F420465

General Info

Members Datasets Scaffolds Average Seq Length
356 225 712 228

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10014459|Ga0099794_100144593
Length 263
Sequence VNPWIVTHRRDERPVIGGKARQGANTPVVSDVAANVSRVREGIAAAARRGGRRGEDVLLVAVSKGVAPTQVQAAATSGVTDFGENRVQEALPKITQFAPQVAEAVRWHLVGHLQRNKVRQAVQLFDVIHSVDSVALAMALDERARQAGRICEVLVQVNVAAGPQKFGIAPEALPAMVQSLTVLSGIRVVGLMTIAPQVDHPEVVRPVFRRLRELRDEVARAGGAPALAHLSMGMSEDFEVAVEEGATMVRIGRAIFGPRPHET

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 3.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 0.56
Rhizosphere 97.47
Stem 0
Stem Tuber 0
Unclassified 15.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10014459 3300007265 Bacteria 3459
2 JGI24752J21851_1017518 3300001976 Bacteria 934
3 Ga0058863_11600609 3300004799 Bacteria 1125
4 Ga0058861_11865005 3300004800 Bacteria 1078
5 Ga0058862_12142227 3300004803 Bacteria 1106
6 Ga0058862_12517130 3300004803 Unclassified 1175
7 Ga0070658_10485117 3300005327 Unclassified 1067
8 Ga0070683_100003200 3300005329 Bacteria 13216
9 Ga0070683_100003366 3300005329 Bacteria 12954
10 Ga0070683_100012542 3300005329 Bacteria 7367
11 Ga0070683_100021319 3300005329 Bacteria 5782
12 Ga0070683_100032281 3300005329 Bacteria 4768
13 Ga0070690_100036940 3300005330 Unclassified 3074
14 Ga0070690_100057281 3300005330 Bacteria 2501
15 Ga0070690_100139079 3300005330 Bacteria 1647
16 Ga0070670_100032765 3300005331 Bacteria 4477
17 Ga0068869_100008257 3300005334 Bacteria 6705
18 Ga0068869_100049581 3300005334 Bacteria 3040
19 Ga0070680_100001828 3300005336 Bacteria 15629
20 Ga0070680_100216834 3300005336 Bacteria 1615
21 Ga0070682_100001984 3300005337 Bacteria 11406
22 Ga0068868_100113983 3300005338 Unclassified 2199
23 Ga0070689_100631028 3300005340 Bacteria 930
24 Ga0070691_10003195 3300005341 Bacteria 7341
25 Ga0070691_10116468 3300005341 Unclassified 1341
26 Ga0070687_100059790 3300005343 Bacteria 2008
27 Ga0070687_100250261 3300005343 Bacteria 1100
28 Ga0070661_100001030 3300005344 Bacteria 19749
29 Ga0070661_100007493 3300005344 Bacteria 7529
30 Ga0070692_10151525 3300005345 Bacteria 1321
31 Ga0070669_100001989 3300005353 Bacteria 14784
32 Ga0070675_100011622 3300005354 Bacteria 6896
33 Ga0070675_100372811 3300005354 Bacteria 1269
34 Ga0070674_100342989 3300005356 Bacteria 1204
35 Ga0070673_100629554 3300005364 Bacteria 980
36 Ga0070659_100043791 3300005366 Unclassified 3502
37 Ga0070667_100651324 3300005367 Bacteria 972
38 Ga0070709_10243215 3300005434 Bacteria 1293
39 Ga0070714_100014052 3300005435 Bacteria 6424
40 Ga0070714_100025505 3300005435 Bacteria 4878
41 Ga0070714_100138789 3300005435 Bacteria 2180
42 Ga0070713_100019265 3300005436 Bacteria 5205
43 Ga0070713_100909147 3300005436 Bacteria 847
44 Ga0070705_100405352 3300005440 Bacteria 1011
45 Ga0070700_100148409 3300005441 Unclassified 1601
46 Ga0070700_100302794 3300005441 Bacteria 1168
47 Ga0070708_100000168 3300005445 Bacteria 46393
48 Ga0070708_100387380 3300005445 Bacteria 1318
49 Ga0070662_100203455 3300005457 Unclassified 1572
50 Ga0070681_10000529 3300005458 Bacteria 31314
51 Ga0070681_10000633 3300005458 Bacteria 28922
52 Ga0070685_10206883 3300005466 Unclassified 1279
53 Ga0070706_100010276 3300005467 Bacteria 8696
54 Ga0070706_100014810 3300005467 Bacteria 7208
55 Ga0070706_100235295 3300005467 Bacteria 1710
56 Ga0070706_100551027 3300005467 Bacteria 1073
57 Ga0070707_100001079 3300005468 Bacteria 26946
58 Ga0070707_100037608 3300005468 Bacteria 4620
59 Ga0070707_100225808 3300005468 Bacteria 1823
60 Ga0070698_100005517 3300005471 Bacteria 13816
61 Ga0070698_100052724 3300005471 Bacteria 4136
62 Ga0070698_100067106 3300005471 Bacteria 3608
63 Ga0070698_100077540 3300005471 Bacteria 3323
64 Ga0070698_100081040 3300005471 Bacteria 3240
65 Ga0070698_100092514 3300005471 Bacteria 3005
66 Ga0070699_100042732 3300005518 Bacteria 3922
67 Ga0070679_100005036 3300005530 Bacteria 12195
68 Ga0070679_100008779 3300005530 Bacteria 9531
69 Ga0070679_100014964 3300005530 Bacteria 7454
70 Ga0070679_100017179 3300005530 Bacteria 6998
71 Ga0070679_100018848 3300005530 Bacteria 6701
72 Ga0070679_100032064 3300005530 Bacteria 5196
73 Ga0070684_100003904 3300005535 Bacteria 11289
74 Ga0070684_100084647 3300005535 Bacteria 2811
75 Ga0070684_100176023 3300005535 Bacteria 1944
76 Ga0070684_100274713 3300005535 Bacteria 1543
77 Ga0070697_100000034 3300005536 Bacteria 100952
78 Ga0070697_100004335 3300005536 Bacteria 10885
79 Ga0070697_100033718 3300005536 Bacteria 4125
80 Ga0070697_100070589 3300005536 Bacteria 2864
81 Ga0070697_100279273 3300005536 Bacteria 1433
82 Ga0068853_100424464 3300005539 Bacteria 1247
83 Ga0070672_100170199 3300005543 Bacteria 1811
84 Ga0070686_100020156 3300005544 Bacteria 3943
85 Ga0070695_100062566 3300005545 Bacteria 2417
86 Ga0070695_100741036 3300005545 Bacteria 783
87 Ga0070696_100003663 3300005546 Bacteria 10249
88 Ga0068855_100041674 3300005563 Bacteria 5441
89 Ga0070664_100003555 3300005564 Bacteria 12590
90 Ga0070664_100154510 3300005564 Bacteria 2027
91 Ga0068857_100350272 3300005577 Bacteria 1367
92 Ga0068854_100027555 3300005578 Bacteria 3917
93 Ga0068856_100030473 3300005614 Bacteria 5273
94 Ga0068856_100330034 3300005614 Bacteria 1543
95 Ga0068856_100656887 3300005614 Unclassified 1069
96 Ga0070702_100003694 3300005615 Bacteria 6894
97 Ga0070702_100032599 3300005615 Bacteria 2860
98 Ga0068852_100188362 3300005616 Unclassified 1945
99 Ga0068852_100295902 3300005616 Unclassified 1565
100 Ga0068859_100002408 3300005617 Bacteria 19044
101 Ga0068859_100004524 3300005617 Bacteria 14182
102 Ga0068859_100020053 3300005617 Bacteria 6713
103 Ga0068864_100073585 3300005618 Unclassified 2979
104 Ga0068861_100474377 3300005719 Bacteria 1126
105 Ga0068851_10077743 3300005834 Unclassified 1728
106 Ga0068863_101062526 3300005841 Bacteria 813
107 Ga0068860_100020154 3300005843 Bacteria 6463
108 Ga0068860_100068904 3300005843 Bacteria 3362
109 Ga0081455_10055524 3300005937 Bacteria 3368
110 Ga0070715_10218013 3300006163 Bacteria 979
111 Ga0070716_100015414 3300006173 Bacteria 3926
112 Ga0070716_100094065 3300006173 Bacteria 1821
113 Ga0097621_100074976 3300006237 Bacteria 2803
114 Ga0097621_100104380 3300006237 Unclassified 2388
115 Ga0068871_100046893 3300006358 Unclassified 3482
116 Ga0075428_100000099 3300006844 Bacteria 72800
117 Ga0075428_100159745 3300006844 Bacteria 2446
118 Ga0075433_10087195 3300006852 Bacteria 2756
119 Ga0075429_100416439 3300006880 Unclassified 1177
120 Ga0075436_100094333 3300006914 Bacteria 2081
121 Ga0097620_100002408 3300006931 Bacteria 19044
122 Ga0097620_100004524 3300006931 Bacteria 14182
123 Ga0097620_100020053 3300006931 Bacteria 6713
124 Ga0105240_10004437 3300009093 Bacteria 21401
125 Ga0111539_10001258 3300009094 Bacteria 33783
126 Ga0111539_10092030 3300009094 Bacteria 3563
127 Ga0111539_10096576 3300009094 Bacteria 3471
128 Ga0105245_10012697 3300009098 Bacteria 7334
129 Ga0105245_10606062 3300009098 Bacteria 1122
130 Ga0105247_10225146 3300009101 Bacteria 1271
131 Ga0114129_10003862 3300009147 Bacteria 21126
132 Ga0114129_10011299 3300009147 Bacteria 12722
133 Ga0114129_10049977 3300009147 Bacteria 5874
134 Ga0105248_10133739 3300009177 Unclassified 2798
135 Ga0105248_10251622 3300009177 Bacteria 1989
136 Ga0105237_10069978 3300009545 Bacteria 3504
137 Ga0105237_10602620 3300009545 Bacteria 1106
138 Ga0105249_10072765 3300009553 Bacteria 3178
139 Ga0105239_10029501 3300010375 Bacteria 6031
140 Ga0105246_10040078 3300011119 Bacteria 3159
141 Ga0157373_10000674 3300013100 Bacteria 26717
142 Ga0157373_10087745 3300013100 Unclassified 2191
143 Ga0157370_10005892 3300013104 Bacteria 13661
144 Ga0157370_10163774 3300013104 Bacteria 2069
145 Ga0157369_10136706 3300013105 Bacteria 2594
146 Ga0157369_10155445 3300013105 Unclassified 2416
147 Ga0157369_10293562 3300013105 Bacteria 1692
148 Ga0157369_10371935 3300013105 Bacteria 1484
149 Ga0157374_10001983 3300013296 Bacteria 17163
150 Ga0157378_10225210 3300013297 Bacteria 1784
151 Ga0163162_11097620 3300013306 Bacteria 901
152 Ga0157372_10007933 3300013307 Bacteria 11284
153 Ga0157372_10093534 3300013307 Bacteria 3421
154 Ga0157372_10487949 3300013307 Bacteria 1436
155 Ga0157375_10054415 3300013308 Bacteria 3941
156 Ga0157375_10097697 3300013308 Bacteria 3012
157 Ga0163163_10007630 3300014325 Bacteria 9555
158 Ga0157377_10085557 3300014745 Unclassified 1852
159 Ga0157379_10435188 3300014968 Bacteria 1209
160 Ga0157376_10040268 3300014969 Bacteria 3818
161 Ga0157376_10147213 3300014969 Bacteria 2120
162 Ga0163161_10248371 3300017792 Bacteria 1386
163 Ga0206349_1171127 3300020075 Unclassified 1348
164 Ga0206349_1455044 3300020075 Bacteria 5386
165 Ga0206352_10487343 3300020078 Bacteria 1925
166 Ga0206352_10543395 3300020078 Bacteria 7711
167 Ga0206350_10510014 3300020080 Bacteria 1287
168 Ga0206350_10532316 3300020080 Unclassified 3066
169 Ga0224712_10002005 3300022467 Bacteria 4933
170 Ga0224712_10007227 3300022467 Unclassified 3221
171 Ga0207656_10071391 3300025321 Bacteria 1543
172 Ga0207692_10251992 3300025898 Bacteria 1058
173 Ga0207710_10206333 3300025900 Bacteria 972
174 Ga0207680_10246579 3300025903 Unclassified 1232
175 Ga0207647_10156046 3300025904 Bacteria 1333
176 Ga0207684_10001040 3300025910 Bacteria 31070
177 Ga0207684_10005996 3300025910 Bacteria 11118
178 Ga0207684_10223454 3300025910 Bacteria 1625
179 Ga0207654_10214313 3300025911 Unclassified 1274
180 Ga0207707_10001698 3300025912 Bacteria 20259
181 Ga0207707_10006392 3300025912 Bacteria 10289
182 Ga0207707_10007427 3300025912 Bacteria 9549
183 Ga0207695_10003486 3300025913 Bacteria 22123
184 Ga0207695_10037157 3300025913 Bacteria 5256
185 Ga0207671_10199762 3300025914 Bacteria 1561
186 Ga0207660_10000760 3300025917 Bacteria 21451
187 Ga0207660_10004995 3300025917 Bacteria 8648
188 Ga0207660_10010197 3300025917 Bacteria 6091
189 Ga0207660_10023630 3300025917 Bacteria 4154
190 Ga0207660_10054214 3300025917 Bacteria 2861
191 Ga0207660_10486923 3300025917 Unclassified 1000
192 Ga0207662_10255488 3300025918 Bacteria 1152
193 Ga0207662_10509089 3300025918 Bacteria 830
194 Ga0207657_10046589 3300025919 Bacteria 3797
195 Ga0207649_10001864 3300025920 Bacteria 12041
196 Ga0207649_10005599 3300025920 Bacteria 6792
197 Ga0207652_10000783 3300025921 Bacteria 30376
198 Ga0207652_10006328 3300025921 Bacteria 9563
199 Ga0207652_10018078 3300025921 Bacteria 5779
200 Ga0207652_10028719 3300025921 Bacteria 4643
201 Ga0207652_10052677 3300025921 Bacteria 3494
202 Ga0207652_10506640 3300025921 Unclassified 1086
203 Ga0207646_10000816 3300025922 Bacteria 40514
204 Ga0207646_10003160 3300025922 Bacteria 18865
205 Ga0207646_10017467 3300025922 Bacteria 6712
206 Ga0207646_10146441 3300025922 Unclassified 2128
207 Ga0207694_10214021 3300025924 Bacteria 1570
208 Ga0207650_10010785 3300025925 Bacteria 6275
209 Ga0207659_10261446 3300025926 Unclassified 1408
210 Ga0207687_10045968 3300025927 Unclassified 3020
211 Ga0207700_10354925 3300025928 Bacteria 1277
212 Ga0207700_10987939 3300025928 Unclassified 753
213 Ga0207690_10004418 3300025932 Bacteria 8296
214 Ga0207706_10009256 3300025933 Bacteria 9050
215 Ga0207706_10024733 3300025933 Bacteria 5382
216 Ga0207706_10110799 3300025933 Bacteria 2415
217 Ga0207669_10527965 3300025937 Bacteria 949
218 Ga0207665_10305659 3300025939 Bacteria 1190
219 Ga0207691_10041537 3300025940 Bacteria 4245
220 Ga0207711_10090280 3300025941 Unclassified 2693
221 Ga0207689_10000655 3300025942 Bacteria 33035
222 Ga0207689_10206018 3300025942 Bacteria 1624
223 Ga0207661_10000387 3300025944 Bacteria 28515
224 Ga0207661_10011046 3300025944 Bacteria 6526
225 Ga0207661_10029455 3300025944 Bacteria 4216
226 Ga0207661_10068444 3300025944 Bacteria 2891
227 Ga0207679_10002881 3300025945 Bacteria 10673
228 Ga0207667_10022677 3300025949 Bacteria 6926
229 Ga0207667_10041632 3300025949 Unclassified 4885
230 Ga0207651_10553860 3300025960 Bacteria 1000
231 Ga0207640_10002551 3300025981 Bacteria 9762
232 Ga0207640_10446837 3300025981 Bacteria 1064
233 Ga0207658_10067381 3300025986 Bacteria 2696
234 Ga0207658_10231761 3300025986 Unclassified 1559
235 Ga0207677_10058931 3300026023 Unclassified 2646
236 Ga0207703_10113595 3300026035 Bacteria 2315
237 Ga0207639_10293311 3300026041 Bacteria 1435
238 Ga0207639_10722823 3300026041 Unclassified 925
239 Ga0207678_10387438 3300026067 Bacteria 1209
240 Ga0207708_10035646 3300026075 Bacteria 3786
241 Ga0207708_10064948 3300026075 Bacteria 2789
242 Ga0207702_10016796 3300026078 Bacteria 6058
243 Ga0207702_10701225 3300026078 Bacteria 997
244 Ga0207641_10009474 3300026088 Bacteria 8026
245 Ga0207676_10008708 3300026095 Bacteria 7216
246 Ga0207674_10000066 3300026116 Bacteria 107916
247 Ga0207675_100299570 3300026118 Bacteria 1566
248 Ga0207675_100683442 3300026118 Bacteria 1034
249 Ga0207683_10378332 3300026121 Bacteria 1301
250 Ga0207698_10156526 3300026142 Unclassified 1986
251 Ga0209588_1009637 3300027671 Bacteria 2888
252 Ga0207428_10006845 3300027907 Bacteria 10452
253 Ga0268264_10007980 3300028381 Bacteria 8808
254 Ga0268264_10032417 3300028381 Bacteria 4287
255 Ga0265338_10124528 3300028800 Bacteria 2048
256 Ga0265332_10002155 3300031238 Bacteria 10150
257 Ga0265327_10004420 3300031251 Bacteria 12460
258 Ga0307408_100048827 3300031548 Bacteria 3037
259 Ga0265314_10005919 3300031711 Bacteria 10939
260 Ga0307405_10194137 3300031731 Bacteria 1469
261 Ga0373934_0057572 3300035086 Bacteria 1546
262 Ga0373940_0092338 3300035088 Unclassified 909
263 Ga0373936_0014332 3300035113 Bacteria 3028
264 Ga0373953_0155325 3300035117 Unclassified 982
265 Ga0373956_0123504 3300035119 Bacteria 1210
266 Ga0373957_0008700 3300035120 Unclassified 3301
267 Ga0373957_0346974 3300035120 Bacteria 634
268 Ga0373943_0042655 3300035170 Bacteria 2199
269 Ga0373955_0057356 3300035172 Bacteria 2139
270 Ga0373931_0002859 3300035691 Bacteria 7700
271 Ga0373931_0028988 3300035691 Bacteria 2838
272 Ga0373927_0012178 3300035695 Bacteria 5720
273 Ga0373933_0018326 3300035724 Unclassified 3936
274 Ga0373947_0018687 3300035725 Bacteria 3991
275 Ga0373937_0000448 3300036401 Bacteria 38003
276 Ga0373937_0168415 3300036401 Bacteria 2055
277 Ga0373925_0096857 3300037068 Bacteria 2262
278 Ga0436365_0478920 3300039437 Bacteria 835
279 Ga0436363_0163546 3300039450 Bacteria 3743
280 Ga0451577_0005957 3300042876 Bacteria 12289
281 Ga0466969_0061316 3300044656 Bacteria 1827
282 Ga0466972_0007103 3300044658 Bacteria 5622
283 Ga0453683_0095386 3300044673 Unclassified 1866
284 Ga0453683_0233792 3300044673 Bacteria 1170
285 Ga0466966_0231287 3300044684 Bacteria 1115
286 Ga0466961_0023912 3300044693 Bacteria 3931
287 Ga0453684_0015623 3300044712 Bacteria 11976
288 Ga0466968_0253197 3300044735 Bacteria 837
289 Ga0466959_0071846 3300045049 Bacteria 2505
290 Ga0466959_0091850 3300045049 Bacteria 2180
291 Ga0495603_0044687 3300046455 Bacteria 2643
292 Ga0495629_0000567 3300046459 Bacteria 30144
293 Ga0495629_0048699 3300046459 Bacteria 2971
294 Ga0495629_0105768 3300046459 Bacteria 1963
295 Ga0495651_0003975 3300046462 Bacteria 11300
296 Ga0495580_0103320 3300046472 Unclassified 1981
297 Ga0495582_0006669 3300046473 Bacteria 6414
298 Ga0495582_0014821 3300046473 Bacteria 4283
299 Ga0495639_0006339 3300046475 Bacteria 5084
300 Ga0495639_0013871 3300046475 Unclassified 3483
301 Ga0495662_0038410 3300046476 Bacteria 2314
302 Ga0495664_0169706 3300046477 Bacteria 1324
303 Ga0495594_0011305 3300046499 Bacteria 4638
304 Ga0495628_0035784 3300046516 Bacteria 3989
305 Ga0495630_0010359 3300046517 Bacteria 6727
306 Ga0495630_0371736 3300046517 Unclassified 1095
307 Ga0495630_0490624 3300046517 Bacteria 942
308 Ga0495666_0088921 3300046526 Bacteria 1459
309 Ga0495665_0066846 3300046531 Unclassified 1896
310 Ga0495586_0016054 3300046535 Unclassified 3984
311 Ga0495586_0019021 3300046535 Bacteria 3656
312 Ga0495587_0002752 3300046536 Bacteria 11734
313 Ga0495587_0309174 3300046536 Unclassified 883
314 Ga0495645_0000804 3300046543 Bacteria 21498
315 Ga0495667_0008829 3300046559 Bacteria 6854
316 Ga0495634_0035186 3300046642 Unclassified 3432
317 Ga0495635_0021960 3300046663 Bacteria 4447
318 Ga0495657_0258252 3300046675 Bacteria 1047
319 Ga0495647_0010222 3300046681 Bacteria 3193
320 Ga0495647_0257463 3300046681 Bacteria 778
321 Ga0495658_0000066 3300046683 Bacteria 52738
322 Ga0495658_0098674 3300046683 Bacteria 1740
323 Ga0495658_0136078 3300046683 Bacteria 1499
324 Ga0495613_0004365 3300046689 Bacteria 10579
325 Ga0495600_0016233 3300046809 Bacteria 4722
326 Ga0495581_0000921 3300047315 Bacteria 15784
327 Ga0495581_0012413 3300047315 Bacteria 4935
328 Ga0495676_0065492 3300047321 Bacteria 2820
329 Ga0495680_0000722 3300047322 Bacteria 37172
330 Ga0495684_0212409 3300047471 Unclassified 1422
331 Ga0495684_0255691 3300047471 Bacteria 1273
332 Ga0495602_0313817 3300048088 Unclassified 1143
333 Ga0495614_0008484 3300048089 Bacteria 4568
334 Ga0496106_0942638 3300048909 Bacteria 680
335 Ga0496107_0311679 3300048910 Bacteria 1171
336 Ga0501033_0045434 3300049570 Bacteria 3269
337 Ga0501034_0260783 3300049571 Bacteria 1676
338 Ga0501043_0123321 3300049579 Bacteria 2032
339 Ga0501069_0006489 3300049585 Bacteria 6116
340 Ga0501071_0301442 3300049587 Unclassified 1215
341 Ga0501083_0214673 3300049744 Bacteria 1254
342 nmdc:mga05p37_1487_c1 3300050507 Bacteria 27251
343 nmdc:mga05p37_3888_c1 3300050507 Bacteria 17468
344 nmdc:mga05p37_55263_c1 3300050507 Bacteria 4885
345 nmdc:mga09592_55757_c1 3300050508 Bacteria 3339
346 nmdc:mga06r32_163647_c1 3300050510 Bacteria 2207
347 nmdc:mga08y16_70750_c1 3300050511 Bacteria 3636
348 nmdc:mga08y16_7582_c1 3300050511 Bacteria 11361
349 nmdc:mga0n895_353907_c1 3300050512 Unclassified 1487
350 nmdc:mga0a205_259460_c1 3300050515 Unclassified 1616
351 Ga0495619_0000605 3300053085 Bacteria 23789
352 Ga0500641_0001115 3300053096 Bacteria 9550
353 Ga0500555_000393 3300053103 Bacteria 18348
354 Ga0500592_003884 3300053116 Bacteria 2387
355 Ga0500616_0000823 3300053153 Bacteria 35166
356 Ga0500645_002747 3300053730 Bacteria 7629
357 Ga0099794_10014459
358 JGI24752J21851_1017518
359 Ga0058863_11600609
360 Ga0058861_11865005
361 Ga0058862_12142227
362 Ga0058862_12517130
363 Ga0070658_10485117
364 Ga0070683_100003200
365 Ga0070683_100003366
366 Ga0070683_100012542
367 Ga0070683_100021319
368 Ga0070683_100032281
369 Ga0070690_100036940
370 Ga0070690_100057281
371 Ga0070690_100139079
372 Ga0070670_100032765
373 Ga0068869_100008257
374 Ga0068869_100049581
375 Ga0070680_100001828
376 Ga0070680_100216834
377 Ga0070682_100001984
378 Ga0068868_100113983
379 Ga0070689_100631028
380 Ga0070691_10003195
381 Ga0070691_10116468
382 Ga0070687_100059790
383 Ga0070687_100250261
384 Ga0070661_100001030
385 Ga0070661_100007493
386 Ga0070692_10151525
387 Ga0070669_100001989
388 Ga0070675_100011622
389 Ga0070675_100372811
390 Ga0070674_100342989
391 Ga0070673_100629554
392 Ga0070659_100043791
393 Ga0070667_100651324
394 Ga0070709_10243215
395 Ga0070714_100014052
396 Ga0070714_100025505
397 Ga0070714_100138789
398 Ga0070713_100019265
399 Ga0070713_100909147
400 Ga0070705_100405352
401 Ga0070700_100148409
402 Ga0070700_100302794
403 Ga0070708_100000168
404 Ga0070708_100387380
405 Ga0070662_100203455
406 Ga0070681_10000529
407 Ga0070681_10000633
408 Ga0070685_10206883
409 Ga0070706_100010276
410 Ga0070706_100014810
411 Ga0070706_100235295
412 Ga0070706_100551027
413 Ga0070707_100001079
414 Ga0070707_100037608
415 Ga0070707_100225808
416 Ga0070698_100005517
417 Ga0070698_100052724
418 Ga0070698_100067106
419 Ga0070698_100077540
420 Ga0070698_100081040
421 Ga0070698_100092514
422 Ga0070699_100042732
423 Ga0070679_100005036
424 Ga0070679_100008779
425 Ga0070679_100014964
426 Ga0070679_100017179
427 Ga0070679_100018848
428 Ga0070679_100032064
429 Ga0070684_100003904
430 Ga0070684_100084647
431 Ga0070684_100176023
432 Ga0070684_100274713
433 Ga0070697_100000034
434 Ga0070697_100004335
435 Ga0070697_100033718
436 Ga0070697_100070589
437 Ga0070697_100279273
438 Ga0068853_100424464
439 Ga0070672_100170199
440 Ga0070686_100020156
441 Ga0070695_100062566
442 Ga0070695_100741036
443 Ga0070696_100003663
444 Ga0068855_100041674
445 Ga0070664_100003555
446 Ga0070664_100154510
447 Ga0068857_100350272
448 Ga0068854_100027555
449 Ga0068856_100030473
450 Ga0068856_100330034
451 Ga0068856_100656887
452 Ga0070702_100003694
453 Ga0070702_100032599
454 Ga0068852_100188362
455 Ga0068852_100295902
456 Ga0068859_100002408
457 Ga0068859_100004524
458 Ga0068859_100020053
459 Ga0068864_100073585
460 Ga0068861_100474377
461 Ga0068851_10077743
462 Ga0068863_101062526
463 Ga0068860_100020154
464 Ga0068860_100068904
465 Ga0081455_10055524
466 Ga0070715_10218013
467 Ga0070716_100015414
468 Ga0070716_100094065
469 Ga0097621_100074976
470 Ga0097621_100104380
471 Ga0068871_100046893
472 Ga0075428_100000099
473 Ga0075428_100159745
474 Ga0075433_10087195
475 Ga0075429_100416439
476 Ga0075436_100094333
477 Ga0097620_100002408
478 Ga0097620_100004524
479 Ga0097620_100020053
480 Ga0105240_10004437
481 Ga0111539_10001258
482 Ga0111539_10092030
483 Ga0111539_10096576
484 Ga0105245_10012697
485 Ga0105245_10606062
486 Ga0105247_10225146
487 Ga0114129_10003862
488 Ga0114129_10011299
489 Ga0114129_10049977
490 Ga0105248_10133739
491 Ga0105248_10251622
492 Ga0105237_10069978
493 Ga0105237_10602620
494 Ga0105249_10072765
495 Ga0105239_10029501
496 Ga0105246_10040078
497 Ga0157373_10000674
498 Ga0157373_10087745
499 Ga0157370_10005892
500 Ga0157370_10163774
501 Ga0157369_10136706
502 Ga0157369_10155445
503 Ga0157369_10293562
504 Ga0157369_10371935
505 Ga0157374_10001983
506 Ga0157378_10225210
507 Ga0163162_11097620
508 Ga0157372_10007933
509 Ga0157372_10093534
510 Ga0157372_10487949
511 Ga0157375_10054415
512 Ga0157375_10097697
513 Ga0163163_10007630
514 Ga0157377_10085557
515 Ga0157379_10435188
516 Ga0157376_10040268
517 Ga0157376_10147213
518 Ga0163161_10248371
519 Ga0206349_1171127
520 Ga0206349_1455044
521 Ga0206352_10487343
522 Ga0206352_10543395
523 Ga0206350_10510014
524 Ga0206350_10532316
525 Ga0224712_10002005
526 Ga0224712_10007227
527 Ga0207656_10071391
528 Ga0207692_10251992
529 Ga0207710_10206333
530 Ga0207680_10246579
531 Ga0207647_10156046
532 Ga0207684_10001040
533 Ga0207684_10005996
534 Ga0207684_10223454
535 Ga0207654_10214313
536 Ga0207707_10001698
537 Ga0207707_10006392
538 Ga0207707_10007427
539 Ga0207695_10003486
540 Ga0207695_10037157
541 Ga0207671_10199762
542 Ga0207660_10000760
543 Ga0207660_10004995
544 Ga0207660_10010197
545 Ga0207660_10023630
546 Ga0207660_10054214
547 Ga0207660_10486923
548 Ga0207662_10255488
549 Ga0207662_10509089
550 Ga0207657_10046589
551 Ga0207649_10001864
552 Ga0207649_10005599
553 Ga0207652_10000783
554 Ga0207652_10006328
555 Ga0207652_10018078
556 Ga0207652_10028719
557 Ga0207652_10052677
558 Ga0207652_10506640
559 Ga0207646_10000816
560 Ga0207646_10003160
561 Ga0207646_10017467
562 Ga0207646_10146441
563 Ga0207694_10214021
564 Ga0207650_10010785
565 Ga0207659_10261446
566 Ga0207687_10045968
567 Ga0207700_10354925
568 Ga0207700_10987939
569 Ga0207690_10004418
570 Ga0207706_10009256
571 Ga0207706_10024733
572 Ga0207706_10110799
573 Ga0207669_10527965
574 Ga0207665_10305659
575 Ga0207691_10041537
576 Ga0207711_10090280
577 Ga0207689_10000655
578 Ga0207689_10206018
579 Ga0207661_10000387
580 Ga0207661_10011046
581 Ga0207661_10029455
582 Ga0207661_10068444
583 Ga0207679_10002881
584 Ga0207667_10022677
585 Ga0207667_10041632
586 Ga0207651_10553860
587 Ga0207640_10002551
588 Ga0207640_10446837
589 Ga0207658_10067381
590 Ga0207658_10231761
591 Ga0207677_10058931
592 Ga0207703_10113595
593 Ga0207639_10293311
594 Ga0207639_10722823
595 Ga0207678_10387438
596 Ga0207708_10035646
597 Ga0207708_10064948
598 Ga0207702_10016796
599 Ga0207702_10701225
600 Ga0207641_10009474
601 Ga0207676_10008708
602 Ga0207674_10000066
603 Ga0207675_100299570
604 Ga0207675_100683442
605 Ga0207683_10378332
606 Ga0207698_10156526
607 Ga0209588_1009637
608 Ga0207428_10006845
609 Ga0268264_10007980
610 Ga0268264_10032417
611 Ga0265338_10124528
612 Ga0265332_10002155
613 Ga0265327_10004420
614 Ga0307408_100048827
615 Ga0265314_10005919
616 Ga0307405_10194137
617 Ga0373934_0057572
618 Ga0373940_0092338
619 Ga0373936_0014332
620 Ga0373953_0155325
621 Ga0373956_0123504
622 Ga0373957_0008700
623 Ga0373957_0346974
624 Ga0373943_0042655
625 Ga0373955_0057356
626 Ga0373931_0002859
627 Ga0373931_0028988
628 Ga0373927_0012178
629 Ga0373933_0018326
630 Ga0373947_0018687
631 Ga0373937_0000448
632 Ga0373937_0168415
633 Ga0373925_0096857
634 Ga0436365_0478920
635 Ga0436363_0163546
636 Ga0451577_0005957
637 Ga0466969_0061316
638 Ga0466972_0007103
639 Ga0453683_0095386
640 Ga0453683_0233792
641 Ga0466966_0231287
642 Ga0466961_0023912
643 Ga0453684_0015623
644 Ga0466968_0253197
645 Ga0466959_0071846
646 Ga0466959_0091850
647 Ga0495603_0044687
648 Ga0495629_0000567
649 Ga0495629_0048699
650 Ga0495629_0105768
651 Ga0495651_0003975
652 Ga0495580_0103320
653 Ga0495582_0006669
654 Ga0495582_0014821
655 Ga0495639_0006339
656 Ga0495639_0013871
657 Ga0495662_0038410
658 Ga0495664_0169706
659 Ga0495594_0011305
660 Ga0495628_0035784
661 Ga0495630_0010359
662 Ga0495630_0371736
663 Ga0495630_0490624
664 Ga0495666_0088921
665 Ga0495665_0066846
666 Ga0495586_0016054
667 Ga0495586_0019021
668 Ga0495587_0002752
669 Ga0495587_0309174
670 Ga0495645_0000804
671 Ga0495667_0008829
672 Ga0495634_0035186
673 Ga0495635_0021960
674 Ga0495657_0258252
675 Ga0495647_0010222
676 Ga0495647_0257463
677 Ga0495658_0000066
678 Ga0495658_0098674
679 Ga0495658_0136078
680 Ga0495613_0004365
681 Ga0495600_0016233
682 Ga0495581_0000921
683 Ga0495581_0012413
684 Ga0495676_0065492
685 Ga0495680_0000722
686 Ga0495684_0212409
687 Ga0495684_0255691
688 Ga0495602_0313817
689 Ga0495614_0008484
690 Ga0496106_0942638
691 Ga0496107_0311679
692 Ga0501033_0045434
693 Ga0501034_0260783
694 Ga0501043_0123321
695 Ga0501069_0006489
696 Ga0501071_0301442
697 Ga0501083_0214673
698 nmdc:mga05p37_1487_c1
699 nmdc:mga05p37_3888_c1
700 nmdc:mga05p37_55263_c1
701 nmdc:mga09592_55757_c1
702 nmdc:mga06r32_163647_c1
703 nmdc:mga08y16_70750_c1
704 nmdc:mga08y16_7582_c1
705 nmdc:mga0n895_353907_c1
706 nmdc:mga0a205_259460_c1
707 Ga0495619_0000605
708 Ga0500641_0001115
709 Ga0500555_000393
710 Ga0500592_003884
711 Ga0500616_0000823
712 Ga0500645_002747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

30

260

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cpg-assembly1.cif.gz_A crystal structure of an unknown protein from bifidobacterium adolescentis 0.935 5 221
5nlc-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942,without plp 0.9167 6 222
5nm8-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942, with plp bound 0.916 6 222
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9131 5 224
1w8g-assembly1.cif.gz_A crystal structure of e. coli k-12 yggs 0.912 5 223
ID Description Score Start End Superfamily
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9305 6 222 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.916 6 222 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.912 5 223 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9077 6 222 3.20.20.10
af_Q1ZXI6_1_255_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9072 3 224 3.20.20.10
ID Description Score Start End GO Terms
AF-W0RHI2-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9964 1 225 GO:0005737
GO:0030170
GO:0051301
AF-A0A838T4N8-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9958 1 224 GO:0030170
AF-W0RHI2-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9877 1 225 GO:0005737
GO:0030170
GO:0051301
AF-A0A382G5J7-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9677 73 226 GO:0030170
AF-A0A6I2A1C0-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9672 7 225 GO:0030170

Map