F420393

General Info

Members Datasets Scaffolds Average Seq Length
356 182 712 252

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100237345|Ga0070683_1002373452
Length 277
Sequence MVGWSTYPEGGDGSQGXXXXEPDPGTVASRGLEALRSLVLALILEERRLGTIGTGPGSGSLWMAGDVRVGPPASDRSPGGGHQFAASNEDSAADRDRLIALVELARTGDADAFGMLFDHYHGSVYRFLFHRTRSTTLAEDLTSETFFRALRSMSSFRWQGKDFGAWLMTIARNLCMDHFKAGRTRLEMTTEDMGLHDDSTTEGPEDAVLTSLTNEVLLEALTELPAEQRDCLVMRFLQGMSISETAAVLGRSDGAVKQLQLRGVRNLAKLMPEGIRD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
70 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
86 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2643221561 Nocardioides sp. Root151 Isolate Unclassified
173 2643221615 Nocardioides sp. Root224 Isolate Unclassified
174 2643221641 Nocardioides sp. Root122 Isolate Unclassified
175 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
176 2643221696 Nocardioides sp. Root140 Isolate Unclassified
177 2739367898 Nocardioides sp. CF479 Isolate Unclassified
178 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
179 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
180 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
181 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
182 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.79
Metatranscriptomes 1.12
Isolates 3.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 0
Rhizoplane 9.27
Rhizosphere 73.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100237345 3300005329 Bacteria 1734
2 JGI24735J21928_10047879 3300002067 Bacteria 1238
3 JGI24750J21931_1016957 3300002070 Bacteria 992
4 Ga0070658_10006407 3300005327 Bacteria 9539
5 Ga0070658_10211530 3300005327 Bacteria 1638
6 Ga0070683_100000595 3300005329 Bacteria 25935
7 Ga0070683_100245247 3300005329 Bacteria 1704
8 Ga0068868_100492985 3300005338 Bacteria 1072
9 Ga0070660_100153269 3300005339 Bacteria 1854
10 Ga0070660_100265570 3300005339 Bacteria 1402
11 Ga0070660_100361551 3300005339 Bacteria 1196
12 Ga0070660_100426843 3300005339 Bacteria 1098
13 Ga0070659_100051835 3300005366 Bacteria 3226
14 Ga0070659_100175725 3300005366 Bacteria 1756
15 Ga0070659_100231914 3300005366 Bacteria 1526
16 Ga0070667_100054262 3300005367 Bacteria 3384
17 Ga0070681_10281076 3300005458 Bacteria 1575
18 Ga0070681_10592498 3300005458 Bacteria 1023
19 Ga0070707_100015714 3300005468 Bacteria 7107
20 Ga0070698_100000205 3300005471 Bacteria 56962
21 Ga0070684_100000974 3300005535 Bacteria 20418
22 Ga0070684_100121319 3300005535 Bacteria 2352
23 Ga0070672_100204076 3300005543 Bacteria 1654
24 Ga0070672_100349126 3300005543 Bacteria 1261
25 Ga0070696_100472584 3300005546 Bacteria 993
26 Ga0068855_100081379 3300005563 Bacteria 3754
27 Ga0070664_100005522 3300005564 Bacteria 10150
28 Ga0068857_100019761 3300005577 Bacteria 5917
29 Ga0070702_100080042 3300005615 Bacteria 1954
30 Ga0068864_100172300 3300005618 Bacteria 1974
31 Ga0068861_100293478 3300005719 Bacteria 1405
32 Ga0068851_10095472 3300005834 Bacteria 1571
33 Ga0068858_100153776 3300005842 Bacteria 2164
34 Ga0068860_100003178 3300005843 Bacteria 16944
35 Ga0081455_10030374 3300005937 Bacteria 4907
36 Ga0075365_10006841 3300006038 Bacteria 6323
37 Ga0075365_10019761 3300006038 Bacteria 4164
38 Ga0075365_10020983 3300006038 Bacteria 4065
39 Ga0075365_10023099 3300006038 Bacteria 3907
40 Ga0075365_10167674 3300006038 Bacteria 1532
41 Ga0075365_10174626 3300006038 Bacteria 1500
42 Ga0075365_10217656 3300006038 Bacteria 1340
43 Ga0075368_10000043 3300006042 Bacteria 29599
44 Ga0075368_10063704 3300006042 Bacteria 1479
45 Ga0075363_100003991 3300006048 Bacteria 6384
46 Ga0075363_100026249 3300006048 Bacteria 2978
47 Ga0075363_100038923 3300006048 Bacteria 2501
48 Ga0075363_100146938 3300006048 Bacteria 1329
49 Ga0075363_100274621 3300006048 Bacteria 974
50 Ga0075364_10007183 3300006051 Bacteria 6593
51 Ga0075364_10011404 3300006051 Bacteria 5400
52 Ga0075364_10079646 3300006051 Bacteria 2165
53 Ga0075364_10084741 3300006051 Bacteria 2098
54 Ga0075364_10091228 3300006051 Bacteria 2021
55 Ga0075364_10134660 3300006051 Bacteria 1660
56 Ga0075362_10025008 3300006177 Bacteria 2537
57 Ga0075367_10003472 3300006178 Bacteria 7524
58 Ga0075367_10017387 3300006178 Bacteria 3947
59 Ga0075370_10002608 3300006353 Bacteria 8408
60 Ga0068871_100247449 3300006358 Bacteria 1552
61 Ga0068865_100050389 3300006881 Bacteria 2876
62 Ga0105245_10026354 3300009098 Bacteria 5116
63 Ga0105243_10102105 3300009148 Bacteria 2382
64 Ga0105242_10107914 3300009176 Bacteria 2369
65 Ga0105242_10496543 3300009176 Bacteria 1160
66 Ga0105237_10161755 3300009545 Bacteria 2237
67 Ga0105238_10621275 3300009551 Bacteria 1089
68 Ga0105238_10912887 3300009551 Bacteria 897
69 Ga0105249_10065596 3300009553 Bacteria 3340
70 Ga0105239_10001253 3300010375 Bacteria 34499
71 Ga0105246_10004009 3300011119 Bacteria 8938
72 Ga0157372_10003008 3300013307 Bacteria 18176
73 Ga0157372_10074576 3300013307 Bacteria 3826
74 Ga0157372_11007155 3300013307 Bacteria 965
75 Ga0157375_10020640 3300013308 Bacteria 6023
76 Ga0157375_10088904 3300013308 Bacteria 3145
77 Ga0163163_10167934 3300014325 Bacteria 2241
78 Ga0163163_10192984 3300014325 Bacteria 2085
79 Ga0163163_10550505 3300014325 Bacteria 1216
80 Ga0157379_10004243 3300014968 Bacteria 12239
81 Ga0197907_11487420 3300020069 Bacteria 899
82 Ga0206354_11431985 3300020081 Bacteria 1183
83 Ga0207688_10055446 3300025901 Bacteria 2224
84 Ga0207647_10019396 3300025904 Bacteria 4575
85 Ga0207647_10038695 3300025904 Bacteria 3014
86 Ga0207647_10313813 3300025904 Bacteria 891
87 Ga0207660_10136686 3300025917 Bacteria 1871
88 Ga0207657_10005113 3300025919 Bacteria 13744
89 Ga0207657_10088290 3300025919 Bacteria 2592
90 Ga0207646_10036111 3300025922 Bacteria 4462
91 Ga0207687_10030052 3300025927 Bacteria 3660
92 Ga0207690_10176046 3300025932 Bacteria 1607
93 Ga0207690_10380140 3300025932 Bacteria 1122
94 Ga0207686_10147976 3300025934 Bacteria 1631
95 Ga0207704_10004229 3300025938 Bacteria 6561
96 Ga0207691_10212952 3300025940 Bacteria 1678
97 Ga0207691_10432146 3300025940 Bacteria 1121
98 Ga0207661_10002542 3300025944 Bacteria 12561
99 Ga0207679_10325977 3300025945 Bacteria 1331
100 Ga0207667_10051679 3300025949 Bacteria 4331
101 Ga0207667_10779165 3300025949 Bacteria 954
102 Ga0207658_10020758 3300025986 Bacteria 4551
103 Ga0207703_10128883 3300026035 Bacteria 2182
104 Ga0207648_10063647 3300026089 Bacteria 3214
105 Ga0207676_10167818 3300026095 Bacteria 1909
106 Ga0207676_10180334 3300026095 Bacteria 1849
107 Ga0207674_10025492 3300026116 Bacteria 6305
108 Ga0207683_10030078 3300026121 Bacteria 4704
109 Ga0209813_10006114 3300027866 Bacteria 2960
110 Ga0268264_10000193 3300028381 Bacteria 126247
111 Ga0316183_1105499 3300030742 Bacteria 1434
112 Ga0316181_1208223 3300030744 Bacteria 1823
113 Ga0307413_10037647 3300031824 Bacteria 2796
114 Ga0307413_10354995 3300031824 Bacteria 1133
115 Ga0307410_10042193 3300031852 Bacteria 3014
116 Ga0307410_10277692 3300031852 Bacteria 1313
117 Ga0307406_10225809 3300031901 Bacteria 1395
118 Ga0307407_10032933 3300031903 Bacteria 2823
119 Ga0307407_10079925 3300031903 Bacteria 1974
120 Ga0307412_10094028 3300031911 Bacteria 2104
121 Ga0307412_10125598 3300031911 Bacteria 1855
122 Ga0307412_10194536 3300031911 Bacteria 1536
123 Ga0307409_100002523 3300031995 Bacteria 9595
124 Ga0307409_100011214 3300031995 Bacteria 5634
125 Ga0307409_100186097 3300031995 Bacteria 1843
126 Ga0307409_100225256 3300031995 Bacteria 1696
127 Ga0307416_100008704 3300032002 Bacteria 6573
128 Ga0307416_100108794 3300032002 Bacteria 2436
129 Ga0307416_100245002 3300032002 Bacteria 1740
130 Ga0307414_10071348 3300032004 Bacteria 2505
131 Ga0307414_10431731 3300032004 Bacteria 1151
132 Ga0307411_10059740 3300032005 Bacteria 2529
133 Ga0307411_10288417 3300032005 Bacteria 1310
134 Ga0307415_100000142 3300032126 Bacteria 31723
135 Ga0307415_100125400 3300032126 Bacteria 1934
136 Ga0307415_100198031 3300032126 Bacteria 1591
137 Ga0307415_100335391 3300032126 Bacteria 1267
138 Ga0395898_0400357 3300037466 Bacteria 1309
139 Ga0395905_0084270 3300037471 Bacteria 2978
140 Ga0395901_0006072 3300038443 Bacteria 12241
141 Ga0395901_0142273 3300038443 Bacteria 2521
142 Ga0436365_1697618 3300039437 Bacteria 813
143 Ga0450907_035623 3300042146 Bacteria 849
144 Ga0439464_0017156 3300042439 Bacteria 1961
145 Ga0466972_0012348 3300044658 Bacteria 4293
146 Ga0466972_0052646 3300044658 Bacteria 1961
147 Ga0466972_0166102 3300044658 Bacteria 1036
148 Ga0466972_0187305 3300044658 Bacteria 970
149 Ga0466965_0028282 3300044683 Bacteria 2723
150 Ga0466965_0041482 3300044683 Bacteria 2268
151 Ga0466965_0056445 3300044683 Bacteria 1956
152 Ga0466966_0027145 3300044684 Bacteria 3733
153 Ga0466966_0038552 3300044684 Bacteria 3080
154 Ga0466966_0219895 3300044684 Bacteria 1147
155 Ga0466961_0031626 3300044693 Bacteria 3402
156 Ga0466961_0034231 3300044693 Bacteria 3262
157 Ga0466961_0054405 3300044693 Bacteria 2553
158 Ga0466961_0178417 3300044693 Bacteria 1319
159 Ga0466963_0068144 3300044694 Bacteria 2389
160 Ga0466963_0091443 3300044694 Bacteria 2073
161 Ga0466964_0082693 3300044706 Bacteria 1381
162 Ga0466964_0159295 3300044706 Bacteria 1053
163 Ga0466964_0174252 3300044706 Bacteria 1015
164 Ga0466971_0011125 3300044719 Bacteria 3940
165 Ga0466971_0026643 3300044719 Bacteria 2585
166 Ga0466971_0045182 3300044719 Bacteria 1978
167 Ga0466971_0125889 3300044719 Bacteria 1187
168 Ga0466968_0077148 3300044735 Bacteria 1459
169 Ga0466968_0135172 3300044735 Bacteria 1124
170 Ga0466970_0005228 3300044765 Bacteria 6423
171 Ga0466970_0015817 3300044765 Bacteria 3884
172 Ga0466970_0024512 3300044765 Bacteria 3155
173 Ga0466970_0112133 3300044765 Bacteria 1490
174 Ga0466970_0193914 3300044765 Bacteria 1129
175 Ga0466970_0437678 3300044765 Bacteria 749
176 Ga0466957_0008479 3300044842 Bacteria 5847
177 Ga0466957_0031631 3300044842 Bacteria 3163
178 Ga0466957_0058501 3300044842 Bacteria 2361
179 Ga0466957_0392146 3300044842 Bacteria 948
180 Ga0466960_0002015 3300044901 Bacteria 7536
181 Ga0466960_0017942 3300044901 Bacteria 3095
182 Ga0466960_0025412 3300044901 Bacteria 2680
183 Ga0466960_0042820 3300044901 Bacteria 2151
184 Ga0466960_0110236 3300044901 Bacteria 1429
185 Ga0466959_0410622 3300045049 Bacteria 919
186 Ga0466958_0234414 3300045836 Bacteria 1172
187 Ga0466967_0030412 3300045976 Bacteria 4532
188 Ga0466967_0071954 3300045976 Bacteria 3097
189 Ga0466967_0087823 3300045976 Bacteria 2820
190 Ga0466967_0205288 3300045976 Bacteria 1867
191 Ga0495664_0166309 3300046477 Bacteria 1338
192 Ga0495594_0211550 3300046499 Bacteria 1106
193 Ga0495608_0346528 3300046511 Bacteria 915
194 Ga0495657_0091491 3300046675 Bacteria 1951
195 Ga0495674_0211004 3300047319 Bacteria 1608
196 Ga0495674_0675860 3300047319 Bacteria 812
197 Ga0495676_0114340 3300047321 Bacteria 1975
198 Ga0496100_0047403 3300048903 Bacteria 2769
199 Ga0496100_0094076 3300048903 Bacteria 2052
200 Ga0496101_0058681 3300048904 Bacteria 2788
201 Ga0496101_0119486 3300048904 Bacteria 1991
202 Ga0496102_0002966 3300048905 Bacteria 14371
203 Ga0496102_0021720 3300048905 Bacteria 5679
204 Ga0496102_0025322 3300048905 Bacteria 5281
205 Ga0496102_0101257 3300048905 Bacteria 2676
206 Ga0496102_0568091 3300048905 Bacteria 1057
207 Ga0496103_0036089 3300048906 Bacteria 3027
208 Ga0496103_0312091 3300048906 Bacteria 1011
209 Ga0496104_0089672 3300048907 Bacteria 2937
210 Ga0496105_0013742 3300048908 Bacteria 6428
211 Ga0496105_0186984 3300048908 Bacteria 1695
212 Ga0496105_0289372 3300048908 Bacteria 1319
213 Ga0496106_0010472 3300048909 Bacteria 6847
214 Ga0496106_0228504 3300048909 Bacteria 1485
215 Ga0496107_0006668 3300048910 Bacteria 7947
216 Ga0496107_0316351 3300048910 Bacteria 1162
217 Ga0496108_0435977 3300048911 Bacteria 1144
218 Ga0496109_0001848 3300048912 Bacteria 17542
219 Ga0496109_0112827 3300048912 Bacteria 2528
220 Ga0496110_0000438 3300048913 Bacteria 28365
221 Ga0496110_0045998 3300048913 Bacteria 3817
222 Ga0496110_0053005 3300048913 Bacteria 3564
223 Ga0496111_0000246 3300048914 Bacteria 26045
224 Ga0496111_0270200 3300048914 Bacteria 1261
225 Ga0496112_0099865 3300048915 Bacteria 2872
226 Ga0496112_0216062 3300048915 Bacteria 1874
227 Ga0496113_0272241 3300048916 Bacteria 1353
228 Ga0496114_0016014 3300048917 Bacteria 6033
229 Ga0496114_0086914 3300048917 Bacteria 2650
230 Ga0496115_0001052 3300048918 Bacteria 20018
231 Ga0496118_0315993 3300048921 Bacteria 850
232 Ga0501307_021071 3300049162 Bacteria 848
233 Ga0501031_0003162 3300049568 Bacteria 10566
234 Ga0501031_0010175 3300049568 Bacteria 6127
235 Ga0501031_0285979 3300049568 Bacteria 1069
236 Ga0501031_0422686 3300049568 Bacteria 861
237 Ga0501032_0002412 3300049569 Bacteria 14583
238 Ga0501032_0049742 3300049569 Bacteria 2828
239 Ga0501033_0004384 3300049570 Bacteria 11309
240 Ga0501034_0010110 3300049571 Bacteria 9844
241 Ga0501034_0057899 3300049571 Bacteria 3896
242 Ga0501034_0406529 3300049571 Bacteria 1284
243 Ga0501036_0002018 3300049572 Bacteria 15794
244 Ga0501036_0009301 3300049572 Bacteria 8081
245 Ga0501036_0070753 3300049572 Bacteria 2950
246 Ga0501036_0117136 3300049572 Bacteria 2250
247 Ga0501036_0345872 3300049572 Bacteria 1242
248 Ga0501037_0007409 3300049573 Bacteria 8023
249 Ga0501037_0008739 3300049573 Bacteria 7424
250 Ga0501037_0166036 3300049573 Bacteria 1572
251 Ga0501037_0177406 3300049573 Bacteria 1513
252 Ga0501038_0000830 3300049574 Bacteria 27511
253 Ga0501038_0008767 3300049574 Bacteria 9277
254 Ga0501038_0033418 3300049574 Bacteria 4532
255 Ga0501039_0015347 3300049575 Bacteria 5864
256 Ga0501039_0073783 3300049575 Bacteria 2651
257 Ga0501039_0075601 3300049575 Bacteria 2618
258 Ga0501041_0014773 3300049577 Bacteria 4637
259 Ga0501042_0021562 3300049578 Bacteria 4492
260 Ga0501043_0011213 3300049579 Bacteria 7020
261 Ga0501043_0110946 3300049579 Bacteria 2153
262 Ga0501043_0545026 3300049579 Bacteria 862
263 Ga0501046_0000583 3300049580 Bacteria 35953
264 Ga0501046_0012223 3300049580 Bacteria 7315
265 Ga0501046_0161931 3300049580 Bacteria 1682
266 Ga0501047_0003733 3300049581 Bacteria 14343
267 Ga0501047_0007427 3300049581 Bacteria 10314
268 Ga0501048_0005292 3300049582 Bacteria 9829
269 Ga0501048_0033128 3300049582 Bacteria 3734
270 Ga0501048_0135883 3300049582 Bacteria 1738
271 Ga0501048_0170421 3300049582 Bacteria 1542
272 Ga0501048_0236570 3300049582 Bacteria 1296
273 Ga0501067_0001983 3300049583 Bacteria 11265
274 Ga0501067_0025989 3300049583 Bacteria 3245
275 Ga0501067_0041318 3300049583 Bacteria 2561
276 Ga0501067_0070647 3300049583 Bacteria 1933
277 Ga0501067_0121070 3300049583 Bacteria 1456
278 Ga0501067_0128864 3300049583 Bacteria 1408
279 Ga0501067_0151608 3300049583 Bacteria 1291
280 Ga0501068_0045468 3300049584 Bacteria 2645
281 Ga0501068_0106944 3300049584 Bacteria 1737
282 Ga0501069_0063868 3300049585 Bacteria 2057
283 Ga0501069_0125147 3300049585 Bacteria 1470
284 Ga0501070_0097934 3300049586 Bacteria 2426
285 Ga0501070_0118735 3300049586 Bacteria 2185
286 Ga0501070_0228885 3300049586 Bacteria 1523
287 Ga0501071_0033174 3300049587 Bacteria 3669
288 Ga0501071_0083255 3300049587 Bacteria 2344
289 Ga0501071_0278662 3300049587 Bacteria 1265
290 Ga0501071_0613302 3300049587 Bacteria 837
291 Ga0501072_0093797 3300049588 Bacteria 2384
292 Ga0501073_0097095 3300049589 Bacteria 2046
293 Ga0501073_0119363 3300049589 Bacteria 1828
294 Ga0501073_0324931 3300049589 Bacteria 1062
295 Ga0501074_0218935 3300049590 Bacteria 1356
296 Ga0501075_0272965 3300049591 Bacteria 1289
297 Ga0501076_0001743 3300049592 Bacteria 14705
298 Ga0501076_0098296 3300049592 Bacteria 2358
299 Ga0501079_0113551 3300049741 Bacteria 2106
300 Ga0501080_0044536 3300049742 Bacteria 4131
301 Ga0501080_0277548 3300049742 Bacteria 1524
302 Ga0501035_0001134 3300049822 Bacteria 27845
303 Ga0501035_0008640 3300049822 Bacteria 9481
304 Ga0501035_0075372 3300049822 Bacteria 2984
305 Ga0501044_0026005 3300049823 Bacteria 6200
306 Ga0501044_0080624 3300049823 Bacteria 3296
307 Ga0501045_0017509 3300049824 Bacteria 5088
308 Ga0501045_0026324 3300049824 Bacteria 4183
309 Ga0501045_0214454 3300049824 Bacteria 1434
310 nmdc:mga03683_23876_c1 3300050489 Bacteria 2387
311 nmdc:mga03n38_107181_c1 3300050490 Bacteria 1356
312 nmdc:mga03n38_58453_c1 3300050490 Bacteria 1747
313 nmdc:mga00v17_114384_c1 3300050491 Bacteria 1714
314 nmdc:mga00v17_42411_c1 3300050491 Bacteria 2737
315 nmdc:mga00v17_90372_c1 3300050491 Bacteria 1922
316 nmdc:mga0yw44_1136_c1 3300050492 Bacteria 10280
317 nmdc:mga0yw44_125759_c1 3300050492 Bacteria 1656
318 nmdc:mga0yw44_165670_c1 3300050492 Bacteria 1449
319 nmdc:mga0yw44_26292_c1 3300050492 Bacteria 3322
320 nmdc:mga0yw44_286402_c1 3300050492 Bacteria 1102
321 nmdc:mga0yw44_355387_c1 3300050492 Bacteria 987
322 nmdc:mga0yw44_81005_c1 3300050492 Bacteria 2035
323 nmdc:mga0yw44_95711_c1 3300050492 Bacteria 1884
324 nmdc:mga06z11_17579_c1 3300050494 Bacteria 3249
325 nmdc:mga06z11_21933_c1 3300050494 Bacteria 2975
326 nmdc:mga04h51_36679_c1 3300050495 Bacteria 1579
327 nmdc:mga04h51_6752_c1 3300050495 Bacteria 2995
328 nmdc:mga07m45_22658_c1 3300050496 Bacteria 3431
329 nmdc:mga07m45_47642_c1 3300050496 Bacteria 2410
330 Ga0495601_0073336 3300053077 Bacteria 2188
331 Ga0495655_0023615 3300053083 Bacteria 1420
332 Ga0500556_0004011 3300053104 Bacteria 4241
333 Ga0500593_000066 3300053117 Bacteria 38736
334 Ga0500573_0034853 3300053140 Bacteria 2903
335 Ga0500573_0073950 3300053140 Bacteria 1941
336 Ga0500604_0043259 3300053151 Bacteria 1368
337 Ga0501084_0014617 3300054114 Bacteria 6507
338 Ga0587083_0058458 3300059505 Bacteria 862
339 Ga0501082_0007505 3300060353 Bacteria 9412
340 Ga0501082_0252441 3300060353 Bacteria 1535
341 Ga0466962_0030320 3300061719 Bacteria 2590
342 Ga0466962_0057904 3300061719 Bacteria 1850
343 Ga0466962_0089963 3300061719 Bacteria 1470
344 Ga0530510_0077017 3300061734 Bacteria 2424
345 Ga0530510_0190125 3300061734 Bacteria 1524
346 2643824721 2643221561 Bacteria 4984412
347 2644093136 2643221615 Bacteria 5487866
348 2644229657 2643221641 Bacteria 4490190
349 2644322747 2643221657 Bacteria 5490246
350 2644535973 2643221696 Bacteria 5431823
351 2740168314 2739367898 Bacteria 4367674
352 2774395031 2773857762 Bacteria 5971770
353 2809194137 2808606439 Bacteria 5952208
354 2812348867 2811994878 Bacteria 5992952
355 2855388090 2855386786 Bacteria 4752232
356 2891973368 2891968417 Bacteria 5821697
357 Ga0070683_100237345
358 JGI24735J21928_10047879
359 JGI24750J21931_1016957
360 Ga0070658_10006407
361 Ga0070658_10211530
362 Ga0070683_100000595
363 Ga0070683_100245247
364 Ga0068868_100492985
365 Ga0070660_100153269
366 Ga0070660_100265570
367 Ga0070660_100361551
368 Ga0070660_100426843
369 Ga0070659_100051835
370 Ga0070659_100175725
371 Ga0070659_100231914
372 Ga0070667_100054262
373 Ga0070681_10281076
374 Ga0070681_10592498
375 Ga0070707_100015714
376 Ga0070698_100000205
377 Ga0070684_100000974
378 Ga0070684_100121319
379 Ga0070672_100204076
380 Ga0070672_100349126
381 Ga0070696_100472584
382 Ga0068855_100081379
383 Ga0070664_100005522
384 Ga0068857_100019761
385 Ga0070702_100080042
386 Ga0068864_100172300
387 Ga0068861_100293478
388 Ga0068851_10095472
389 Ga0068858_100153776
390 Ga0068860_100003178
391 Ga0081455_10030374
392 Ga0075365_10006841
393 Ga0075365_10019761
394 Ga0075365_10020983
395 Ga0075365_10023099
396 Ga0075365_10167674
397 Ga0075365_10174626
398 Ga0075365_10217656
399 Ga0075368_10000043
400 Ga0075368_10063704
401 Ga0075363_100003991
402 Ga0075363_100026249
403 Ga0075363_100038923
404 Ga0075363_100146938
405 Ga0075363_100274621
406 Ga0075364_10007183
407 Ga0075364_10011404
408 Ga0075364_10079646
409 Ga0075364_10084741
410 Ga0075364_10091228
411 Ga0075364_10134660
412 Ga0075362_10025008
413 Ga0075367_10003472
414 Ga0075367_10017387
415 Ga0075370_10002608
416 Ga0068871_100247449
417 Ga0068865_100050389
418 Ga0105245_10026354
419 Ga0105243_10102105
420 Ga0105242_10107914
421 Ga0105242_10496543
422 Ga0105237_10161755
423 Ga0105238_10621275
424 Ga0105238_10912887
425 Ga0105249_10065596
426 Ga0105239_10001253
427 Ga0105246_10004009
428 Ga0157372_10003008
429 Ga0157372_10074576
430 Ga0157372_11007155
431 Ga0157375_10020640
432 Ga0157375_10088904
433 Ga0163163_10167934
434 Ga0163163_10192984
435 Ga0163163_10550505
436 Ga0157379_10004243
437 Ga0197907_11487420
438 Ga0206354_11431985
439 Ga0207688_10055446
440 Ga0207647_10019396
441 Ga0207647_10038695
442 Ga0207647_10313813
443 Ga0207660_10136686
444 Ga0207657_10005113
445 Ga0207657_10088290
446 Ga0207646_10036111
447 Ga0207687_10030052
448 Ga0207690_10176046
449 Ga0207690_10380140
450 Ga0207686_10147976
451 Ga0207704_10004229
452 Ga0207691_10212952
453 Ga0207691_10432146
454 Ga0207661_10002542
455 Ga0207679_10325977
456 Ga0207667_10051679
457 Ga0207667_10779165
458 Ga0207658_10020758
459 Ga0207703_10128883
460 Ga0207648_10063647
461 Ga0207676_10167818
462 Ga0207676_10180334
463 Ga0207674_10025492
464 Ga0207683_10030078
465 Ga0209813_10006114
466 Ga0268264_10000193
467 Ga0316183_1105499
468 Ga0316181_1208223
469 Ga0307413_10037647
470 Ga0307413_10354995
471 Ga0307410_10042193
472 Ga0307410_10277692
473 Ga0307406_10225809
474 Ga0307407_10032933
475 Ga0307407_10079925
476 Ga0307412_10094028
477 Ga0307412_10125598
478 Ga0307412_10194536
479 Ga0307409_100002523
480 Ga0307409_100011214
481 Ga0307409_100186097
482 Ga0307409_100225256
483 Ga0307416_100008704
484 Ga0307416_100108794
485 Ga0307416_100245002
486 Ga0307414_10071348
487 Ga0307414_10431731
488 Ga0307411_10059740
489 Ga0307411_10288417
490 Ga0307415_100000142
491 Ga0307415_100125400
492 Ga0307415_100198031
493 Ga0307415_100335391
494 Ga0395898_0400357
495 Ga0395905_0084270
496 Ga0395901_0006072
497 Ga0395901_0142273
498 Ga0436365_1697618
499 Ga0450907_035623
500 Ga0439464_0017156
501 Ga0466972_0012348
502 Ga0466972_0052646
503 Ga0466972_0166102
504 Ga0466972_0187305
505 Ga0466965_0028282
506 Ga0466965_0041482
507 Ga0466965_0056445
508 Ga0466966_0027145
509 Ga0466966_0038552
510 Ga0466966_0219895
511 Ga0466961_0031626
512 Ga0466961_0034231
513 Ga0466961_0054405
514 Ga0466961_0178417
515 Ga0466963_0068144
516 Ga0466963_0091443
517 Ga0466964_0082693
518 Ga0466964_0159295
519 Ga0466964_0174252
520 Ga0466971_0011125
521 Ga0466971_0026643
522 Ga0466971_0045182
523 Ga0466971_0125889
524 Ga0466968_0077148
525 Ga0466968_0135172
526 Ga0466970_0005228
527 Ga0466970_0015817
528 Ga0466970_0024512
529 Ga0466970_0112133
530 Ga0466970_0193914
531 Ga0466970_0437678
532 Ga0466957_0008479
533 Ga0466957_0031631
534 Ga0466957_0058501
535 Ga0466957_0392146
536 Ga0466960_0002015
537 Ga0466960_0017942
538 Ga0466960_0025412
539 Ga0466960_0042820
540 Ga0466960_0110236
541 Ga0466959_0410622
542 Ga0466958_0234414
543 Ga0466967_0030412
544 Ga0466967_0071954
545 Ga0466967_0087823
546 Ga0466967_0205288
547 Ga0495664_0166309
548 Ga0495594_0211550
549 Ga0495608_0346528
550 Ga0495657_0091491
551 Ga0495674_0211004
552 Ga0495674_0675860
553 Ga0495676_0114340
554 Ga0496100_0047403
555 Ga0496100_0094076
556 Ga0496101_0058681
557 Ga0496101_0119486
558 Ga0496102_0002966
559 Ga0496102_0021720
560 Ga0496102_0025322
561 Ga0496102_0101257
562 Ga0496102_0568091
563 Ga0496103_0036089
564 Ga0496103_0312091
565 Ga0496104_0089672
566 Ga0496105_0013742
567 Ga0496105_0186984
568 Ga0496105_0289372
569 Ga0496106_0010472
570 Ga0496106_0228504
571 Ga0496107_0006668
572 Ga0496107_0316351
573 Ga0496108_0435977
574 Ga0496109_0001848
575 Ga0496109_0112827
576 Ga0496110_0000438
577 Ga0496110_0045998
578 Ga0496110_0053005
579 Ga0496111_0000246
580 Ga0496111_0270200
581 Ga0496112_0099865
582 Ga0496112_0216062
583 Ga0496113_0272241
584 Ga0496114_0016014
585 Ga0496114_0086914
586 Ga0496115_0001052
587 Ga0496118_0315993
588 Ga0501307_021071
589 Ga0501031_0003162
590 Ga0501031_0010175
591 Ga0501031_0285979
592 Ga0501031_0422686
593 Ga0501032_0002412
594 Ga0501032_0049742
595 Ga0501033_0004384
596 Ga0501034_0010110
597 Ga0501034_0057899
598 Ga0501034_0406529
599 Ga0501036_0002018
600 Ga0501036_0009301
601 Ga0501036_0070753
602 Ga0501036_0117136
603 Ga0501036_0345872
604 Ga0501037_0007409
605 Ga0501037_0008739
606 Ga0501037_0166036
607 Ga0501037_0177406
608 Ga0501038_0000830
609 Ga0501038_0008767
610 Ga0501038_0033418
611 Ga0501039_0015347
612 Ga0501039_0073783
613 Ga0501039_0075601
614 Ga0501041_0014773
615 Ga0501042_0021562
616 Ga0501043_0011213
617 Ga0501043_0110946
618 Ga0501043_0545026
619 Ga0501046_0000583
620 Ga0501046_0012223
621 Ga0501046_0161931
622 Ga0501047_0003733
623 Ga0501047_0007427
624 Ga0501048_0005292
625 Ga0501048_0033128
626 Ga0501048_0135883
627 Ga0501048_0170421
628 Ga0501048_0236570
629 Ga0501067_0001983
630 Ga0501067_0025989
631 Ga0501067_0041318
632 Ga0501067_0070647
633 Ga0501067_0121070
634 Ga0501067_0128864
635 Ga0501067_0151608
636 Ga0501068_0045468
637 Ga0501068_0106944
638 Ga0501069_0063868
639 Ga0501069_0125147
640 Ga0501070_0097934
641 Ga0501070_0118735
642 Ga0501070_0228885
643 Ga0501071_0033174
644 Ga0501071_0083255
645 Ga0501071_0278662
646 Ga0501071_0613302
647 Ga0501072_0093797
648 Ga0501073_0097095
649 Ga0501073_0119363
650 Ga0501073_0324931
651 Ga0501074_0218935
652 Ga0501075_0272965
653 Ga0501076_0001743
654 Ga0501076_0098296
655 Ga0501079_0113551
656 Ga0501080_0044536
657 Ga0501080_0277548
658 Ga0501035_0001134
659 Ga0501035_0008640
660 Ga0501035_0075372
661 Ga0501044_0026005
662 Ga0501044_0080624
663 Ga0501045_0017509
664 Ga0501045_0026324
665 Ga0501045_0214454
666 nmdc:mga03683_23876_c1
667 nmdc:mga03n38_107181_c1
668 nmdc:mga03n38_58453_c1
669 nmdc:mga00v17_114384_c1
670 nmdc:mga00v17_42411_c1
671 nmdc:mga00v17_90372_c1
672 nmdc:mga0yw44_1136_c1
673 nmdc:mga0yw44_125759_c1
674 nmdc:mga0yw44_165670_c1
675 nmdc:mga0yw44_26292_c1
676 nmdc:mga0yw44_286402_c1
677 nmdc:mga0yw44_355387_c1
678 nmdc:mga0yw44_81005_c1
679 nmdc:mga0yw44_95711_c1
680 nmdc:mga06z11_17579_c1
681 nmdc:mga06z11_21933_c1
682 nmdc:mga04h51_36679_c1
683 nmdc:mga04h51_6752_c1
684 nmdc:mga07m45_22658_c1
685 nmdc:mga07m45_47642_c1
686 Ga0495601_0073336
687 Ga0495655_0023615
688 Ga0500556_0004011
689 Ga0500593_000066
690 Ga0500573_0034853
691 Ga0500573_0073950
692 Ga0500604_0043259
693 Ga0501084_0014617
694 Ga0587083_0058458
695 Ga0501082_0007505
696 Ga0501082_0252441
697 Ga0466962_0030320
698 Ga0466962_0057904
699 Ga0466962_0089963
700 Ga0530510_0077017
701 Ga0530510_0190125
702 2643824721
703 2644093136
704 2644229657
705 2644322747
706 2644535973
707 2740168314
708 2774395031
709 2809194137
710 2812348867
711 2855388090
712 2891973368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

220

269

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

116

185

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

214

267

0.92

PF07638

Sigma70_ECF

ECF sigma factor

96

270

0.76

Map