F420382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 356 | 183 | 335 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10017496|Ga0070658_100174962 |
| Length | 266 |
| Sequence | MMLLRVITSNIITNNTTLAKMFSWFKKSEEKREITFDYSSVIVDMHSHVLPGIDDGAQTPQDSVELIRQMMALGIKKIIATPHIMADYYKNTAETINGALDILKAELVKEKIDIVVEAAAEHYFDESFESRIDEGKLMIMGDNYVLFEFSFISPPPNVIKIIQKLLALGHKPILAHPERYPYMDVEQFQMLRGQGLLFQLNTISLTGYYGKEAKKLAENLIDAQLIDFISSDMHHLRHADALKNALKMPYLEKVMFDYPLKNIMLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 2 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 3 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 4 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 5 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 6 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 7 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 8 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 9 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 10 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 11 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 12 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 13 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 14 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 15 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 16 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 17 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 18 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 19 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 20 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 21 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 22 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 27 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 28 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 29 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 30 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 31 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 173 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 174 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 175 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 176 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 177 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 178 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 180 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 181 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 182 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 183 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.54 |
| Metatranscriptomes | 0.56 |
| Isolates | 5.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.27 |
| Nodule | 0 |
| Rhizoplane | 0.28 |
| Rhizosphere | 82.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1007511 | 3300001904 | Bacteria | 1831 |
| 2 | JGI24736J21556_1012268 | 3300001904 | Bacteria | 1389 |
| 3 | JGI24736J21556_1023431 | 3300001904 | Bacteria | 965 |
| 4 | JGI24737J22298_10002167 | 3300001990 | Bacteria | 7000 |
| 5 | JGI24737J22298_10005184 | 3300001990 | Bacteria | 4511 |
| 6 | JGI24737J22298_10013672 | 3300001990 | Bacteria | 2639 |
| 7 | JGI24735J21928_10000009 | 3300002067 | Bacteria | 247425 |
| 8 | JGI24735J21928_10006817 | 3300002067 | Bacteria | 3744 |
| 9 | JGI24735J21928_10041089 | 3300002067 | Unclassified | 1348 |
| 10 | JGI25162J39368_1000117 | 3300002737 | Bacteria | 87536 |
| 11 | JGI25162J39368_1001967 | 3300002737 | Bacteria | 9225 |
| 12 | JGI25152J39213_1000737 | 3300002773 | Bacteria | 16746 |
| 13 | JGI25150J39212_1000360 | 3300002774 | Bacteria | 22352 |
| 14 | JGI25151J46595_10000947 | 3300003187 | Bacteria | 22352 |
| 15 | JGI25165J46597_1003041 | 3300003214 | Bacteria | 4575 |
| 16 | JGI25153J46596_10000587 | 3300003215 | Bacteria | 22352 |
| 17 | rootH1_10132916 | 3300003316 | Bacteria | 2127 |
| 18 | rootH2_10012367 | 3300003320 | Bacteria | 23503 |
| 19 | rootH2_10042766 | 3300003320 | Bacteria | 27178 |
| 20 | rootH2_10121714 | 3300003320 | Bacteria | 2513 |
| 21 | rootH2_10206601 | 3300003320 | Bacteria | 2890 |
| 22 | rootL2_10065137 | 3300003322 | Bacteria | 3027 |
| 23 | rootH1_10002777 | 3300003323 | Bacteria | 45345 |
| 24 | rootH1_10046618 | 3300003323 | Bacteria | 1790 |
| 25 | rootH1_10061979 | 3300003323 | Bacteria | 6236 |
| 26 | rootH1_10075254 | 3300003323 | Bacteria | 4063 |
| 27 | rootH1_10110327 | 3300003323 | Bacteria | 3979 |
| 28 | Ga0055529_1007047 | 3300003763 | Bacteria | 1541 |
| 29 | Ga0055536_1000016 | 3300003781 | Bacteria | 222134 |
| 30 | Ga0055530_10003522 | 3300003791 | Bacteria | 8839 |
| 31 | Ga0065714_10028327 | 3300005288 | Bacteria | 1216 |
| 32 | Ga0065714_10073164 | 3300005288 | Bacteria | 3235 |
| 33 | Ga0065714_10152919 | 3300005288 | Bacteria | 1095 |
| 34 | Ga0070658_10000025 | 3300005327 | Bacteria | 174551 |
| 35 | Ga0070658_10017496 | 3300005327 | Bacteria | 5735 |
| 36 | Ga0070658_10359948 | 3300005327 | Bacteria | 1246 |
| 37 | Ga0070676_10001252 | 3300005328 | Bacteria | 12792 |
| 38 | Ga0070680_100035133 | 3300005336 | Bacteria | 4045 |
| 39 | Ga0068868_100021181 | 3300005338 | Bacteria | 4894 |
| 40 | Ga0070660_100004162 | 3300005339 | Bacteria | 9992 |
| 41 | Ga0070660_100145545 | 3300005339 | Bacteria | 1903 |
| 42 | Ga0070659_100000203 | 3300005366 | Bacteria | 46107 |
| 43 | Ga0070659_100502697 | 3300005366 | Unclassified | 1033 |
| 44 | Ga0070678_100018106 | 3300005456 | Bacteria | 4558 |
| 45 | Ga0070662_100000003 | 3300005457 | Bacteria | 239813 |
| 46 | Ga0070662_100362067 | 3300005457 | Bacteria | 1190 |
| 47 | Ga0070681_10027027 | 3300005458 | Bacteria | 5769 |
| 48 | Ga0068867_100000591 | 3300005459 | Bacteria | 24039 |
| 49 | Ga0070679_100006460 | 3300005530 | Bacteria | 10922 |
| 50 | Ga0070684_100012469 | 3300005535 | Bacteria | 6815 |
| 51 | Ga0068853_100343028 | 3300005539 | Bacteria | 1388 |
| 52 | Ga0070665_100000061 | 3300005548 | Bacteria | 222138 |
| 53 | Ga0070665_100007570 | 3300005548 | Bacteria | 11040 |
| 54 | Ga0068855_100000522 | 3300005563 | Bacteria | 47210 |
| 55 | Ga0068855_100001223 | 3300005563 | Bacteria | 31869 |
| 56 | Ga0068855_100030218 | 3300005563 | Bacteria | 6480 |
| 57 | Ga0068855_100053474 | 3300005563 | Unclassified | 4750 |
| 58 | Ga0068855_100380931 | 3300005563 | Bacteria | 1549 |
| 59 | Ga0068855_100489665 | 3300005563 | Bacteria | 1337 |
| 60 | Ga0068855_100509917 | 3300005563 | Bacteria | 1306 |
| 61 | Ga0068855_100989620 | 3300005563 | Bacteria | 884 |
| 62 | Ga0068857_100018430 | 3300005577 | Bacteria | 6124 |
| 63 | Ga0068856_100000118 | 3300005614 | Bacteria | 78833 |
| 64 | Ga0068856_100012488 | 3300005614 | Bacteria | 8222 |
| 65 | Ga0068856_100514459 | 3300005614 | Bacteria | 1218 |
| 66 | Ga0068856_100730774 | 3300005614 | Bacteria | 1010 |
| 67 | Ga0068852_100000765 | 3300005616 | Bacteria | 21159 |
| 68 | Ga0068858_100158048 | 3300005842 | Bacteria | 2134 |
| 69 | Ga0068858_100296338 | 3300005842 | Bacteria | 1542 |
| 70 | Ga0075366_10000951 | 3300006195 | Bacteria | 14104 |
| 71 | Ga0097621_100000140 | 3300006237 | Bacteria | 43299 |
| 72 | Ga0068871_100000195 | 3300006358 | Bacteria | 41566 |
| 73 | Ga0068865_100000060 | 3300006881 | Bacteria | 58604 |
| 74 | Ga0105244_10120161 | 3300009036 | Bacteria | 1273 |
| 75 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 76 | Ga0105240_10020048 | 3300009093 | Bacteria | 8927 |
| 77 | Ga0105240_10070935 | 3300009093 | Bacteria | 4309 |
| 78 | Ga0105240_10159795 | 3300009093 | Bacteria | 2678 |
| 79 | Ga0105240_10324295 | 3300009093 | Bacteria | 1754 |
| 80 | Ga0105240_10841020 | 3300009093 | Bacteria | 991 |
| 81 | Ga0105243_10032441 | 3300009148 | Bacteria | 4036 |
| 82 | Ga0105241_10004560 | 3300009174 | Bacteria | 10250 |
| 83 | Ga0105241_10005676 | 3300009174 | Bacteria | 9207 |
| 84 | Ga0105241_10007899 | 3300009174 | Bacteria | 7821 |
| 85 | Ga0105241_10015739 | 3300009174 | Bacteria | 5542 |
| 86 | Ga0105241_10183080 | 3300009174 | Bacteria | 1739 |
| 87 | Ga0105241_10234489 | 3300009174 | Bacteria | 1548 |
| 88 | Ga0105242_10132632 | 3300009176 | Bacteria | 2152 |
| 89 | Ga0105237_10000138 | 3300009545 | Bacteria | 102411 |
| 90 | Ga0105237_10001149 | 3300009545 | Bacteria | 35513 |
| 91 | Ga0105237_10002006 | 3300009545 | Bacteria | 25906 |
| 92 | Ga0105237_10002486 | 3300009545 | Bacteria | 22858 |
| 93 | Ga0105237_10012221 | 3300009545 | Bacteria | 9052 |
| 94 | Ga0105237_10021012 | 3300009545 | Bacteria | 6718 |
| 95 | Ga0105237_10046026 | 3300009545 | Bacteria | 4389 |
| 96 | Ga0105237_10392423 | 3300009545 | Bacteria | 1393 |
| 97 | Ga0105238_10015647 | 3300009551 | Bacteria | 7678 |
| 98 | Ga0105238_10228503 | 3300009551 | Bacteria | 1838 |
| 99 | Ga0105238_10355672 | 3300009551 | Bacteria | 1454 |
| 100 | Ga0105249_10636004 | 3300009553 | Bacteria | 1124 |
| 101 | Ga0105239_10000045 | 3300010375 | Bacteria | 186314 |
| 102 | Ga0105239_10000708 | 3300010375 | Bacteria | 47248 |
| 103 | Ga0105239_10002462 | 3300010375 | Bacteria | 23588 |
| 104 | Ga0105239_10006980 | 3300010375 | Bacteria | 13012 |
| 105 | Ga0105239_10019797 | 3300010375 | Bacteria | 7428 |
| 106 | Ga0105239_10089437 | 3300010375 | Bacteria | 3395 |
| 107 | Ga0105239_10575022 | 3300010375 | Bacteria | 1284 |
| 108 | Ga0105239_10768940 | 3300010375 | Bacteria | 1103 |
| 109 | Ga0105239_10779598 | 3300010375 | Bacteria | 1095 |
| 110 | Ga0157373_10002350 | 3300013100 | Bacteria | 14364 |
| 111 | Ga0157373_10003916 | 3300013100 | Bacteria | 11236 |
| 112 | Ga0157373_10052421 | 3300013100 | Bacteria | 2903 |
| 113 | Ga0157371_10000107 | 3300013102 | Bacteria | 126477 |
| 114 | Ga0157371_10012900 | 3300013102 | Bacteria | 6364 |
| 115 | Ga0157371_10018021 | 3300013102 | Bacteria | 5230 |
| 116 | Ga0157371_10032541 | 3300013102 | Bacteria | 3752 |
| 117 | Ga0157370_10001651 | 3300013104 | Bacteria | 27525 |
| 118 | Ga0157370_10016234 | 3300013104 | Bacteria | 7545 |
| 119 | Ga0157370_10028893 | 3300013104 | Bacteria | 5450 |
| 120 | Ga0157370_10042215 | 3300013104 | Bacteria | 4396 |
| 121 | Ga0157370_10208670 | 3300013104 | Bacteria | 1811 |
| 122 | Ga0157370_10220484 | 3300013104 | Bacteria | 1757 |
| 123 | Ga0157369_10000507 | 3300013105 | Bacteria | 51275 |
| 124 | Ga0157369_10001625 | 3300013105 | Bacteria | 27447 |
| 125 | Ga0157369_10271825 | 3300013105 | Bacteria | 1766 |
| 126 | Ga0157369_10282701 | 3300013105 | Bacteria | 1728 |
| 127 | Ga0157369_10650218 | 3300013105 | Bacteria | 1087 |
| 128 | Ga0157374_10000125 | 3300013296 | Bacteria | 70183 |
| 129 | Ga0157374_10000562 | 3300013296 | Bacteria | 32938 |
| 130 | Ga0157374_10011215 | 3300013296 | Bacteria | 7750 |
| 131 | Ga0157374_10285955 | 3300013296 | Bacteria | 1629 |
| 132 | Ga0157378_10049772 | 3300013297 | Bacteria | 3729 |
| 133 | Ga0157378_10184056 | 3300013297 | Bacteria | 1966 |
| 134 | Ga0157378_10903078 | 3300013297 | Bacteria | 914 |
| 135 | Ga0163162_10000087 | 3300013306 | Bacteria | 85680 |
| 136 | Ga0163162_10000586 | 3300013306 | Bacteria | 33755 |
| 137 | Ga0163162_10003615 | 3300013306 | Bacteria | 14814 |
| 138 | Ga0163162_10114843 | 3300013306 | Bacteria | 2792 |
| 139 | Ga0163162_10187215 | 3300013306 | Bacteria | 2197 |
| 140 | Ga0163162_10441247 | 3300013306 | Bacteria | 1434 |
| 141 | Ga0157372_10000048 | 3300013307 | Bacteria | 142757 |
| 142 | Ga0157372_10001314 | 3300013307 | Bacteria | 26916 |
| 143 | Ga0157372_10001370 | 3300013307 | Bacteria | 26365 |
| 144 | Ga0157372_10001459 | 3300013307 | Bacteria | 25634 |
| 145 | Ga0157372_10018988 | 3300013307 | Bacteria | 7398 |
| 146 | Ga0157375_10124812 | 3300013308 | Bacteria | 2688 |
| 147 | Ga0157375_10126386 | 3300013308 | Bacteria | 2672 |
| 148 | Ga0157375_10586181 | 3300013308 | Bacteria | 1275 |
| 149 | Ga0182008_10000165 | 3300014497 | Bacteria | 51552 |
| 150 | Ga0157376_10008227 | 3300014969 | Bacteria | 7510 |
| 151 | Ga0182006_1000247 | 3300015261 | Bacteria | 50590 |
| 152 | Ga0182007_10000016 | 3300015262 | Bacteria | 202375 |
| 153 | Ga0182007_10009517 | 3300015262 | Bacteria | 3913 |
| 154 | Ga0183373_1011 | 3300015682 | Bacteria | 138873 |
| 155 | Ga0163161_10003307 | 3300017792 | Bacteria | 11320 |
| 156 | Ga0163161_10008795 | 3300017792 | Bacteria | 6981 |
| 157 | Ga0163161_10027189 | 3300017792 | Bacteria | 4058 |
| 158 | Ga0163161_10035926 | 3300017792 | Bacteria | 3547 |
| 159 | Ga0163161_10092603 | 3300017792 | Bacteria | 2238 |
| 160 | Ga0206351_10910495 | 3300020077 | Bacteria | 3575 |
| 161 | Ga0207427_100109 | 3300025231 | Bacteria | 116061 |
| 162 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 163 | Ga0209437_100096 | 3300025233 | Bacteria | 233558 |
| 164 | Ga0207425_1000549 | 3300025245 | Bacteria | 22404 |
| 165 | Ga0209026_1006685 | 3300025250 | Bacteria | 2769 |
| 166 | Ga0209026_1022674 | 3300025250 | Bacteria | 961 |
| 167 | Ga0209129_1000660 | 3300025258 | Bacteria | 22946 |
| 168 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 169 | Ga0209233_1002409 | 3300025261 | Bacteria | 6904 |
| 170 | Ga0209233_1010492 | 3300025261 | Bacteria | 2773 |
| 171 | Ga0209455_1002386 | 3300025272 | Bacteria | 7292 |
| 172 | Ga0209676_1000106 | 3300025292 | Bacteria | 222576 |
| 173 | Ga0209025_1002112 | 3300025294 | Bacteria | 22404 |
| 174 | Ga0209758_1001943 | 3300025297 | Bacteria | 22404 |
| 175 | Ga0209050_1000174 | 3300025298 | Bacteria | 148871 |
| 176 | Ga0207647_10000529 | 3300025904 | Bacteria | 30445 |
| 177 | Ga0207647_10000691 | 3300025904 | Bacteria | 26470 |
| 178 | Ga0207647_10016305 | 3300025904 | Bacteria | 5074 |
| 179 | Ga0207647_10085783 | 3300025904 | Bacteria | 1883 |
| 180 | Ga0207647_10249085 | 3300025904 | Unclassified | 1019 |
| 181 | Ga0207645_10001026 | 3300025907 | Bacteria | 23094 |
| 182 | Ga0207705_10000088 | 3300025909 | Bacteria | 113694 |
| 183 | Ga0207705_10407342 | 3300025909 | Bacteria | 1052 |
| 184 | Ga0207705_10597961 | 3300025909 | Unclassified | 858 |
| 185 | Ga0207654_10002431 | 3300025911 | Bacteria | 9508 |
| 186 | Ga0207654_10003991 | 3300025911 | Bacteria | 7431 |
| 187 | Ga0207707_10047811 | 3300025912 | Bacteria | 3725 |
| 188 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 189 | Ga0207695_10007448 | 3300025913 | Bacteria | 13918 |
| 190 | Ga0207695_10020114 | 3300025913 | Bacteria | 7657 |
| 191 | Ga0207695_10031350 | 3300025913 | Bacteria | 5832 |
| 192 | Ga0207695_10037805 | 3300025913 | Bacteria | 5205 |
| 193 | Ga0207695_10262712 | 3300025913 | Bacteria | 1623 |
| 194 | Ga0207695_10616530 | 3300025913 | Bacteria | 966 |
| 195 | Ga0207671_10000382 | 3300025914 | Bacteria | 62807 |
| 196 | Ga0207671_10000635 | 3300025914 | Bacteria | 45980 |
| 197 | Ga0207671_10002004 | 3300025914 | Bacteria | 22433 |
| 198 | Ga0207671_10003851 | 3300025914 | Bacteria | 14678 |
| 199 | Ga0207671_10037773 | 3300025914 | Bacteria | 3580 |
| 200 | Ga0207671_10199041 | 3300025914 | Bacteria | 1564 |
| 201 | Ga0207671_10387528 | 3300025914 | Bacteria | 1111 |
| 202 | Ga0207652_10422951 | 3300025921 | Bacteria | 1201 |
| 203 | Ga0207694_10076998 | 3300025924 | Bacteria | 2613 |
| 204 | Ga0207694_10142776 | 3300025924 | Bacteria | 1926 |
| 205 | Ga0207694_10144512 | 3300025924 | Bacteria | 1914 |
| 206 | Ga0207644_10019709 | 3300025931 | Bacteria | 4580 |
| 207 | Ga0207690_10000212 | 3300025932 | Bacteria | 44164 |
| 208 | Ga0207706_10000009 | 3300025933 | Bacteria | 200607 |
| 209 | Ga0207686_10015887 | 3300025934 | Bacteria | 4218 |
| 210 | Ga0207704_10000028 | 3300025938 | Bacteria | 122144 |
| 211 | Ga0207689_10207246 | 3300025942 | Bacteria | 1619 |
| 212 | Ga0207661_10025050 | 3300025944 | Bacteria | 4531 |
| 213 | Ga0207667_10000197 | 3300025949 | Bacteria | 87987 |
| 214 | Ga0207667_10006254 | 3300025949 | Bacteria | 14451 |
| 215 | Ga0207667_10028674 | 3300025949 | Bacteria | 6044 |
| 216 | Ga0207667_10040858 | 3300025949 | Bacteria | 4936 |
| 217 | Ga0207667_10218129 | 3300025949 | Bacteria | 1955 |
| 218 | Ga0207667_10288565 | 3300025949 | Bacteria | 1677 |
| 219 | Ga0207667_10306789 | 3300025949 | Bacteria | 1621 |
| 220 | Ga0207667_10529059 | 3300025949 | Bacteria | 1194 |
| 221 | Ga0207651_10001787 | 3300025960 | Bacteria | 9992 |
| 222 | Ga0207677_10070896 | 3300026023 | Bacteria | 2458 |
| 223 | Ga0207639_10058247 | 3300026041 | Bacteria | 2971 |
| 224 | Ga0207678_10041518 | 3300026067 | Bacteria | 3989 |
| 225 | Ga0207702_10000590 | 3300026078 | Bacteria | 40097 |
| 226 | Ga0207702_10009460 | 3300026078 | Bacteria | 8186 |
| 227 | Ga0207648_10000968 | 3300026089 | Bacteria | 32355 |
| 228 | Ga0207674_10509122 | 3300026116 | Bacteria | 1163 |
| 229 | Ga0207698_10009565 | 3300026142 | Bacteria | 6189 |
| 230 | Ga0207698_10090980 | 3300026142 | Bacteria | 2497 |
| 231 | Ga0268266_10000053 | 3300028379 | Bacteria | 295181 |
| 232 | Ga0268266_10129276 | 3300028379 | Bacteria | 2257 |
| 233 | Ga0307517_10000400 | 3300028786 | Bacteria | 74215 |
| 234 | Ga0307515_10000077 | 3300028794 | Bacteria | 228162 |
| 235 | Ga0307515_10011130 | 3300028794 | Bacteria | 17107 |
| 236 | Ga0265338_10076188 | 3300028800 | Bacteria | 2842 |
| 237 | Ga0307509_10137868 | 3300031507 | Bacteria | 2382 |
| 238 | Ga0307408_100001246 | 3300031548 | Bacteria | 19110 |
| 239 | Ga0307408_100016738 | 3300031548 | Bacteria | 4900 |
| 240 | Ga0307405_10000023 | 3300031731 | Bacteria | 141450 |
| 241 | Ga0307405_10342898 | 3300031731 | Unclassified | 1149 |
| 242 | Ga0307407_10000057 | 3300031903 | Bacteria | 49070 |
| 243 | Ga0307412_10000490 | 3300031911 | Bacteria | 23654 |
| 244 | Ga0307412_10195470 | 3300031911 | Unclassified | 1532 |
| 245 | Ga0307412_10375456 | 3300031911 | Bacteria | 1149 |
| 246 | Ga0307409_100007288 | 3300031995 | Bacteria | 6603 |
| 247 | Ga0307416_100000112 | 3300032002 | Bacteria | 49491 |
| 248 | Ga0307416_100745278 | 3300032002 | Bacteria | 1072 |
| 249 | Ga0307414_10011747 | 3300032004 | Bacteria | 5151 |
| 250 | Ga0307414_10062052 | 3300032004 | Bacteria | 2650 |
| 251 | Ga0307414_10071621 | 3300032004 | Bacteria | 2501 |
| 252 | Ga0307414_10090186 | 3300032004 | Bacteria | 2274 |
| 253 | Ga0307414_10124669 | 3300032004 | Bacteria | 1988 |
| 254 | Ga0307414_10233776 | 3300032004 | Bacteria | 1517 |
| 255 | Ga0307414_10745341 | 3300032004 | Bacteria | 890 |
| 256 | Ga0307411_10676867 | 3300032005 | Bacteria | 896 |
| 257 | Ga0307507_10000097 | 3300033179 | Bacteria | 139761 |
| 258 | Ga0307510_10002335 | 3300033180 | Bacteria | 21445 |
| 259 | Ga0373941_0040193 | 3300035115 | Bacteria | 1441 |
| 260 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 261 | Ga0395899_0000453 | 3300037312 | Bacteria | 46699 |
| 262 | Ga0395899_0002919 | 3300037312 | Bacteria | 13729 |
| 263 | Ga0395900_0000431 | 3300037418 | Bacteria | 60172 |
| 264 | Ga0395900_0002406 | 3300037418 | Bacteria | 20644 |
| 265 | Ga0395898_0100138 | 3300037466 | Bacteria | 2783 |
| 266 | Ga0395905_0001183 | 3300037471 | Bacteria | 32616 |
| 267 | Ga0395905_0018692 | 3300037471 | Bacteria | 6573 |
| 268 | Ga0395905_0150761 | 3300037471 | Bacteria | 2187 |
| 269 | Ga0395901_0001158 | 3300038443 | Bacteria | 28004 |
| 270 | Ga0395901_0006292 | 3300038443 | Bacteria | 12025 |
| 271 | Ga0395901_0104117 | 3300038443 | Bacteria | 2978 |
| 272 | Ga0395901_0246394 | 3300038443 | Bacteria | 1863 |
| 273 | Ga0436361_0606257 | 3300039447 | Bacteria | 4438 |
| 274 | Ga0466959_0027021 | 3300045049 | Bacteria | 4257 |
| 275 | Ga0495638_0193231 | 3300046460 | Bacteria | 1154 |
| 276 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 277 | Ga0495585_0000235 | 3300046492 | Bacteria | 57308 |
| 278 | Ga0495585_0001898 | 3300046492 | Bacteria | 15732 |
| 279 | Ga0495585_0129701 | 3300046492 | Bacteria | 1328 |
| 280 | Ga0495583_0051321 | 3300046506 | Bacteria | 1881 |
| 281 | Ga0495606_0000448 | 3300046507 | Bacteria | 67282 |
| 282 | Ga0495606_0011179 | 3300046507 | Bacteria | 7349 |
| 283 | Ga0495610_0000098 | 3300046512 | Bacteria | 101620 |
| 284 | Ga0495610_0001315 | 3300046512 | Bacteria | 22083 |
| 285 | Ga0495610_0005456 | 3300046512 | Bacteria | 9030 |
| 286 | Ga0495616_0002589 | 3300046513 | Bacteria | 11900 |
| 287 | Ga0495616_0016166 | 3300046513 | Bacteria | 4135 |
| 288 | Ga0495631_0018968 | 3300046518 | Bacteria | 3232 |
| 289 | Ga0495637_0034035 | 3300046520 | Bacteria | 2233 |
| 290 | Ga0495644_0003068 | 3300046523 | Bacteria | 6612 |
| 291 | Ga0495648_0008550 | 3300046524 | Bacteria | 8040 |
| 292 | Ga0495652_0346832 | 3300046529 | Bacteria | 1065 |
| 293 | Ga0495654_0039760 | 3300046530 | Bacteria | 2347 |
| 294 | Ga0495609_0007589 | 3300046538 | Bacteria | 5392 |
| 295 | Ga0495609_0110558 | 3300046538 | Bacteria | 1186 |
| 296 | Ga0495622_0037380 | 3300046557 | Bacteria | 2262 |
| 297 | Ga0495633_0000004 | 3300046558 | Bacteria | 370781 |
| 298 | Ga0495633_0003981 | 3300046558 | Bacteria | 9580 |
| 299 | Ga0495668_0000058 | 3300046616 | Bacteria | 195501 |
| 300 | Ga0495668_0000526 | 3300046616 | Bacteria | 47711 |
| 301 | Ga0495668_0035546 | 3300046616 | Bacteria | 2793 |
| 302 | Ga0495625_0000018 | 3300046660 | Bacteria | 299567 |
| 303 | Ga0495625_0000641 | 3300046660 | Bacteria | 50345 |
| 304 | Ga0495625_0002311 | 3300046660 | Bacteria | 20845 |
| 305 | Ga0495625_0089000 | 3300046660 | Bacteria | 2138 |
| 306 | Ga0495625_0178025 | 3300046660 | Bacteria | 1416 |
| 307 | Ga0495661_0002106 | 3300046665 | Bacteria | 15618 |
| 308 | Ga0495661_0006725 | 3300046665 | Bacteria | 8069 |
| 309 | Ga0495661_0069993 | 3300046665 | Bacteria | 2054 |
| 310 | Ga0495649_0000015 | 3300046694 | Bacteria | 246431 |
| 311 | Ga0495649_0034047 | 3300046694 | Bacteria | 2804 |
| 312 | Ga0495683_0007778 | 3300047323 | Bacteria | 5754 |
| 313 | Ga0495687_001855 | 3300047443 | Bacteria | 18422 |
| 314 | Ga0495687_023006 | 3300047443 | Bacteria | 2983 |
| 315 | Ga0495673_0055881 | 3300047469 | Bacteria | 1711 |
| 316 | Ga0495681_0178779 | 3300047470 | Bacteria | 873 |
| 317 | Ga0495686_0000303 | 3300047472 | Bacteria | 84544 |
| 318 | Ga0495686_0000471 | 3300047472 | Bacteria | 60050 |
| 319 | Ga0495686_0011518 | 3300047472 | Bacteria | 6229 |
| 320 | Ga0495686_0149506 | 3300047472 | Bacteria | 1372 |
| 321 | Ga0495678_008458 | 3300049459 | Bacteria | 5188 |
| 322 | Ga0501223_000993 | 3300049663 | Bacteria | 6711 |
| 323 | Ga0501235_033455 | 3300049669 | Bacteria | 1164 |
| 324 | Ga0501240_001473 | 3300049673 | Bacteria | 2304 |
| 325 | Ga0501269_010225 | 3300049766 | Bacteria | 1139 |
| 326 | nmdc:mga0k408_1713_c1 | 3300050493 | Bacteria | 11794 |
| 327 | Ga0500556_0087735 | 3300053104 | Bacteria | 1184 |
| 328 | Ga0500608_002973 | 3300053122 | Bacteria | 6277 |
| 329 | Ga0500618_000105 | 3300053125 | Bacteria | 68057 |
| 330 | Ga0500618_008762 | 3300053125 | Bacteria | 2798 |
| 331 | Ga0500642_0001595 | 3300053130 | Bacteria | 6542 |
| 332 | Ga0500642_0087344 | 3300053130 | Bacteria | 1438 |
| 333 | Ga0500616_0000741 | 3300053153 | Bacteria | 37622 |
| 334 | Ga0500624_000714 | 3300053157 | Bacteria | 8307 |
| 335 | Ga0587073_0007499 | 3300059492 | Bacteria | 1728 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049669 | Ga0501235_033455 | Ga0501235_033455_500_1129 | 205 |
| 2 | 3300046529 | Ga0495652_0346832 | Ga0495652_0346832_23_691 | 222 |
| 3 | 3300047470 | Ga0495681_0178779 | Ga0495681_0178779_18_686 | 222 |
| 4 | 3300013297 | Ga0157378_10903078 | Ga0157378_109030782 | 225 |
| 5 | 3300025904 | Ga0207647_10085783 | Ga0207647_100857832 | 225 |
| 6 | 3300046506 | Ga0495583_0051321 | Ga0495583_0051321_1193_1870 | 225 |
| 7 | 3300049673 | Ga0501240_001473 | Ga0501240_001473_281_967 | 226 |
| 8 | 3300049766 | Ga0501269_010225 | Ga0501269_010225_305_1057 | 228 |
| 9 | 3300013308 | Ga0157375_10586181 | Ga0157375_105861812 | 232 |
| 10 | 3300009036 | Ga0105244_10120161 | Ga0105244_101201612 | 235 |
| 11 | 3300013100 | Ga0157373_10052421 | Ga0157373_100524212 | 235 |
| 12 | 3300015261 | Ga0182006_1000247 | Ga0182006_100024740 | 235 |
| 13 | 3300017792 | Ga0163161_10003307 | Ga0163161_100033072 | 235 |
| 14 | 3300031731 | Ga0307405_10000023 | Ga0307405_1000002321 | 235 |
| 15 | 3300031903 | Ga0307407_10000057 | Ga0307407_1000005720 | 235 |
| 16 | 3300031995 | Ga0307409_100007288 | Ga0307409_1000072882 | 235 |
| 17 | 3300032002 | Ga0307416_100000112 | Ga0307416_10000011234 | 235 |
| 18 | 3300032004 | Ga0307414_10011747 | Ga0307414_100117474 | 235 |
| 19 | 3300032005 | Ga0307411_10676867 | Ga0307411_106768671 | 235 |
| 20 | 3300046512 | Ga0495610_0001315 | Ga0495610_0001315_8992_9729 | 235 |
| 21 | 3300046520 | Ga0495637_0034035 | Ga0495637_0034035_578_1315 | 235 |
| 22 | 3300005327 | Ga0070658_10000025 | Ga0070658_10000025159 | 237 |
| 23 | 3300005563 | Ga0068855_100053474 | Ga0068855_1000534745 | 237 |
| 24 | 3300025909 | Ga0207705_10000088 | Ga0207705_1000008824 | 237 |
| 25 | 3300025949 | Ga0207667_10028674 | Ga0207667_100286744 | 237 |
| 26 | iso_pu_bacteria | 2585427687 | 2586207949 | 239 |
| 27 | iso_pu_bacteria | 2738541302 | 2738856506 | 239 |
| 28 | iso_pu_bacteria | 2739367651 | 2739587476 | 239 |
| 29 | iso_pu_bacteria | 2739367656 | 2739613838 | 239 |
| 30 | iso_pu_bacteria | 2739367663 | 2739647841 | 239 |
| 31 | iso_pu_bacteria | 2842722452 | 2842726924 | 239 |
| 32 | iso_pu_bacteria | 2842909656 | 2842911773 | 239 |
| 33 | iso_pu_bacteria | 2849281842 | 2849286968 | 239 |
| 34 | iso_pu_bacteria | 2857627736 | 2857630347 | 239 |
| 35 | iso_pu_bacteria | 2902048731 | 2902050864 | 239 |
| 36 | iso_pu_bacteria | 2945997725 | 2946002744 | 239 |
| 37 | 3300046660 | Ga0495625_0002311 | Ga0495625_0002311_19753_20502 | 240 |
| 38 | iso_pu_bacteria | 2904445276 | 2904448788 | 240 |
| 39 | iso_pu_bacteria | 2954016120 | 2954019618 | 240 |
| 40 | iso_pu_bacteria | 2852623160 | 2852625458 | 241 |
| 41 | iso_pu_bacteria | 2884933994 | 2884934463 | 241 |
| 42 | 3300028794 | Ga0307515_10011130 | Ga0307515_1001113015 | 242 |
| 43 | iso_pu_bacteria | 2599185184 | 2599479230 | 242 |
| 44 | iso_pu_bacteria | 2919437846 | 2919440090 | 242 |
| 45 | iso_pu_bacteria | 2928078545 | 2928082456 | 242 |
| 46 | iso_pu_bacteria | 2928147474 | 2928148959 | 242 |
| 47 | iso_pu_bacteria | 2932082852 | 2932087489 | 242 |
| 48 | 3300002773 | JGI25152J39213_1000737 | JGI25152J39213_10007374 | 243 |
| 49 | 3300002774 | JGI25150J39212_1000360 | JGI25150J39212_10003604 | 243 |
| 50 | 3300003187 | JGI25151J46595_10000947 | JGI25151J46595_100009474 | 243 |
| 51 | 3300003215 | JGI25153J46596_10000587 | JGI25153J46596_100005874 | 243 |
| 52 | 3300003781 | Ga0055536_1000016 | Ga0055536_1000016190 | 243 |
| 53 | 3300003791 | Ga0055530_10003522 | Ga0055530_100035224 | 243 |
| 54 | 3300013104 | Ga0157370_10001651 | Ga0157370_1000165116 | 243 |
| 55 | 3300013104 | Ga0157370_10016234 | Ga0157370_100162344 | 243 |
| 56 | 3300013104 | Ga0157370_10042215 | Ga0157370_100422154 | 243 |
| 57 | 3300013104 | Ga0157370_10220484 | Ga0157370_102204843 | 243 |
| 58 | 3300013105 | Ga0157369_10001625 | Ga0157369_1000162522 | 243 |
| 59 | 3300015262 | Ga0182007_10000016 | Ga0182007_10000016166 | 243 |
| 60 | 3300015682 | Ga0183373_1011 | Ga0183373_1011132 | 243 |
| 61 | 3300017792 | Ga0163161_10008795 | Ga0163161_100087953 | 243 |
| 62 | 3300017792 | Ga0163161_10027189 | Ga0163161_100271892 | 243 |
| 63 | 3300017792 | Ga0163161_10035926 | Ga0163161_100359263 | 243 |
| 64 | 3300025245 | Ga0207425_1000549 | Ga0207425_10005494 | 243 |
| 65 | 3300025258 | Ga0209129_1000660 | Ga0209129_10006604 | 243 |
| 66 | 3300025292 | Ga0209676_1000106 | Ga0209676_100010616 | 243 |
| 67 | 3300025294 | Ga0209025_1002112 | Ga0209025_10021124 | 243 |
| 68 | 3300025297 | Ga0209758_1001943 | Ga0209758_10019434 | 243 |
| 69 | 3300025298 | Ga0209050_1000174 | Ga0209050_1000174141 | 243 |
| 70 | 3300031548 | Ga0307408_100001246 | Ga0307408_1000012469 | 243 |
| 71 | 3300031548 | Ga0307408_100016738 | Ga0307408_1000167382 | 243 |
| 72 | 3300031731 | Ga0307405_10342898 | Ga0307405_103428981 | 243 |
| 73 | 3300031911 | Ga0307412_10000490 | Ga0307412_1000049013 | 243 |
| 74 | 3300031911 | Ga0307412_10195470 | Ga0307412_101954701 | 243 |
| 75 | 3300032002 | Ga0307416_100745278 | Ga0307416_1007452782 | 243 |
| 76 | 3300032004 | Ga0307414_10062052 | Ga0307414_100620521 | 243 |
| 77 | 3300032004 | Ga0307414_10071621 | Ga0307414_100716214 | 243 |
| 78 | 3300032004 | Ga0307414_10090186 | Ga0307414_100901863 | 243 |
| 79 | 3300032004 | Ga0307414_10124669 | Ga0307414_101246692 | 243 |
| 80 | 3300032004 | Ga0307414_10745341 | Ga0307414_107453411 | 243 |
| 81 | 3300046512 | Ga0495610_0000098 | Ga0495610_0000098_99433_100170 | 243 |
| 82 | 3300049663 | Ga0501223_000993 | Ga0501223_000993_3936_4673 | 243 |
| 83 | iso_pu_bacteria | 2977232053 | 2977234436 | 243 |
| 84 | 3300001904 | JGI24736J21556_1012268 | JGI24736J21556_10122682 | 244 |
| 85 | 3300001990 | JGI24737J22298_10013672 | JGI24737J22298_100136723 | 244 |
| 86 | 3300002067 | JGI24735J21928_10041089 | JGI24735J21928_100410892 | 244 |
| 87 | 3300003320 | rootH2_10012367 | rootH2_1001236724 | 244 |
| 88 | 3300003320 | rootH2_10206601 | rootH2_102066012 | 244 |
| 89 | 3300003323 | rootH1_10046618 | rootH1_100466182 | 244 |
| 90 | 3300005288 | Ga0065714_10028327 | Ga0065714_100283272 | 244 |
| 91 | 3300005328 | Ga0070676_10001252 | Ga0070676_1000125213 | 244 |
| 92 | 3300005338 | Ga0068868_100021181 | Ga0068868_1000211812 | 244 |
| 93 | 3300005366 | Ga0070659_100502697 | Ga0070659_1005026971 | 244 |
| 94 | 3300005456 | Ga0070678_100018106 | Ga0070678_1000181062 | 244 |
| 95 | 3300005457 | Ga0070662_100000003 | Ga0070662_10000000317 | 244 |
| 96 | 3300005457 | Ga0070662_100362067 | Ga0070662_1003620671 | 244 |
| 97 | 3300005459 | Ga0068867_100000591 | Ga0068867_10000059115 | 244 |
| 98 | 3300005548 | Ga0070665_100000061 | Ga0070665_10000006132 | 244 |
| 99 | 3300005563 | Ga0068855_100380931 | Ga0068855_1003809312 | 244 |
| 100 | 3300005563 | Ga0068855_100509917 | Ga0068855_1005099172 | 244 |
| 101 | 3300005614 | Ga0068856_100514459 | Ga0068856_1005144592 | 244 |
| 102 | 3300005616 | Ga0068852_100000765 | Ga0068852_10000076513 | 244 |
| 103 | 3300005842 | Ga0068858_100158048 | Ga0068858_1001580482 | 244 |
| 104 | 3300006237 | Ga0097621_100000140 | Ga0097621_10000014010 | 244 |
| 105 | 3300006358 | Ga0068871_100000195 | Ga0068871_1000001958 | 244 |
| 106 | 3300006881 | Ga0068865_100000060 | Ga0068865_1000000608 | 244 |
| 107 | 3300009093 | Ga0105240_10020048 | Ga0105240_100200485 | 244 |
| 108 | 3300009093 | Ga0105240_10159795 | Ga0105240_101597953 | 244 |
| 109 | 3300009148 | Ga0105243_10032441 | Ga0105243_100324412 | 244 |
| 110 | 3300009174 | Ga0105241_10004560 | Ga0105241_100045604 | 244 |
| 111 | 3300009174 | Ga0105241_10007899 | Ga0105241_100078996 | 244 |
| 112 | 3300009176 | Ga0105242_10132632 | Ga0105242_101326321 | 244 |
| 113 | 3300009545 | Ga0105237_10001149 | Ga0105237_1000114918 | 244 |
| 114 | 3300009551 | Ga0105238_10015647 | Ga0105238_100156474 | 244 |
| 115 | 3300010375 | Ga0105239_10089437 | Ga0105239_100894372 | 244 |
| 116 | 3300010375 | Ga0105239_10575022 | Ga0105239_105750222 | 244 |
| 117 | 3300013102 | Ga0157371_10032541 | Ga0157371_100325413 | 244 |
| 118 | 3300013104 | Ga0157370_10208670 | Ga0157370_102086702 | 244 |
| 119 | 3300013105 | Ga0157369_10282701 | Ga0157369_102827012 | 244 |
| 120 | 3300013296 | Ga0157374_10000125 | Ga0157374_1000012528 | 244 |
| 121 | 3300013296 | Ga0157374_10000562 | Ga0157374_1000056217 | 244 |
| 122 | 3300013297 | Ga0157378_10049772 | Ga0157378_100497723 | 244 |
| 123 | 3300013306 | Ga0163162_10000087 | Ga0163162_1000008725 | 244 |
| 124 | 3300013306 | Ga0163162_10000586 | Ga0163162_1000058621 | 244 |
| 125 | 3300013307 | Ga0157372_10018988 | Ga0157372_100189885 | 244 |
| 126 | 3300013308 | Ga0157375_10124812 | Ga0157375_101248123 | 244 |
| 127 | 3300013308 | Ga0157375_10126386 | Ga0157375_101263862 | 244 |
| 128 | 3300014497 | Ga0182008_10000165 | Ga0182008_1000016518 | 244 |
| 129 | 3300014969 | Ga0157376_10008227 | Ga0157376_100082272 | 244 |
| 130 | 3300015262 | Ga0182007_10009517 | Ga0182007_100095173 | 244 |
| 131 | 3300025904 | Ga0207647_10000691 | Ga0207647_100006919 | 244 |
| 132 | 3300025907 | Ga0207645_10001026 | Ga0207645_100010266 | 244 |
| 133 | 3300025911 | Ga0207654_10003991 | Ga0207654_100039915 | 244 |
| 134 | 3300025913 | Ga0207695_10007448 | Ga0207695_1000744814 | 244 |
| 135 | 3300025913 | Ga0207695_10020114 | Ga0207695_100201147 | 244 |
| 136 | 3300025914 | Ga0207671_10387528 | Ga0207671_103875282 | 244 |
| 137 | 3300025924 | Ga0207694_10144512 | Ga0207694_101445122 | 244 |
| 138 | 3300025931 | Ga0207644_10019709 | Ga0207644_100197095 | 244 |
| 139 | 3300025933 | Ga0207706_10000009 | Ga0207706_1000000927 | 244 |
| 140 | 3300025934 | Ga0207686_10015887 | Ga0207686_100158874 | 244 |
| 141 | 3300025938 | Ga0207704_10000028 | Ga0207704_1000002830 | 244 |
| 142 | 3300025942 | Ga0207689_10207246 | Ga0207689_102072462 | 244 |
| 143 | 3300025949 | Ga0207667_10288565 | Ga0207667_102885652 | 244 |
| 144 | 3300025949 | Ga0207667_10306789 | Ga0207667_103067893 | 244 |
| 145 | 3300025960 | Ga0207651_10001787 | Ga0207651_100017873 | 244 |
| 146 | 3300026023 | Ga0207677_10070896 | Ga0207677_100708962 | 244 |
| 147 | 3300026041 | Ga0207639_10058247 | Ga0207639_100582473 | 244 |
| 148 | 3300026089 | Ga0207648_10000968 | Ga0207648_1000096819 | 244 |
| 149 | 3300026142 | Ga0207698_10009565 | Ga0207698_100095652 | 244 |
| 150 | 3300028379 | Ga0268266_10000053 | Ga0268266_10000053168 | 244 |
| 151 | 3300028786 | Ga0307517_10000400 | Ga0307517_1000040049 | 244 |
| 152 | 3300032004 | Ga0307414_10233776 | Ga0307414_102337762 | 244 |
| 153 | 3300033180 | Ga0307510_10002335 | Ga0307510_1000233518 | 244 |
| 154 | 3300037312 | Ga0395899_0002919 | Ga0395899_0002919_1092_1826 | 244 |
| 155 | 3300037418 | Ga0395900_0000431 | Ga0395900_0000431_32755_33489 | 244 |
| 156 | 3300037466 | Ga0395898_0100138 | Ga0395898_0100138_2004_2738 | 244 |
| 157 | 3300037471 | Ga0395905_0018692 | Ga0395905_0018692_429_1163 | 244 |
| 158 | 3300038443 | Ga0395901_0001158 | Ga0395901_0001158_27088_27822 | 244 |
| 159 | 3300039447 | Ga0436361_0606257 | Ga0436361_0606257_2352_3086 | 244 |
| 160 | 3300046518 | Ga0495631_0018968 | Ga0495631_0018968_1785_2534 | 244 |
| 161 | 3300046694 | Ga0495649_0034047 | Ga0495649_0034047_699_1433 | 244 |
| 162 | 3300047323 | Ga0495683_0007778 | Ga0495683_0007778_382_1116 | 244 |
| 163 | 3300047443 | Ga0495687_001855 | Ga0495687_001855_13785_14519 | 244 |
| 164 | 3300053122 | Ga0500608_002973 | Ga0500608_002973_2565_3299 | 244 |
| 165 | 3300059492 | Ga0587073_0007499 | Ga0587073_0007499_407_1141 | 244 |
| 166 | 3300003316 | rootH1_10132916 | rootH1_101329162 | 245 |
| 167 | 3300003323 | rootH1_10110327 | rootH1_101103272 | 245 |
| 168 | 3300005339 | Ga0070660_100004162 | Ga0070660_1000041627 | 245 |
| 169 | 3300005366 | Ga0070659_100000203 | Ga0070659_10000020343 | 245 |
| 170 | 3300005535 | Ga0070684_100012469 | Ga0070684_1000124693 | 245 |
| 171 | 3300005563 | Ga0068855_100030218 | Ga0068855_1000302186 | 245 |
| 172 | 3300005842 | Ga0068858_100296338 | Ga0068858_1002963382 | 245 |
| 173 | 3300009093 | Ga0105240_10324295 | Ga0105240_103242952 | 245 |
| 174 | 3300009174 | Ga0105241_10183080 | Ga0105241_101830802 | 245 |
| 175 | 3300009545 | Ga0105237_10046026 | Ga0105237_100460262 | 245 |
| 176 | 3300009545 | Ga0105237_10392423 | Ga0105237_103924232 | 245 |
| 177 | 3300009553 | Ga0105249_10636004 | Ga0105249_106360042 | 245 |
| 178 | 3300010375 | Ga0105239_10019797 | Ga0105239_100197976 | 245 |
| 179 | 3300013100 | Ga0157373_10002350 | Ga0157373_1000235010 | 245 |
| 180 | 3300013296 | Ga0157374_10011215 | Ga0157374_100112157 | 245 |
| 181 | 3300013306 | Ga0163162_10003615 | Ga0163162_100036157 | 245 |
| 182 | 3300013307 | Ga0157372_10001314 | Ga0157372_1000131413 | 245 |
| 183 | 3300017792 | Ga0163161_10092603 | Ga0163161_100926032 | 245 |
| 184 | 3300025913 | Ga0207695_10262712 | Ga0207695_102627122 | 245 |
| 185 | 3300025914 | Ga0207671_10037773 | Ga0207671_100377734 | 245 |
| 186 | 3300025914 | Ga0207671_10199041 | Ga0207671_101990412 | 245 |
| 187 | 3300025924 | Ga0207694_10076998 | Ga0207694_100769982 | 245 |
| 188 | 3300025932 | Ga0207690_10000212 | Ga0207690_1000021242 | 245 |
| 189 | 3300025944 | Ga0207661_10025050 | Ga0207661_100250504 | 245 |
| 190 | 3300025949 | Ga0207667_10040858 | Ga0207667_100408585 | 245 |
| 191 | 3300026142 | Ga0207698_10090980 | Ga0207698_100909802 | 245 |
| 192 | 3300035115 | Ga0373941_0040193 | Ga0373941_0040193_173_940 | 245 |
| 193 | 3300046616 | Ga0495668_0000526 | Ga0495668_0000526_41513_42268 | 245 |
| 194 | 3300047472 | Ga0495686_0000471 | Ga0495686_0000471_49782_50540 | 245 |
| 195 | 3300053104 | Ga0500556_0087735 | Ga0500556_0087735_149_904 | 245 |
| 196 | 3300053130 | Ga0500642_0001595 | Ga0500642_0001595_2381_3139 | 245 |
| 197 | 3300053153 | Ga0500616_0000741 | Ga0500616_0000741_21808_22560 | 245 |
| 198 | 3300001904 | JGI24736J21556_1023431 | JGI24736J21556_10234311 | 246 |
| 199 | 3300001990 | JGI24737J22298_10005184 | JGI24737J22298_100051846 | 246 |
| 200 | 3300002067 | JGI24735J21928_10000009 | JGI24735J21928_10000009139 | 246 |
| 201 | 3300002737 | JGI25162J39368_1000117 | JGI25162J39368_10001177 | 246 |
| 202 | 3300002737 | JGI25162J39368_1001967 | JGI25162J39368_10019679 | 246 |
| 203 | 3300003214 | JGI25165J46597_1003041 | JGI25165J46597_10030412 | 246 |
| 204 | 3300003320 | rootH2_10042766 | rootH2_1004276612 | 246 |
| 205 | 3300003320 | rootH2_10121714 | rootH2_101217143 | 246 |
| 206 | 3300003322 | rootL2_10065137 | rootL2_100651373 | 246 |
| 207 | 3300003323 | rootH1_10061979 | rootH1_100619793 | 246 |
| 208 | 3300003763 | Ga0055529_1007047 | Ga0055529_10070471 | 246 |
| 209 | 3300005288 | Ga0065714_10073164 | Ga0065714_100731641 | 246 |
| 210 | 3300005288 | Ga0065714_10152919 | Ga0065714_101529191 | 246 |
| 211 | 3300005327 | Ga0070658_10017496 | Ga0070658_100174962 | 246 |
| 212 | 3300005327 | Ga0070658_10359948 | Ga0070658_103599482 | 246 |
| 213 | 3300005336 | Ga0070680_100035133 | Ga0070680_1000351334 | 246 |
| 214 | 3300005458 | Ga0070681_10027027 | Ga0070681_100270271 | 246 |
| 215 | 3300005530 | Ga0070679_100006460 | Ga0070679_1000064606 | 246 |
| 216 | 3300005539 | Ga0068853_100343028 | Ga0068853_1003430281 | 246 |
| 217 | 3300005548 | Ga0070665_100007570 | Ga0070665_10000757010 | 246 |
| 218 | 3300005563 | Ga0068855_100001223 | Ga0068855_1000012235 | 246 |
| 219 | 3300005563 | Ga0068855_100489665 | Ga0068855_1004896652 | 246 |
| 220 | 3300005563 | Ga0068855_100989620 | Ga0068855_1009896202 | 246 |
| 221 | 3300005614 | Ga0068856_100000118 | Ga0068856_10000011824 | 246 |
| 222 | 3300005614 | Ga0068856_100012488 | Ga0068856_1000124883 | 246 |
| 223 | 3300005614 | Ga0068856_100730774 | Ga0068856_1007307741 | 246 |
| 224 | 3300006195 | Ga0075366_10000951 | Ga0075366_100009512 | 246 |
| 225 | 3300009093 | Ga0105240_10000083 | Ga0105240_1000008354 | 246 |
| 226 | 3300009093 | Ga0105240_10070935 | Ga0105240_100709352 | 246 |
| 227 | 3300009093 | Ga0105240_10841020 | Ga0105240_108410201 | 246 |
| 228 | 3300009174 | Ga0105241_10005676 | Ga0105241_100056762 | 246 |
| 229 | 3300009174 | Ga0105241_10015739 | Ga0105241_100157392 | 246 |
| 230 | 3300009174 | Ga0105241_10234489 | Ga0105241_102344891 | 246 |
| 231 | 3300009545 | Ga0105237_10000138 | Ga0105237_1000013867 | 246 |
| 232 | 3300009545 | Ga0105237_10002006 | Ga0105237_100020068 | 246 |
| 233 | 3300009545 | Ga0105237_10002486 | Ga0105237_100024863 | 246 |
| 234 | 3300009545 | Ga0105237_10012221 | Ga0105237_100122212 | 246 |
| 235 | 3300009545 | Ga0105237_10021012 | Ga0105237_100210126 | 246 |
| 236 | 3300009551 | Ga0105238_10228503 | Ga0105238_102285032 | 246 |
| 237 | 3300009551 | Ga0105238_10355672 | Ga0105238_103556721 | 246 |
| 238 | 3300010375 | Ga0105239_10000045 | Ga0105239_10000045113 | 246 |
| 239 | 3300010375 | Ga0105239_10000708 | Ga0105239_100007088 | 246 |
| 240 | 3300010375 | Ga0105239_10002462 | Ga0105239_1000246220 | 246 |
| 241 | 3300010375 | Ga0105239_10006980 | Ga0105239_1000698010 | 246 |
| 242 | 3300010375 | Ga0105239_10768940 | Ga0105239_107689402 | 246 |
| 243 | 3300010375 | Ga0105239_10779598 | Ga0105239_107795982 | 246 |
| 244 | 3300013102 | Ga0157371_10018021 | Ga0157371_100180213 | 246 |
| 245 | 3300013105 | Ga0157369_10271825 | Ga0157369_102718252 | 246 |
| 246 | 3300013105 | Ga0157369_10650218 | Ga0157369_106502181 | 246 |
| 247 | 3300013296 | Ga0157374_10285955 | Ga0157374_102859551 | 246 |
| 248 | 3300013297 | Ga0157378_10184056 | Ga0157378_101840563 | 246 |
| 249 | 3300013306 | Ga0163162_10114843 | Ga0163162_101148432 | 246 |
| 250 | 3300013306 | Ga0163162_10187215 | Ga0163162_101872152 | 246 |
| 251 | 3300013306 | Ga0163162_10441247 | Ga0163162_104412472 | 246 |
| 252 | 3300013307 | Ga0157372_10001459 | Ga0157372_100014592 | 246 |
| 253 | 3300025231 | Ga0207427_100109 | Ga0207427_10010956 | 246 |
| 254 | 3300025233 | Ga0209437_100030 | Ga0209437_100030419 | 246 |
| 255 | 3300025233 | Ga0209437_100096 | Ga0209437_100096163 | 246 |
| 256 | 3300025250 | Ga0209026_1022674 | Ga0209026_10226742 | 246 |
| 257 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029539 | 246 |
| 258 | 3300025261 | Ga0209233_1010492 | Ga0209233_10104924 | 246 |
| 259 | 3300025272 | Ga0209455_1002386 | Ga0209455_10023863 | 246 |
| 260 | 3300025904 | Ga0207647_10016305 | Ga0207647_100163052 | 246 |
| 261 | 3300025904 | Ga0207647_10249085 | Ga0207647_102490852 | 246 |
| 262 | 3300025909 | Ga0207705_10597961 | Ga0207705_105979611 | 246 |
| 263 | 3300025911 | Ga0207654_10002431 | Ga0207654_100024311 | 246 |
| 264 | 3300025912 | Ga0207707_10047811 | Ga0207707_100478111 | 246 |
| 265 | 3300025913 | Ga0207695_10000127 | Ga0207695_1000012753 | 246 |
| 266 | 3300025913 | Ga0207695_10031350 | Ga0207695_100313502 | 246 |
| 267 | 3300025913 | Ga0207695_10037805 | Ga0207695_100378054 | 246 |
| 268 | 3300025913 | Ga0207695_10616530 | Ga0207695_106165301 | 246 |
| 269 | 3300025914 | Ga0207671_10000382 | Ga0207671_1000038269 | 246 |
| 270 | 3300025914 | Ga0207671_10000635 | Ga0207671_1000063539 | 246 |
| 271 | 3300025914 | Ga0207671_10002004 | Ga0207671_100020042 | 246 |
| 272 | 3300025914 | Ga0207671_10003851 | Ga0207671_100038515 | 246 |
| 273 | 3300025921 | Ga0207652_10422951 | Ga0207652_104229512 | 246 |
| 274 | 3300025924 | Ga0207694_10142776 | Ga0207694_101427762 | 246 |
| 275 | 3300025949 | Ga0207667_10006254 | Ga0207667_1000625414 | 246 |
| 276 | 3300025949 | Ga0207667_10529059 | Ga0207667_105290592 | 246 |
| 277 | 3300026078 | Ga0207702_10000590 | Ga0207702_1000059023 | 246 |
| 278 | 3300026078 | Ga0207702_10009460 | Ga0207702_100094608 | 246 |
| 279 | 3300026116 | Ga0207674_10509122 | Ga0207674_105091222 | 246 |
| 280 | 3300028379 | Ga0268266_10129276 | Ga0268266_101292762 | 246 |
| 281 | 3300028794 | Ga0307515_10000077 | Ga0307515_1000007724 | 246 |
| 282 | 3300028800 | Ga0265338_10076188 | Ga0265338_100761883 | 246 |
| 283 | 3300031507 | Ga0307509_10137868 | Ga0307509_101378682 | 246 |
| 284 | 3300033179 | Ga0307507_10000097 | Ga0307507_1000009733 | 246 |
| 285 | 3300037312 | Ga0395899_0000011 | Ga0395899_0000011_41048_41803 | 246 |
| 286 | 3300037418 | Ga0395900_0002406 | Ga0395900_0002406_16358_17098 | 246 |
| 287 | 3300037471 | Ga0395905_0001183 | Ga0395905_0001183_18406_19146 | 246 |
| 288 | 3300038443 | Ga0395901_0006292 | Ga0395901_0006292_9298_10038 | 246 |
| 289 | 3300046460 | Ga0495638_0193231 | Ga0495638_0193231_151_891 | 246 |
| 290 | 3300046471 | Ga0495650_0000023 | Ga0495650_0000023_396860_397600 | 246 |
| 291 | 3300046492 | Ga0495585_0000235 | Ga0495585_0000235_41173_41913 | 246 |
| 292 | 3300046492 | Ga0495585_0001898 | Ga0495585_0001898_14818_15558 | 246 |
| 293 | 3300046492 | Ga0495585_0129701 | Ga0495585_0129701_322_1062 | 246 |
| 294 | 3300046507 | Ga0495606_0000448 | Ga0495606_0000448_2427_3167 | 246 |
| 295 | 3300046507 | Ga0495606_0011179 | Ga0495606_0011179_4779_5519 | 246 |
| 296 | 3300046512 | Ga0495610_0005456 | Ga0495610_0005456_7001_7741 | 246 |
| 297 | 3300046513 | Ga0495616_0002589 | Ga0495616_0002589_1038_1778 | 246 |
| 298 | 3300046513 | Ga0495616_0016166 | Ga0495616_0016166_1132_1872 | 246 |
| 299 | 3300046523 | Ga0495644_0003068 | Ga0495644_0003068_5862_6602 | 246 |
| 300 | 3300046524 | Ga0495648_0008550 | Ga0495648_0008550_4776_5516 | 246 |
| 301 | 3300046530 | Ga0495654_0039760 | Ga0495654_0039760_1360_2100 | 246 |
| 302 | 3300046538 | Ga0495609_0007589 | Ga0495609_0007589_440_1180 | 246 |
| 303 | 3300046538 | Ga0495609_0110558 | Ga0495609_0110558_179_919 | 246 |
| 304 | 3300046557 | Ga0495622_0037380 | Ga0495622_0037380_1424_2164 | 246 |
| 305 | 3300046558 | Ga0495633_0000004 | Ga0495633_0000004_5547_6287 | 246 |
| 306 | 3300046558 | Ga0495633_0003981 | Ga0495633_0003981_2423_3163 | 246 |
| 307 | 3300046616 | Ga0495668_0000058 | Ga0495668_0000058_75811_76551 | 246 |
| 308 | 3300046616 | Ga0495668_0035546 | Ga0495668_0035546_774_1514 | 246 |
| 309 | 3300046660 | Ga0495625_0000018 | Ga0495625_0000018_146772_147512 | 246 |
| 310 | 3300046660 | Ga0495625_0000641 | Ga0495625_0000641_34562_35302 | 246 |
| 311 | 3300046660 | Ga0495625_0178025 | Ga0495625_0178025_80_820 | 246 |
| 312 | 3300046665 | Ga0495661_0002106 | Ga0495661_0002106_5294_6034 | 246 |
| 313 | 3300046665 | Ga0495661_0006725 | Ga0495661_0006725_6652_7392 | 246 |
| 314 | 3300046665 | Ga0495661_0069993 | Ga0495661_0069993_1294_2034 | 246 |
| 315 | 3300046694 | Ga0495649_0000015 | Ga0495649_0000015_75274_76014 | 246 |
| 316 | 3300047443 | Ga0495687_023006 | Ga0495687_023006_1215_1955 | 246 |
| 317 | 3300047469 | Ga0495673_0055881 | Ga0495673_0055881_508_1248 | 246 |
| 318 | 3300047472 | Ga0495686_0011518 | Ga0495686_0011518_4978_5718 | 246 |
| 319 | 3300047472 | Ga0495686_0149506 | Ga0495686_0149506_421_1161 | 246 |
| 320 | 3300049459 | Ga0495678_008458 | Ga0495678_008458_1409_2149 | 246 |
| 321 | 3300050493 | nmdc:mga0k408_1713_c1 | nmdc:mga0k408_1713_c1_846_1586 | 246 |
| 322 | 3300053125 | Ga0500618_000105 | Ga0500618_000105_8216_8956 | 246 |
| 323 | 3300053125 | Ga0500618_008762 | Ga0500618_008762_722_1462 | 246 |
| 324 | 3300053130 | Ga0500642_0087344 | Ga0500642_0087344_374_1117 | 246 |
| 325 | 3300053157 | Ga0500624_000714 | Ga0500624_000714_1428_2168 | 246 |
| 326 | 3300005563 | Ga0068855_100000522 | Ga0068855_10000052221 | 247 |
| 327 | 3300013102 | Ga0157371_10012900 | Ga0157371_100129005 | 247 |
| 328 | 3300013105 | Ga0157369_10000507 | Ga0157369_1000050747 | 247 |
| 329 | 3300013307 | Ga0157372_10000048 | Ga0157372_1000004818 | 247 |
| 330 | 3300020077 | Ga0206351_10910495 | Ga0206351_109104952 | 247 |
| 331 | 3300025250 | Ga0209026_1006685 | Ga0209026_10066852 | 247 |
| 332 | 3300025949 | Ga0207667_10000197 | Ga0207667_1000019758 | 247 |
| 333 | 3300026067 | Ga0207678_10041518 | Ga0207678_100415183 | 247 |
| 334 | 3300031911 | Ga0307412_10375456 | Ga0307412_103754562 | 247 |
| 335 | 3300037312 | Ga0395899_0000453 | Ga0395899_0000453_15887_16633 | 247 |
| 336 | 3300038443 | Ga0395901_0246394 | Ga0395901_0246394_26_772 | 247 |
| 337 | 3300045049 | Ga0466959_0027021 | Ga0466959_0027021_2680_3426 | 247 |
| 338 | 3300046660 | Ga0495625_0089000 | Ga0495625_0089000_841_1584 | 247 |
| 339 | 3300047472 | Ga0495686_0000303 | Ga0495686_0000303_26298_27041 | 247 |
| 340 | 3300003323 | rootH1_10002777 | rootH1_1000277733 | 248 |
| 341 | 3300003323 | rootH1_10075254 | rootH1_100752542 | 248 |
| 342 | 3300001904 | JGI24736J21556_1007511 | JGI24736J21556_10075112 | 249 |
| 343 | 3300001990 | JGI24737J22298_10002167 | JGI24737J22298_100021676 | 249 |
| 344 | 3300002067 | JGI24735J21928_10006817 | JGI24735J21928_100068173 | 249 |
| 345 | 3300005339 | Ga0070660_100145545 | Ga0070660_1001455452 | 249 |
| 346 | 3300005577 | Ga0068857_100018430 | Ga0068857_1000184303 | 249 |
| 347 | 3300013100 | Ga0157373_10003916 | Ga0157373_1000391613 | 249 |
| 348 | 3300013102 | Ga0157371_10000107 | Ga0157371_10000107111 | 249 |
| 349 | 3300013104 | Ga0157370_10028893 | Ga0157370_100288936 | 249 |
| 350 | 3300013307 | Ga0157372_10001370 | Ga0157372_1000137017 | 249 |
| 351 | 3300025261 | Ga0209233_1002409 | Ga0209233_10024094 | 249 |
| 352 | 3300025904 | Ga0207647_10000529 | Ga0207647_100005293 | 249 |
| 353 | 3300025909 | Ga0207705_10407342 | Ga0207705_104073422 | 249 |
| 354 | 3300025949 | Ga0207667_10218129 | Ga0207667_102181292 | 249 |
| 355 | 3300037471 | Ga0395905_0150761 | Ga0395905_0150761_1332_2081 | 249 |
| 356 | 3300038443 | Ga0395901_0104117 | Ga0395901_0104117_674_1423 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qy7-assembly1.cif.gz_A | crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases | 0.885 | 26 | 246 |
| 2wjd-assembly1.cif.gz_A | crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. | 0.8543 | 25 | 249 |
| 3qy7-assembly1.cif.gz_A | crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases | 0.7915 | 26 | 246 |
| 2wjd-assembly1.cif.gz_A | crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. | 0.7898 | 25 | 249 |
| 4gem-assembly1.cif.gz_A | crystal structure of zucchini (k171a) | 0.6138 | 110 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1K6_1_254_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9058 | 26 | 246 | 3.20.20.140 |
| 3qy7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.885 | 26 | 246 | 3.20.20.140 |
| 3qy8A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8482 | 26 | 247 | 3.20.20.140 |
| af_Q2G1K6_1_254_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8067 | 26 | 246 | 3.20.20.140 |
| 3qy7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7915 | 26 | 246 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P5TCD1-F1-model_v4 | deleted | 0.9792 | 26 | 249 |
|
| AF-A0A7C3KQQ6-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.978 | 28 | 248 |
GO:0004726
GO:0030145 GO:0030946 GO:0140793 |
| AF-A0A2M8FV22-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9772 | 19 | 245 |
GO:0004726
GO:0030145 GO:0030946 GO:0140793 |
| AF-A0A1V6HIY5-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9734 | 28 | 248 |
GO:0004726
GO:0030145 GO:0030946 GO:0140793 |
| AF-A0A7C6ALI7-F1-model_v4 | protein-tyrosine-phosphatase (EC 3.1.3.48) | 0.9728 | 23 | 245 |
GO:0004726
GO:0030145 GO:0030946 GO:0140793 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar