5038
49 Ga0157373_10047442 3300013100 Bacteria 3064
50 Ga0157371_10073690 3300013102 Bacteria 2418
51 Ga0157370_10002578 3300013104 Bacteria 21764
52 Ga0157370_10003293 3300013104 Bacteria 19049
53 Ga0157370_10033267 3300013104 Bacteria 5026
54 Ga0157369_10000044 3300013105 Bacteria 178695
55 Ga0157369_10000214 3300013105 Bacteria 80288
56 Ga0157369_10007543 3300013105 Bacteria 12517
57 Ga0157369_10011421 3300013105 Bacteria 10087
58 Ga0157369_10274517 3300013105 Bacteria 1756
59 Ga0157374_10000039 3300013296 Bacteria 164906
60 Ga0163162_10034128 3300013306 Bacteria 5061
61 Ga0157372_10001457 3300013307 Bacteria 25640
62 Ga0157372_10107783 3300013307 Bacteria 3188
63 Ga0182008_10047359 3300014497 Bacteria 2136
64 Ga0182006_1024291 3300015261 Bacteria 2501
65 Ga0182007_10001938 3300015262 Bacteria 10712
66 Ga0182005_1016133 3300015265 Bacteria 2079
67 Ga0197907_11080258 3300020069 Bacteria 1302
68 Ga0206356_11898130 3300020070 Bacteria 1219
69 Ga0206355_1330490 3300020076 Bacteria 1274
70 Ga0213872_10000041 3300021361 Bacteria 118955
71 Ga0224712_10050070 3300022467 Bacteria 1621
72 Ga0209566_100272 3300025225 Bacteria 48279
73 Ga0209674_101005 3300025226 Bacteria 8682
74 Ga0209672_100075 3300025228 Bacteria 159275
75 Ga0209672_100104 3300025228 Bacteria 103234
76 Ga0209147_100143 3300025229 Bacteria 110480
77 Ga0209147_100176 3300025229 Bacteria 80329
78 Ga0209258_100153 3300025242 Bacteria 159275
79 Ga0209148_1000683 3300025254 Bacteria 28202
80 Ga0209759_1000686 3300025256 Bacteria 30494
81 Ga0209565_1000139 3300025263 Bacteria 101579
82 Ga0209565_1000391 3300025263 Bacteria 37106
83 Ga0209565_1010225 3300025263 Bacteria 2335
84 Ga0209455_1000221 3300025272 Bacteria 78847
85 Ga0209673_1011117 3300025273 Bacteria 3735
86 Ga0209130_1010718 3300025284 Bacteria 2504
87 Ga0209675_1000160 3300025291 Bacteria 87175
88 Ga0209675_1000592 3300025291 Bacteria 25954
89 Ga0209675_1001837 3300025291 Bacteria 11553
90 Ga0209676_1000064 3300025292 Bacteria 321700
91 Ga0209676_1040382 3300025292 Bacteria 1314
92 Ga0209025_1000243 3300025294 Bacteria 128086
93 Ga0209025_1000447 3300025294 Bacteria 80906
94 Ga0209025_1002575 3300025294 Bacteria 18835
95 Ga0209025_1002752 3300025294 Bacteria 17787
96 Ga0209025_1007482 3300025294 Bacteria 8122
97 Ga0209025_1012232 3300025294 Bacteria 5530
98 Ga0209564_1000202 3300025295 Bacteria 136555
99 Ga0209564_1000293 3300025295 Bacteria 101618
100 Ga0209564_1000351 3300025295 Bacteria 86736
101 Ga0209564_1001422 3300025295 Bacteria 24649
102 Ga0209564_1033789 3300025295 Bacteria 1514
103 Ga0209758_1004075 3300025297 Bacteria 12559
104 Ga0209256_1000254 3300025299 Bacteria 94801
105 Ga0209256_1000291 3300025299 Bacteria 88153
106 Ga0209256_1000326 3300025299 Bacteria 81240
107 Ga0209256_1000340 3300025299 Bacteria 76961
108 Ga0207426_1000004 3300025302 Bacteria 1047900
109 Ga0209051_1009969 3300025303 Bacteria 4841
110 Ga0207713_1000260 3300025735 Bacteria 65059
111 Ga0207647_10003663 3300025904 Bacteria 11493
112 Ga0207647_10005420 3300025904 Bacteria 9354
113 Ga0207647_10010904 3300025904 Bacteria 6394
114 Ga0207705_10232240 3300025909 Bacteria 1403
115 Ga0207695_10000176 3300025913 Bacteria 187773
116 Ga0207695_10016095 3300025913 Bacteria 8773
117 Ga0207671_10109235 3300025914 Bacteria 2103
118 Ga0207657_10000424 3300025919 Bacteria 44824
119 Ga0207657_10005372 3300025919 Bacteria 13411
120 Ga0207694_10072114 3300025924 Bacteria 2700
121 Ga0207644_10040639 3300025931 Bacteria 3288
122 Ga0207690_10000208 3300025932 Bacteria 45500
123 Ga0207667_10006768 3300025949 Bacteria 13841
124 Ga0207667_10007062 3300025949 Bacteria 13570
125 Ga0207667_10049163 3300025949 Bacteria 4456
126 Ga0207658_10091941 3300025986 Bacteria 2356
127 Ga0207678_10002998 3300026067 Bacteria 15268
128 Ga0207702_10041917 3300026078 Bacteria 3838
129 Ga0207641_10160666 3300026088 Bacteria 2043
130 Ga0207698_10003506 3300026142 Bacteria 9461
131 Ga0209282_1000086 3300027666 Bacteria 68841
132 Ga0395899_0000023 3300037312 Bacteria 367159
133 Ga0395899_0199550 3300037312 Bacteria 1396
134 Ga0395900_0000019 3300037418 Bacteria 357240
135 Ga0395900_0000450 3300037418 Bacteria 58882
136 Ga0395900_0033497 3300037418 Bacteria 5287
137 Ga0395900_0043583 3300037418 Bacteria 4624
138 Ga0395900_0047587 3300037418 Bacteria 4416
139 Ga0395898_0000016 3300037466 Bacteria 435585
140 Ga0395898_0001518 3300037466 Bacteria 31992
141 Ga0395898_0002024 3300037466 Bacteria 25429
142 Ga0395898_0041163 3300037466 Bacteria 4564
143 Ga0395905_0000017 3300037471 Bacteria 376619
144 Ga0395905_0000082 3300037471 Bacteria 158963
145 Ga0395905_0463594 3300037471 Bacteria 1165
146 Ga0395901_0000012 3300038443 Bacteria 381361
147 Ga0395901_0000038 3300038443 Bacteria 210534
148 Ga0395901_0016473 3300038443 Bacteria 7530
149 Ga0395901_0173563 3300038443 Bacteria 2261
150 Ga0436361_0074176 3300039447 Bacteria 15362
151 Ga0436361_0438991 3300039447 Bacteria 100787
152 Ga0439448_0000022 3300042005 Bacteria 26210
153 Ga0439452_012990 3300042010 Bacteria 2349
154 Ga0466969_0001263 3300044656 Bacteria 13644
155 Ga0466969_0003959 3300044656 Bacteria 7865
156 Ga0466969_0040889 3300044656 Bacteria 2321
157 Ga0466972_0024290 3300044658 Bacteria 3008
158 Ga0466973_0028033 3300044659 Bacteria 5398
159 Ga0466982_0028424 3300044672 Bacteria 3286
160 Ga0466965_0000370 3300044683 Bacteria 15298
161 Ga0466965_0017051 3300044683 Bacteria 3466
162 Ga0466965_0047510 3300044683 Bacteria 2125
163 Ga0466966_0000020 3300044684 Bacteria 119360
164 Ga0466966_0007995 3300044684 Bacteria 7009
165 Ga0466966_0014080 3300044684 Bacteria 5296
166 Ga0466966_0045896 3300044684 Bacteria 2792
167 Ga0466966_0069745 3300044684 Bacteria 2204
168 Ga0466961_0000043 3300044693 Bacteria 76269
169 Ga0466961_0002637 3300044693 Bacteria 11139
170 Ga0466961_0005772 3300044693 Bacteria 7834
171 Ga0466961_0011505 3300044693 Bacteria 5659
172 Ga0466961_0011639 3300044693 Bacteria 5623
173 Ga0466961_0056002 3300044693 Bacteria 2512
174 Ga0466961_0077365 3300044693 Bacteria 2107
175 Ga0466963_0025879 3300044694 Bacteria 3746
176 Ga0466963_0050554 3300044694 Bacteria 2751
177 Ga0466963_0145565 3300044694 Bacteria 1643
178 Ga0466971_0002178 3300044719 Bacteria 8282
179 Ga0466971_0008505 3300044719 Bacteria 4475
180 Ga0466971_0189723 3300044719 Bacteria 968
181 Ga0466970_0009870 3300044765 Bacteria 4835
182 Ga0466970_0012249 3300044765 Bacteria 4381
183 Ga0466970_0018022 3300044765 Bacteria 3654
184 Ga0466970_0060177 3300044765 Bacteria 2034
185 Ga0466957_0001973 3300044842 Bacteria 10921
186 Ga0466957_0011290 3300044842 Bacteria 5148
187 Ga0466957_0016300 3300044842 Bacteria 4346
188 Ga0466957_0106675 3300044842 Bacteria 1772
189 Ga0466959_0001823 3300045049 Bacteria 13364
190 Ga0466959_0029725 3300045049 Bacteria 4048
191 Ga0466959_0068449 3300045049 Bacteria 2572
192 Ga0466959_0098587 3300045049 Bacteria 2093
193 Ga0466959_0123971 3300045049 Bacteria 1834
194 Ga0466958_0004260 3300045836 Bacteria 7523
195 Ga0466958_0046198 3300045836 Bacteria 2628
196 Ga0466958_0098836 3300045836 Bacteria 1812
197 Ga0466967_0376538 3300045976 Unclassified 1378
198 Ga0495617_000446 3300046452 Bacteria 22241
199 Ga0495603_0001042 3300046455 Bacteria 16056
200 Ga0495629_0043337 3300046459 Bacteria 3159
201 Ga0495651_0061712 3300046462 Bacteria 2869
202 Ga0495653_0000957 3300046463 Bacteria 22176
203 Ga0495653_0005435 3300046463 Bacteria 10379
204 Ga0495580_0000009 3300046472 Bacteria 101827
205 Ga0495580_0000158 3300046472 Bacteria 49553
206 Ga0495580_0001067 3300046472 Bacteria 24094
207 Ga0495580_0001394 3300046472 Bacteria 21196
208 Ga0495580_0006204 3300046472 Bacteria 9764
209 Ga0495580_0008021 3300046472 Bacteria 8432
210 Ga0495582_0031118 3300046473 Bacteria 2932
211 Ga0495605_0002326 3300046474 Bacteria 11842
212 Ga0495605_0009598 3300046474 Bacteria 5435
213 Ga0495605_0033622 3300046474 Bacteria 2601
214 Ga0495662_0071218 3300046476 Bacteria 1685
215 Ga0495584_0027290 3300046491 Bacteria 2893
216 Ga0495585_0006576 3300046492 Bacteria 7187
217 Ga0495596_0000020 3300046500 Bacteria 113608
218 Ga0495607_0016885 3300046501 Bacteria 4699
219 Ga0495610_0000325 3300046512 Bacteria 50743
220 Ga0495616_0000605 3300046513 Bacteria 27110
221 Ga0495616_0044431 3300046513 Bacteria 2253
222 Ga0495628_0002652 3300046516 Bacteria 16041
223 Ga0495628_0013946 3300046516 Bacteria 6748
224 Ga0495643_0072491 3300046522 Bacteria 1806
225 Ga0495648_0135934 3300046524 Bacteria 1300
226 Ga0495666_0004384 3300046526 Bacteria 7129
227 Ga0495666_0096314 3300046526 Bacteria 1395
228 Ga0495652_0037500 3300046529 Bacteria 4205
229 Ga0495665_0003633 3300046531 Bacteria 8371
230 Ga0495665_0034922 3300046531 Bacteria 2688
231 Ga0495609_0000539 3300046538 Bacteria 29958
232 Ga0495609_0002412 3300046538 Bacteria 11489
233 Ga0495622_0038583 3300046557 Bacteria 2224
234 Ga0495633_0001024 3300046558 Bacteria 22852
235 Ga0495634_0039173 3300046642 Bacteria 3229
236 Ga0495625_0034501 3300046660 Bacteria 3733
237 Ga0495625_0085356 3300046660 Bacteria 2191
238 Ga0495659_0025559 3300046664 Bacteria 2022
239 Ga0495661_0001054 3300046665 Bacteria 24423
240 Ga0495661_0033816 3300046665 Bacteria 3222
241 Ga0495661_0140297 3300046665 Bacteria 1315
242 Ga0495646_0003409 3300046680 Bacteria 9877
243 Ga0495646_0004970 3300046680 Bacteria 8395
244 Ga0495646_0037821 3300046680 Bacteria 2983
245 Ga0495613_0010748 3300046689 Bacteria 6789
246 Ga0495613_0120027 3300046689 Bacteria 1888
247 Ga0495624_0000859 3300046690 Bacteria 24093
248 Ga0495624_0002414 3300046690 Bacteria 14193
249 Ga0495624_0008631 3300046690 Bacteria 7096
250 Ga0495624_0132884 3300046690 Bacteria 1526
251 Ga0495671_0001406 3300046692 Bacteria 16240
252 Ga0495671_0014371 3300046692 Bacteria 4263
253 Ga0495649_0181703 3300046694 Bacteria 1097
254 Ga0495589_0104045 3300046794 Bacteria 1372
255 Ga0495604_0106904 3300047317 Bacteria 2046
256 Ga0495636_0088730 3300047318 Unclassified 1340
257 Ga0495674_0008280 3300047319 Bacteria 9913
258 Ga0495674_0010182 3300047319 Bacteria 8907
259 Ga0495674_0019147 3300047319 Bacteria 6359
260 Ga0495672_0002246 3300047320 Bacteria 17973
261 Ga0495672_0037873 3300047320 Bacteria 2947
262 Ga0495672_0080729 3300047320 Bacteria 1813
263 Ga0495676_0087437 3300047321 Bacteria 2342
264 Ga0495680_0171539 3300047322 Bacteria 1570
265 Ga0495683_0002105 3300047323 Bacteria 12314
266 Ga0495683_0011096 3300047323 Bacteria 4748
267 Ga0495687_021040 3300047443 Bacteria 3168
268 Ga0495675_0058513 3300047444 Bacteria 2443
269 Ga0495675_0155793 3300047444 Bacteria 1409
270 Ga0495677_0001589 3300047445 Bacteria 9152
271 Ga0495677_0079729 3300047445 Bacteria 1226
272 Ga0495673_0015310 3300047469 Bacteria 3954
273 Ga0495673_0075493 3300047469 Bacteria 1408
274 Ga0495593_0002890 3300047673 Bacteria 10352
275 Ga0495593_0006969 3300047673 Bacteria 6623
276 Ga0495602_0068715 3300048088 Bacteria 3041
277 Ga0495614_0103376 3300048089 Bacteria 1247
278 Ga0496100_0000070 3300048903 Bacteria 56600
279 Ga0496100_0117858 3300048903 Bacteria 1854
280 Ga0496101_0000044 3300048904 Bacteria 161295
281 Ga0496101_0094261 3300048904 Bacteria 2231
282 Ga0496102_0001008 3300048905 Bacteria 26419
283 Ga0496102_0359440 3300048905 Bacteria 1371
284 Ga0496103_0003977 3300048906 Bacteria 8973
285 Ga0496104_0016684 3300048907 Bacteria 6675
286 Ga0496104_0248812 3300048907 Bacteria 1690
287 Ga0496104_0327491 3300048907 Bacteria 1445
288 Ga0496105_0046189 3300048908 Bacteria 3594
289 Ga0496105_0108192 3300048908 Bacteria 2295
290 Ga0496110_0167021 3300048913 Bacteria 1996
291 Ga0496113_0003769 3300048916 Bacteria 9150
292 Ga0496115_0035466 3300048918 Bacteria 3946
293 Ga0496116_0005024 3300048919 Bacteria 12458
294 Ga0496117_0000098 3300048920 Bacteria 196331
295 Ga0496117_0023832 3300048920 Bacteria 4861
296 Ga0496117_0110798 3300048920 Bacteria 1710
297 Ga0496118_0005384 3300048921 Bacteria 14578
298 Ga0496118_0008754 3300048921 Bacteria 10381
299 Ga0496120_0109742 3300048923 Bacteria 1443
300 Ga0496121_0001588 3300048924 Bacteria 37820
301 Ga0496121_0002190 3300048924 Bacteria 30584
302 Ga0496121_0020462 3300048924 Bacteria 6548
303 Ga0496121_0091466 3300048924 Bacteria 2375
304 Ga0496122_0001377 3300048925 Bacteria 39474
305 Ga0496123_0000224 3300048926 Bacteria 115362
306 Ga0495678_048716 3300049459 Bacteria 1651
307 Ga0495682_0001009 3300049460 Bacteria 16717
308 Ga0495682_0008932 3300049460 Bacteria 3930
309 Ga0501036_0318353 3300049572 Bacteria 1300
310 Ga0501047_0012290 3300049581 Bacteria 8103
311 Ga0501035_0009588 3300049822 Bacteria 9004
312 Ga0501044_0010017 3300049823 Bacteria 10297
313 nmdc:mga03683_918_c1 3300050489 Bacteria 8500
314 Ga0466962_0020129 3300061719 Bacteria 3206
315 Ga0466962_0046725 3300061719 Bacteria 2068
316 2509127325 2508501125 Bacteria 7208311
317 2514043345 2513237165 Bacteria 6771773
318 2514047340 2513237166 Bacteria 10373764
319 2514051319 2513237166 Bacteria 10373764
320 2563059759 2562617112 Bacteria 10918404
321 2599737737 2599185239 Bacteria 8686614
322 2599743139 2599185240 Bacteria 7968121
323 2599905861 2599185292 Bacteria 6290804
324 2600205629 2599185355 Bacteria 7968906
325 2600811150 2600255067 Bacteria 6795583
326 2676740926 2675903129 Bacteria 7964495
327 2713480533 2711768613 Bacteria 11048459
328 2746085968 2744054900 Bacteria 8399525
329 2746092935 2744054901 Bacteria 8397047
330 2753567115 2751185846 Bacteria 7242164
331 2792839411 2791355137 Bacteria 9654227
332 2792841302 2791355137 Bacteria 9654227
333 2819621147 2818991450 Bacteria 6962147
334 2819635552 2818991452 Bacteria 8442785
335 2834644519 2834641062 Bacteria 5559922
336 2870075801 2870068957 Bacteria 8925310
337 2900634416 2900634093 Bacteria 10263517
338 2900634435 2900634093 Bacteria 10263517
339 2904621617 2904615490 Bacteria 10047340
340 2921652825 2921643360 Bacteria 11448031
341 2928114645 2928108538 Bacteria 7360024
342 2928142171 2928135762 Bacteria 7259641
343 2928162490 2928157003 Bacteria 7522202
344 2928166949 2928163908 Bacteria 7561269
345 2928178002 2928170801 Bacteria 8785406
346 2928510031 2928503688 Bacteria 7268108
347 2981997074 2981990288 Bacteria 7590678
348 642418320 641736154 Bacteria 7689995
349 642621959 642555113 Bacteria 8214658
350 642621977 642555113 Bacteria 8214658
351 8018847744 8018845410 Bacteria 8933938
352 8020951058 8020945358 Bacteria 8467355
353 8021124783 8021120328 Bacteria 8782274
354 8055269849 8055266321 Bacteria 7999742
355 Ga0105240_10000090
356 JGI24736J21556_1012392
357 JGI24739J22299_10008485
358 JGI24739J22299_10009107
359 JGI24739J22299_10055542
360 JGI24737J22298_10009761
361 JGI24735J21928_10000222
362 JGI25151J46595_10004021
363 JGI25151J46595_10014999
364 rootH1_10076234
365 JGI25160J50197_1000037
366 Ga0055532_1000137
367 Ga0055532_1000309
368 Ga0055527_1000286
369 Ga0055535_1000605
370 Ga0055529_1002104
371 Ga0055526_1000116
372 Ga0055526_1006222
373 Ga0055526_1007888
374 Ga0055526_1017492
375 Ga0055537_1000902
376 Ga0055537_1004209
377 Ga0055524_1000131
378 Ga0055524_1000599
379 Ga0055536_1000069
380 Ga0055534_1000445
381 Ga0055534_1002926
382 Ga0065707_10102722
383 Ga0070658_10240549
384 Ga0070660_100000146
385 Ga0070660_100018532
386 Ga0070659_100000212
387 Ga0070667_100070228
388 Ga0070663_100000722
389 Ga0068855_100005899
390 Ga0068856_100053730
391 Ga0068852_100083835
392 Ga0099826_10000009
393 Ga0105251_10000765
394 Ga0105240_10000934
395 Ga0105241_10010465
396 Ga0105237_10014863
397 Ga0105237_10022046
398 Ga0105237_10158860
399 Ga0105238_10076779
400 Ga0105238_10113275
401 Ga0105239_10004680
402 Ga0157373_10018734
403 Ga0157373_10047442
404 Ga0157371_10073690
405 Ga0157370_10002578
406 Ga0157370_10003293
407 Ga0157370_10033267
408 Ga0157369_10000044
409 Ga0157369_10000214
410 Ga0157369_10007543
411 Ga0157369_10011421
412 Ga0157369_10274517
413 Ga0157374_10000039
414 Ga0163162_10034128
415 Ga0157372_10001457
416 Ga0157372_10107783
417 Ga0182008_10047359
418 Ga0182006_1024291
419 Ga0182007_10001938
420 Ga0182005_1016133
421 Ga0197907_11080258
422 Ga0206356_11898130
423 Ga0206355_1330490
424 Ga0213872_10000041
425 Ga0224712_10050070
426 Ga0209566_100272
427 Ga0209674_101005
428 Ga0209672_100075
429 Ga0209672_100104
430 Ga0209147_100143
431 Ga0209147_100176
432 Ga0209258_100153
433 Ga0209148_1000683
434 Ga0209759_1000686
435 Ga0209565_1000139
436 Ga0209565_1000391
437 Ga0209565_1010225
438 Ga0209455_1000221
439 Ga0209673_1011117
440 Ga0209130_1010718
441 Ga0209675_1000160
442 Ga0209675_1000592
443 Ga0209675_1001837
444 Ga0209676_1000064
445 Ga0209676_1040382
446 Ga0209025_1000243
447 Ga0209025_1000447
448 Ga0209025_1002575
449 Ga0209025_1002752
450 Ga0209025_1007482
451 Ga0209025_1012232
452 Ga0209564_1000202
453 Ga0209564_1000293
454 Ga0209564_1000351
455 Ga0209564_1001422
456 Ga0209564_1033789
457 Ga0209758_1004075
458 Ga0209256_1000254
459 Ga0209256_1000291
460 Ga0209256_1000326
461 Ga0209256_1000340
462 Ga0207426_1000004
463 Ga0209051_1009969
464 Ga0207713_1000260
465 Ga0207647_10003663
466 Ga0207647_10005420
467 Ga0207647_10010904
468 Ga0207705_10232240
469 Ga0207695_10000176
470 Ga0207695_10016095
471 Ga0207671_10109235
472 Ga0207657_10000424
473 Ga0207657_10005372
474 Ga0207694_10072114
475 Ga0207644_10040639
476 Ga0207690_10000208
477 Ga0207667_10006768
478 Ga0207667_10007062
479 Ga0207667_10049163
480 Ga0207658_10091941
481 Ga0207678_10002998
482 Ga0207702_10041917
483 Ga0207641_10160666
484 Ga0207698_10003506
485 Ga0209282_1000086
486 Ga0395899_0000023
487 Ga0395899_0199550
488 Ga0395900_0000019
489 Ga0395900_0000450
490 Ga0395900_0033497
491 Ga0395900_0043583
492 Ga0395900_0047587
493 Ga0395898_0000016
494 Ga0395898_0001518
495 Ga0395898_0002024
496 Ga0395898_0041163
497 Ga0395905_0000017
498 Ga0395905_0000082
499 Ga0395905_0463594
500 Ga0395901_0000012
501 Ga0395901_0000038
502 Ga0395901_0016473
503 Ga0395901_0173563
504 Ga0436361_0074176
505 Ga0436361_0438991
506 Ga0439448_0000022
507 Ga0439452_012990
508 Ga0466969_0001263
509 Ga0466969_0003959
510 Ga0466969_0040889
511 Ga0466972_0024290
512 Ga0466973_0028033
513 Ga0466982_0028424
514 Ga0466965_0000370
515 Ga0466965_0017051
516 Ga0466965_0047510
517 Ga0466966_0000020
518 Ga0466966_0007995
519 Ga0466966_0014080
520 Ga0466966_0045896
521 Ga0466966_0069745
522 Ga0466961_0000043
523 Ga0466961_0002637
524 Ga0466961_0005772
525 Ga0466961_0011505
526 Ga0466961_0011639
527 Ga0466961_0056002
528 Ga0466961_0077365
529 Ga0466963_0025879
530 Ga0466963_0050554
531 Ga0466963_0145565
532 Ga0466971_0002178
533 Ga0466971_0008505
534 Ga0466971_0189723
535 Ga0466970_0009870
536 Ga0466970_0012249
537 Ga0466970_0018022
538 Ga0466970_0060177
539 Ga0466957_0001973
540 Ga0466957_0011290
541 Ga0466957_0016300
542 Ga0466957_0106675
543 Ga0466959_0001823
544 Ga0466959_0029725
545 Ga0466959_0068449
546 Ga0466959_0098587
547 Ga0466959_0123971
548 Ga0466958_0004260
549 Ga0466958_0046198
550 Ga0466958_0098836
551 Ga0466967_0376538
552 Ga0495617_000446
553 Ga0495603_0001042
554 Ga0495629_0043337
555 Ga0495651_0061712
556 Ga0495653_0000957
557 Ga0495653_0005435
558 Ga0495580_0000009
559 Ga0495580_0000158
560 Ga0495580_0001067
561 Ga0495580_0001394
562 Ga0495580_0006204
563 Ga0495580_0008021
564 Ga0495582_0031118
565 Ga0495605_0002326
566 Ga0495605_0009598
567 Ga0495605_0033622
568 Ga0495662_0071218
569 Ga0495584_0027290
570 Ga0495585_0006576
571 Ga0495596_0000020
572 Ga0495607_0016885
573 Ga0495610_0000325
574 Ga0495616_0000605
575 Ga0495616_0044431
576 Ga0495628_0002652
577 Ga0495628_0013946
578 Ga0495643_0072491
579 Ga0495648_0135934
580 Ga0495666_0004384
581 Ga0495666_0096314
582 Ga0495652_0037500
583 Ga0495665_0003633
584 Ga0495665_0034922
585 Ga0495609_0000539
586 Ga0495609_0002412
587 Ga0495622_0038583
588 Ga0495633_0001024
589 Ga0495634_0039173
590 Ga0495625_0034501
591 Ga0495625_0085356
592 Ga0495659_0025559
593 Ga0495661_0001054
594 Ga0495661_0033816
595 Ga0495661_0140297
596 Ga0495646_0003409
597 Ga0495646_0004970
598 Ga0495646_0037821
599 Ga0495613_0010748
600 Ga0495613_0120027
601 Ga0495624_0000859
602 Ga0495624_0002414
603 Ga0495624_0008631
604 Ga0495624_0132884
605 Ga0495671_0001406
606 Ga0495671_0014371
607 Ga0495649_0181703
608 Ga0495589_0104045
609 Ga0495604_0106904
610 Ga0495636_0088730
611 Ga0495674_0008280
612 Ga0495674_0010182
613 Ga0495674_0019147
614 Ga0495672_0002246
615 Ga0495672_0037873
616 Ga0495672_0080729
617 Ga0495676_0087437
618 Ga0495680_0171539
619 Ga0495683_0002105
620 Ga0495683_0011096
621 Ga0495687_021040
622 Ga0495675_0058513
623 Ga0495675_0155793
624 Ga0495677_0001589
625 Ga0495677_0079729
626 Ga0495673_0015310
627 Ga0495673_0075493
628 Ga0495593_0002890
629 Ga0495593_0006969
630 Ga0495602_0068715
631 Ga0495614_0103376
632 Ga0496100_0000070
633 Ga0496100_0117858
634 Ga0496101_0000044
635 Ga0496101_0094261
636 Ga0496102_0001008
637 Ga0496102_0359440
638 Ga0496103_0003977
639 Ga0496104_0016684
640 Ga0496104_0248812
641 Ga0496104_0327491
642 Ga0496105_0046189
643 Ga0496105_0108192
644 Ga0496110_0167021
645 Ga0496113_0003769
646 Ga0496115_0035466
647 Ga0496116_0005024
648 Ga0496117_0000098
649 Ga0496117_0023832
650 Ga0496117_0110798
651 Ga0496118_0005384
652 Ga0496118_0008754
653 Ga0496120_0109742
654 Ga0496121_0001588
655 Ga0496121_0002190
656 Ga0496121_0020462
657 Ga0496121_0091466
658 Ga0496122_0001377
659 Ga0496123_0000224
660 Ga0495678_048716
661 Ga0495682_0001009
662 Ga0495682_0008932
663 Ga0501036_0318353
664 Ga0501047_0012290
665 Ga0501035_0009588
666 Ga0501044_0010017
667 nmdc:mga03683_918_c1
668 Ga0466962_0020129
669 Ga0466962_0046725
670 2509127325
671 2514043345
672 2514047340
673 2514051319
674 2563059759
675 2599737737
676 2599743139
677 2599905861
678 2600205629
679 2600811150
680 2676740926
681 2713480533
682 2746085968
683 2746092935
684 2753567115
685 2792839411
686 2792841302
687 2819621147
688 2819635552
689 2834644519
690 2870075801
691 2900634416
692 2900634435
693 2904621617
694 2921652825
695 2928114645
696 2928142171
697 2928162490
698 2928166949
699 2928178002
700 2928510031
701 2981997074
702 642418320
703 642621959
704 642621977
705 8018847744
706 8020951058
707 8021124783
708 8055269849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

32

89

0.97

PF03466

LysR_substrate

LysR substrate binding domain

114

321

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.9238 54 118
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9113 54 131
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9081 54 131
5x0o-assembly1.cif.gz_B regulatory domain of aphb treated with cumene hydroperoxide from vibrio vulnificus 0.9061 141 339
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9006 54 131
ID Description Score Start End Superfamily
af_P0A9F6_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9504 54 132 1.10.10.10
af_P0A9G2_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9495 52 129 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9431 54 119 1.10.10.10
af_P77744_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9344 54 131 1.10.10.10
af_P39376_183_267_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9315 264 303 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W6XI29-F1-model_v4 DNA-binding transcriptional LysR family regulator 0.9754 49 119 GO:0003700
GO:0006351
GO:0043565
AF-A0A447T6W0-F1-model_v4 D-malate degradation protein R 0.9206 136 350 GO:0003700
GO:0006351
GO:0043565
AF-N9LMW5-F1-model_v4 LysR substrate-binding domain-containing protein 0.9186 140 339 GO:0003700
GO:0006351
GO:0043565
AF-A0A380UKQ5-F1-model_v4 deleted 0.9158 213 339
AF-A0A7Y8DXJ3-F1-model_v4 deleted 0.8997 202 343

Map