F420382

General Info

Members Datasets Scaffolds Average Seq Length
356 183 335 245

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10017496|Ga0070658_100174962
Length 266
Sequence MMLLRVITSNIITNNTTLAKMFSWFKKSEEKREITFDYSSVIVDMHSHVLPGIDDGAQTPQDSVELIRQMMALGIKKIIATPHIMADYYKNTAETINGALDILKAELVKEKIDIVVEAAAEHYFDESFESRIDEGKLMIMGDNYVLFEFSFISPPPNVIKIIQKLLALGHKPILAHPERYPYMDVEQFQMLRGQGLLFQLNTISLTGYYGKEAKKLAENLIDAQLIDFISSDMHHLRHADALKNALKMPYLEKVMFDYPLKNIMLR

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2739367651 Pedobacter sp. OK291 Isolate Unclassified
5 2739367656 Pedobacter sp. CF523 Isolate Unclassified
6 2739367663 Pedobacter sp. YR510 Isolate Unclassified
7 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
8 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
9 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
10 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
11 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
12 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
13 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
14 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
15 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
16 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
17 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
18 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
19 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
20 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
21 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
22 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
175 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
183 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.54
Metatranscriptomes 0.56
Isolates 5.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.27
Nodule 0
Rhizoplane 0.28
Rhizosphere 82.3
Stem 0
Stem Tuber 0
Unclassified 8.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007511 3300001904 Bacteria 1831
2 JGI24736J21556_1012268 3300001904 Bacteria 1389
3 JGI24736J21556_1023431 3300001904 Bacteria 965
4 JGI24737J22298_10002167 3300001990 Bacteria 7000
5 JGI24737J22298_10005184 3300001990 Bacteria 4511
6 JGI24737J22298_10013672 3300001990 Bacteria 2639
7 JGI24735J21928_10000009 3300002067 Bacteria 247425
8 JGI24735J21928_10006817 3300002067 Bacteria 3744
9 JGI24735J21928_10041089 3300002067 Unclassified 1348
10 JGI25162J39368_1000117 3300002737 Bacteria 87536
11 JGI25162J39368_1001967 3300002737 Bacteria 9225
12 JGI25152J39213_1000737 3300002773 Bacteria 16746
13 JGI25150J39212_1000360 3300002774 Bacteria 22352
14 JGI25151J46595_10000947 3300003187 Bacteria 22352
15 JGI25165J46597_1003041 3300003214 Bacteria 4575
16 JGI25153J46596_10000587 3300003215 Bacteria 22352
17 rootH1_10132916 3300003316 Bacteria 2127
18 rootH2_10012367 3300003320 Bacteria 23503
19 rootH2_10042766 3300003320 Bacteria 27178
20 rootH2_10121714 3300003320 Bacteria 2513
21 rootH2_10206601 3300003320 Bacteria 2890
22 rootL2_10065137 3300003322 Bacteria 3027
23 rootH1_10002777 3300003323 Bacteria 45345
24 rootH1_10046618 3300003323 Bacteria 1790
25 rootH1_10061979 3300003323 Bacteria 6236
26 rootH1_10075254 3300003323 Bacteria 4063
27 rootH1_10110327 3300003323 Bacteria 3979
28 Ga0055529_1007047 3300003763 Bacteria 1541
29 Ga0055536_1000016 3300003781 Bacteria 222134
30 Ga0055530_10003522 3300003791 Bacteria 8839
31 Ga0065714_10028327 3300005288 Bacteria 1216
32 Ga0065714_10073164 3300005288 Bacteria 3235
33 Ga0065714_10152919 3300005288 Bacteria 1095
34 Ga0070658_10000025 3300005327 Bacteria 174551
35 Ga0070658_10017496 3300005327 Bacteria 5735
36 Ga0070658_10359948 3300005327 Bacteria 1246
37 Ga0070676_10001252 3300005328 Bacteria 12792
38 Ga0070680_100035133 3300005336 Bacteria 4045
39 Ga0068868_100021181 3300005338 Bacteria 4894
40 Ga0070660_100004162 3300005339 Bacteria 9992
41 Ga0070660_100145545 3300005339 Bacteria 1903
42 Ga0070659_100000203 3300005366 Bacteria 46107
43 Ga0070659_100502697 3300005366 Unclassified 1033
44 Ga0070678_100018106 3300005456 Bacteria 4558
45 Ga0070662_100000003 3300005457 Bacteria 239813
46 Ga0070662_100362067 3300005457 Bacteria 1190
47 Ga0070681_10027027 3300005458 Bacteria 5769
48 Ga0068867_100000591 3300005459 Bacteria 24039
49 Ga0070679_100006460 3300005530 Bacteria 10922
50 Ga0070684_100012469 3300005535 Bacteria 6815
51 Ga0068853_100343028 3300005539 Bacteria 1388
52 Ga0070665_100000061 3300005548 Bacteria 222138
53 Ga0070665_100007570 3300005548 Bacteria 11040
54 Ga0068855_100000522 3300005563 Bacteria 47210
55 Ga0068855_100001223 3300005563 Bacteria 31869
56 Ga0068855_100030218 3300005563 Bacteria 6480
57 Ga0068855_100053474 3300005563 Unclassified 4750
58 Ga0068855_100380931 3300005563 Bacteria 1549
59 Ga0068855_100489665 3300005563 Bacteria 1337
60 Ga0068855_100509917 3300005563 Bacteria 1306
61 Ga0068855_100989620 3300005563 Bacteria 884
62 Ga0068857_100018430 3300005577 Bacteria 6124
63 Ga0068856_100000118 3300005614 Bacteria 78833
64 Ga0068856_100012488 3300005614 Bacteria 8222
65 Ga0068856_100514459 3300005614 Bacteria 1218
66 Ga0068856_100730774 3300005614 Bacteria 1010
67 Ga0068852_100000765 3300005616 Bacteria 21159
68 Ga0068858_100158048 3300005842 Bacteria 2134
69 Ga0068858_100296338 3300005842 Bacteria 1542
70 Ga0075366_10000951 3300006195 Bacteria 14104
71 Ga0097621_100000140 3300006237 Bacteria 43299
72 Ga0068871_100000195 3300006358 Bacteria 41566
73 Ga0068865_100000060 3300006881 Bacteria 58604
74 Ga0105244_10120161 3300009036 Bacteria 1273
75 Ga0105240_10000083 3300009093 Bacteria 192934
76 Ga0105240_10020048 3300009093 Bacteria 8927
77 Ga0105240_10070935 3300009093 Bacteria 4309
78 Ga0105240_10159795 3300009093 Bacteria 2678
79 Ga0105240_10324295 3300009093 Bacteria 1754
80 Ga0105240_10841020 3300009093 Bacteria 991
81 Ga0105243_10032441 3300009148 Bacteria 4036
82 Ga0105241_10004560 3300009174 Bacteria 10250
83 Ga0105241_10005676 3300009174 Bacteria 9207
84 Ga0105241_10007899 3300009174 Bacteria 7821
85 Ga0105241_10015739 3300009174 Bacteria 5542
86 Ga0105241_10183080 3300009174 Bacteria 1739
87 Ga0105241_10234489 3300009174 Bacteria 1548
88 Ga0105242_10132632 3300009176 Bacteria 2152
89 Ga0105237_10000138 3300009545 Bacteria 102411
90 Ga0105237_10001149 3300009545 Bacteria 35513
91 Ga0105237_10002006 3300009545 Bacteria 25906
92 Ga0105237_10002486 3300009545 Bacteria 22858
93 Ga0105237_10012221 3300009545 Bacteria 9052
94 Ga0105237_10021012 3300009545 Bacteria 6718
95 Ga0105237_10046026 3300009545 Bacteria 4389
96 Ga0105237_10392423 3300009545 Bacteria 1393
97 Ga0105238_10015647 3300009551 Bacteria 7678
98 Ga0105238_10228503 3300009551 Bacteria 1838
99 Ga0105238_10355672 3300009551 Bacteria 1454
100 Ga0105249_10636004 3300009553 Bacteria 1124
101 Ga0105239_10000045 3300010375 Bacteria 186314
102 Ga0105239_10000708 3300010375 Bacteria 47248
103 Ga0105239_10002462 3300010375 Bacteria 23588
104 Ga0105239_10006980 3300010375 Bacteria 13012
105 Ga0105239_10019797 3300010375 Bacteria 7428
106 Ga0105239_10089437 3300010375 Bacteria 3395
107 Ga0105239_10575022 3300010375 Bacteria 1284
108 Ga0105239_10768940 3300010375 Bacteria 1103
109 Ga0105239_10779598 3300010375 Bacteria 1095
110 Ga0157373_10002350 3300013100 Bacteria 14364
111 Ga0157373_10003916 3300013100 Bacteria 11236
112 Ga0157373_10052421 3300013100 Bacteria 2903
113 Ga0157371_10000107 3300013102 Bacteria 126477
114 Ga0157371_10012900 3300013102 Bacteria 6364
115 Ga0157371_10018021 3300013102 Bacteria 5230
116 Ga0157371_10032541 3300013102 Bacteria 3752
117 Ga0157370_10001651 3300013104 Bacteria 27525
118 Ga0157370_10016234 3300013104 Bacteria 7545
119 Ga0157370_10028893 3300013104 Bacteria 5450
120 Ga0157370_10042215 3300013104 Bacteria 4396
121 Ga0157370_10208670 3300013104 Bacteria 1811
122 Ga0157370_10220484 3300013104 Bacteria 1757
123 Ga0157369_10000507 3300013105 Bacteria 51275
124 Ga0157369_10001625 3300013105 Bacteria 27447
125 Ga0157369_10271825 3300013105 Bacteria 1766
126 Ga0157369_10282701 3300013105 Bacteria 1728
127 Ga0157369_10650218 3300013105 Bacteria 1087
128 Ga0157374_10000125 3300013296 Bacteria 70183
129 Ga0157374_10000562 3300013296 Bacteria 32938
130 Ga0157374_10011215 3300013296 Bacteria 7750
131 Ga0157374_10285955 3300013296 Bacteria 1629
132 Ga0157378_10049772 3300013297 Bacteria 3729
133 Ga0157378_10184056 3300013297 Bacteria 1966
134 Ga0157378_10903078 3300013297 Bacteria 914
135 Ga0163162_10000087 3300013306 Bacteria 85680
136 Ga0163162_10000586 3300013306 Bacteria 33755
137 Ga0163162_10003615 3300013306 Bacteria 14814
138 Ga0163162_10114843 3300013306 Bacteria 2792
139 Ga0163162_10187215 3300013306 Bacteria 2197
140 Ga0163162_10441247 3300013306 Bacteria 1434
141 Ga0157372_10000048 3300013307 Bacteria 142757
142 Ga0157372_10001314 3300013307 Bacteria 26916
143 Ga0157372_10001370 3300013307 Bacteria 26365
144 Ga0157372_10001459 3300013307 Bacteria 25634
145 Ga0157372_10018988 3300013307 Bacteria 7398
146 Ga0157375_10124812 3300013308 Bacteria 2688
147 Ga0157375_10126386 3300013308 Bacteria 2672
148 Ga0157375_10586181 3300013308 Bacteria 1275
149 Ga0182008_10000165 3300014497 Bacteria 51552
150 Ga0157376_10008227 3300014969 Bacteria 7510
151 Ga0182006_1000247 3300015261 Bacteria 50590
152 Ga0182007_10000016 3300015262 Bacteria 202375
153 Ga0182007_10009517 3300015262 Bacteria 3913
154 Ga0183373_1011 3300015682 Bacteria 138873
155 Ga0163161_10003307 3300017792 Bacteria 11320
156 Ga0163161_10008795 3300017792 Bacteria 6981
157 Ga0163161_10027189 3300017792 Bacteria 4058
158 Ga0163161_10035926 3300017792 Bacteria 3547
159 Ga0163161_10092603 3300017792 Bacteria 2238
160 Ga0206351_10910495 3300020077 Bacteria 3575
161 Ga0207427_100109 3300025231 Bacteria 116061
162 Ga0209437_100030 3300025233 Bacteria 532466
163 Ga0209437_100096 3300025233 Bacteria 233558
164 Ga0207425_1000549 3300025245 Bacteria 22404
165 Ga0209026_1006685 3300025250 Bacteria 2769
166 Ga0209026_1022674 3300025250 Bacteria 961
167 Ga0209129_1000660 3300025258 Bacteria 22946
168 Ga0209233_1000029 3300025261 Bacteria 641642
169 Ga0209233_1002409 3300025261 Bacteria 6904
170 Ga0209233_1010492 3300025261 Bacteria 2773
171 Ga0209455_1002386 3300025272 Bacteria 7292
172 Ga0209676_1000106 3300025292 Bacteria 222576
173 Ga0209025_1002112 3300025294 Bacteria 22404
174 Ga0209758_1001943 3300025297 Bacteria 22404
175 Ga0209050_1000174 3300025298 Bacteria 148871
176 Ga0207647_10000529 3300025904 Bacteria 30445
177 Ga0207647_10000691 3300025904 Bacteria 26470
178 Ga0207647_10016305 3300025904 Bacteria 5074
179 Ga0207647_10085783 3300025904 Bacteria 1883
180 Ga0207647_10249085 3300025904 Unclassified 1019
181 Ga0207645_10001026 3300025907 Bacteria 23094
182 Ga0207705_10000088 3300025909 Bacteria 113694
183 Ga0207705_10407342 3300025909 Bacteria 1052
184 Ga0207705_10597961 3300025909 Unclassified 858
185 Ga0207654_10002431 3300025911 Bacteria 9508
186 Ga0207654_10003991 3300025911 Bacteria 7431
187 Ga0207707_10047811 3300025912 Bacteria 3725
188 Ga0207695_10000127 3300025913 Bacteria 227338
189 Ga0207695_10007448 3300025913 Bacteria 13918
190 Ga0207695_10020114 3300025913 Bacteria 7657
191 Ga0207695_10031350 3300025913 Bacteria 5832
192 Ga0207695_10037805 3300025913 Bacteria 5205
193 Ga0207695_10262712 3300025913 Bacteria 1623
194 Ga0207695_10616530 3300025913 Bacteria 966
195 Ga0207671_10000382 3300025914 Bacteria 62807
196 Ga0207671_10000635 3300025914 Bacteria 45980
197 Ga0207671_10002004 3300025914 Bacteria 22433
198 Ga0207671_10003851 3300025914 Bacteria 14678
199 Ga0207671_10037773 3300025914 Bacteria 3580
200 Ga0207671_10199041 3300025914 Bacteria 1564
201 Ga0207671_10387528 3300025914 Bacteria 1111
202 Ga0207652_10422951 3300025921 Bacteria 1201
203 Ga0207694_10076998 3300025924 Bacteria 2613
204 Ga0207694_10142776 3300025924 Bacteria 1926
205 Ga0207694_10144512 3300025924 Bacteria 1914
206 Ga0207644_10019709 3300025931 Bacteria 4580
207 Ga0207690_10000212 3300025932 Bacteria 44164
208 Ga0207706_10000009 3300025933 Bacteria 200607
209 Ga0207686_10015887 3300025934 Bacteria 4218
210 Ga0207704_10000028 3300025938 Bacteria 122144
211 Ga0207689_10207246 3300025942 Bacteria 1619
212 Ga0207661_10025050 3300025944 Bacteria 4531
213 Ga0207667_10000197 3300025949 Bacteria 87987
214 Ga0207667_10006254 3300025949 Bacteria 14451
215 Ga0207667_10028674 3300025949 Bacteria 6044
216 Ga0207667_10040858 3300025949 Bacteria 4936
217 Ga0207667_10218129 3300025949 Bacteria 1955
218 Ga0207667_10288565 3300025949 Bacteria 1677
219 Ga0207667_10306789 3300025949 Bacteria 1621
220 Ga0207667_10529059 3300025949 Bacteria 1194
221 Ga0207651_10001787 3300025960 Bacteria 9992
222 Ga0207677_10070896 3300026023 Bacteria 2458
223 Ga0207639_10058247 3300026041 Bacteria 2971
224 Ga0207678_10041518 3300026067 Bacteria 3989
225 Ga0207702_10000590 3300026078 Bacteria 40097
226 Ga0207702_10009460 3300026078 Bacteria 8186
227 Ga0207648_10000968 3300026089 Bacteria 32355
228 Ga0207674_10509122 3300026116 Bacteria 1163
229 Ga0207698_10009565 3300026142 Bacteria 6189
230 Ga0207698_10090980 3300026142 Bacteria 2497
231 Ga0268266_10000053 3300028379 Bacteria 295181
232 Ga0268266_10129276 3300028379 Bacteria 2257
233 Ga0307517_10000400 3300028786 Bacteria 74215
234 Ga0307515_10000077 3300028794 Bacteria 228162
235 Ga0307515_10011130 3300028794 Bacteria 17107
236 Ga0265338_10076188 3300028800 Bacteria 2842
237 Ga0307509_10137868 3300031507 Bacteria 2382
238 Ga0307408_100001246 3300031548 Bacteria 19110
239 Ga0307408_100016738 3300031548 Bacteria 4900
240 Ga0307405_10000023 3300031731 Bacteria 141450
241 Ga0307405_10342898 3300031731 Unclassified 1149
242 Ga0307407_10000057 3300031903 Bacteria 49070
243 Ga0307412_10000490 3300031911 Bacteria 23654
244 Ga0307412_10195470 3300031911 Unclassified 1532
245 Ga0307412_10375456 3300031911 Bacteria 1149
246 Ga0307409_100007288 3300031995 Bacteria 6603
247 Ga0307416_100000112 3300032002 Bacteria 49491
248 Ga0307416_100745278 3300032002 Bacteria 1072
249 Ga0307414_10011747 3300032004 Bacteria 5151
250 Ga0307414_10062052 3300032004 Bacteria 2650
251 Ga0307414_10071621 3300032004 Bacteria 2501
252 Ga0307414_10090186 3300032004 Bacteria 2274
253 Ga0307414_10124669 3300032004 Bacteria 1988
254 Ga0307414_10233776 3300032004 Bacteria 1517
255 Ga0307414_10745341 3300032004 Bacteria 890
256 Ga0307411_10676867 3300032005 Bacteria 896
257 Ga0307507_10000097 3300033179 Bacteria 139761
258 Ga0307510_10002335 3300033180 Bacteria 21445
259 Ga0373941_0040193 3300035115 Bacteria 1441
260 Ga0395899_0000011 3300037312 Bacteria 521331
261 Ga0395899_0000453 3300037312 Bacteria 46699
262 Ga0395899_0002919 3300037312 Bacteria 13729
263 Ga0395900_0000431 3300037418 Bacteria 60172
264 Ga0395900_0002406 3300037418 Bacteria 20644
265 Ga0395898_0100138 3300037466 Bacteria 2783
266 Ga0395905_0001183 3300037471 Bacteria 32616
267 Ga0395905_0018692 3300037471 Bacteria 6573
268 Ga0395905_0150761 3300037471 Bacteria 2187
269 Ga0395901_0001158 3300038443 Bacteria 28004
270 Ga0395901_0006292 3300038443 Bacteria 12025
271 Ga0395901_0104117 3300038443 Bacteria 2978
272 Ga0395901_0246394 3300038443 Bacteria 1863
273 Ga0436361_0606257 3300039447 Bacteria 4438
274 Ga0466959_0027021 3300045049 Bacteria 4257
275 Ga0495638_0193231 3300046460 Bacteria 1154
276 Ga0495650_0000023 3300046471 Bacteria 527763
277 Ga0495585_0000235 3300046492 Bacteria 57308
278 Ga0495585_0001898 3300046492 Bacteria 15732
279 Ga0495585_0129701 3300046492 Bacteria 1328
280 Ga0495583_0051321 3300046506 Bacteria 1881
281 Ga0495606_0000448 3300046507 Bacteria 67282
282 Ga0495606_0011179 3300046507 Bacteria 7349
283 Ga0495610_0000098 3300046512 Bacteria 101620
284 Ga0495610_0001315 3300046512 Bacteria 22083
285 Ga0495610_0005456 3300046512 Bacteria 9030
286 Ga0495616_0002589 3300046513 Bacteria 11900
287 Ga0495616_0016166 3300046513 Bacteria 4135
288 Ga0495631_0018968 3300046518 Bacteria 3232
289 Ga0495637_0034035 3300046520 Bacteria 2233
290 Ga0495644_0003068 3300046523 Bacteria 6612
291 Ga0495648_0008550 3300046524 Bacteria 8040
292 Ga0495652_0346832 3300046529 Bacteria 1065
293 Ga0495654_0039760 3300046530 Bacteria 2347
294 Ga0495609_0007589 3300046538 Bacteria 5392
295 Ga0495609_0110558 3300046538 Bacteria 1186
296 Ga0495622_0037380 3300046557 Bacteria 2262
297 Ga0495633_0000004 3300046558 Bacteria 370781
298 Ga0495633_0003981 3300046558 Bacteria 9580
299 Ga0495668_0000058 3300046616 Bacteria 195501
300 Ga0495668_0000526 3300046616 Bacteria 47711
301 Ga0495668_0035546 3300046616 Bacteria 2793
302 Ga0495625_0000018 3300046660 Bacteria 299567
303 Ga0495625_0000641 3300046660 Bacteria 50345
304 Ga0495625_0002311 3300046660 Bacteria 20845
305 Ga0495625_0089000 3300046660 Bacteria 2138
306 Ga0495625_0178025 3300046660 Bacteria 1416
307 Ga0495661_0002106 3300046665 Bacteria 15618
308 Ga0495661_0006725 3300046665 Bacteria 8069
309 Ga0495661_0069993 3300046665 Bacteria 2054
310 Ga0495649_0000015 3300046694 Bacteria 246431
311 Ga0495649_0034047 3300046694 Bacteria 2804
312 Ga0495683_0007778 3300047323 Bacteria 5754
313 Ga0495687_001855 3300047443 Bacteria 18422
314 Ga0495687_023006 3300047443 Bacteria 2983
315 Ga0495673_0055881 3300047469 Bacteria 1711
316 Ga0495681_0178779 3300047470 Bacteria 873
317 Ga0495686_0000303 3300047472 Bacteria 84544
318 Ga0495686_0000471 3300047472 Bacteria 60050
319 Ga0495686_0011518 3300047472 Bacteria 6229
320 Ga0495686_0149506 3300047472 Bacteria 1372
321 Ga0495678_008458 3300049459 Bacteria 5188
322 Ga0501223_000993 3300049663 Bacteria 6711
323 Ga0501235_033455 3300049669 Bacteria 1164
324 Ga0501240_001473 3300049673 Bacteria 2304
325 Ga0501269_010225 3300049766 Bacteria 1139
326 nmdc:mga0k408_1713_c1 3300050493 Bacteria 11794
327 Ga0500556_0087735 3300053104 Bacteria 1184
328 Ga0500608_002973 3300053122 Bacteria 6277
329 Ga0500618_000105 3300053125 Bacteria 68057
330 Ga0500618_008762 3300053125 Bacteria 2798
331 Ga0500642_0001595 3300053130 Bacteria 6542
332 Ga0500642_0087344 3300053130 Bacteria 1438
333 Ga0500616_0000741 3300053153 Bacteria 37622
334 Ga0500624_000714 3300053157 Bacteria 8307
335 Ga0587073_0007499 3300059492 Bacteria 1728

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049669 Ga0501235_033455 Ga0501235_033455_500_1129 205
2 3300046529 Ga0495652_0346832 Ga0495652_0346832_23_691 222
3 3300047470 Ga0495681_0178779 Ga0495681_0178779_18_686 222
4 3300013297 Ga0157378_10903078 Ga0157378_109030782 225
5 3300025904 Ga0207647_10085783 Ga0207647_100857832 225
6 3300046506 Ga0495583_0051321 Ga0495583_0051321_1193_1870 225
7 3300049673 Ga0501240_001473 Ga0501240_001473_281_967 226
8 3300049766 Ga0501269_010225 Ga0501269_010225_305_1057 228
9 3300013308 Ga0157375_10586181 Ga0157375_105861812 232
10 3300009036 Ga0105244_10120161 Ga0105244_101201612 235
11 3300013100 Ga0157373_10052421 Ga0157373_100524212 235
12 3300015261 Ga0182006_1000247 Ga0182006_100024740 235
13 3300017792 Ga0163161_10003307 Ga0163161_100033072 235
14 3300031731 Ga0307405_10000023 Ga0307405_1000002321 235
15 3300031903 Ga0307407_10000057 Ga0307407_1000005720 235
16 3300031995 Ga0307409_100007288 Ga0307409_1000072882 235
17 3300032002 Ga0307416_100000112 Ga0307416_10000011234 235
18 3300032004 Ga0307414_10011747 Ga0307414_100117474 235
19 3300032005 Ga0307411_10676867 Ga0307411_106768671 235
20 3300046512 Ga0495610_0001315 Ga0495610_0001315_8992_9729 235
21 3300046520 Ga0495637_0034035 Ga0495637_0034035_578_1315 235
22 3300005327 Ga0070658_10000025 Ga0070658_10000025159 237
23 3300005563 Ga0068855_100053474 Ga0068855_1000534745 237
24 3300025909 Ga0207705_10000088 Ga0207705_1000008824 237
25 3300025949 Ga0207667_10028674 Ga0207667_100286744 237
26 iso_pu_bacteria 2585427687 2586207949 239
27 iso_pu_bacteria 2738541302 2738856506 239
28 iso_pu_bacteria 2739367651 2739587476 239
29 iso_pu_bacteria 2739367656 2739613838 239
30 iso_pu_bacteria 2739367663 2739647841 239
31 iso_pu_bacteria 2842722452 2842726924 239
32 iso_pu_bacteria 2842909656 2842911773 239
33 iso_pu_bacteria 2849281842 2849286968 239
34 iso_pu_bacteria 2857627736 2857630347 239
35 iso_pu_bacteria 2902048731 2902050864 239
36 iso_pu_bacteria 2945997725 2946002744 239
37 3300046660 Ga0495625_0002311 Ga0495625_0002311_19753_20502 240
38 iso_pu_bacteria 2904445276 2904448788 240
39 iso_pu_bacteria 2954016120 2954019618 240
40 iso_pu_bacteria 2852623160 2852625458 241
41 iso_pu_bacteria 2884933994 2884934463 241
42 3300028794 Ga0307515_10011130 Ga0307515_1001113015 242
43 iso_pu_bacteria 2599185184 2599479230 242
44 iso_pu_bacteria 2919437846 2919440090 242
45 iso_pu_bacteria 2928078545 2928082456 242
46 iso_pu_bacteria 2928147474 2928148959 242
47 iso_pu_bacteria 2932082852 2932087489 242
48 3300002773 JGI25152J39213_1000737 JGI25152J39213_10007374 243
49 3300002774 JGI25150J39212_1000360 JGI25150J39212_10003604 243
50 3300003187 JGI25151J46595_10000947 JGI25151J46595_100009474 243
51 3300003215 JGI25153J46596_10000587 JGI25153J46596_100005874 243
52 3300003781 Ga0055536_1000016 Ga0055536_1000016190 243
53 3300003791 Ga0055530_10003522 Ga0055530_100035224 243
54 3300013104 Ga0157370_10001651 Ga0157370_1000165116 243
55 3300013104 Ga0157370_10016234 Ga0157370_100162344 243
56 3300013104 Ga0157370_10042215 Ga0157370_100422154 243
57 3300013104 Ga0157370_10220484 Ga0157370_102204843 243
58 3300013105 Ga0157369_10001625 Ga0157369_1000162522 243
59 3300015262 Ga0182007_10000016 Ga0182007_10000016166 243
60 3300015682 Ga0183373_1011 Ga0183373_1011132 243
61 3300017792 Ga0163161_10008795 Ga0163161_100087953 243
62 3300017792 Ga0163161_10027189 Ga0163161_100271892 243
63 3300017792 Ga0163161_10035926 Ga0163161_100359263 243
64 3300025245 Ga0207425_1000549 Ga0207425_10005494 243
65 3300025258 Ga0209129_1000660 Ga0209129_10006604 243
66 3300025292 Ga0209676_1000106 Ga0209676_100010616 243
67 3300025294 Ga0209025_1002112 Ga0209025_10021124 243
68 3300025297 Ga0209758_1001943 Ga0209758_10019434 243
69 3300025298 Ga0209050_1000174 Ga0209050_1000174141 243
70 3300031548 Ga0307408_100001246 Ga0307408_1000012469 243
71 3300031548 Ga0307408_100016738 Ga0307408_1000167382 243
72 3300031731 Ga0307405_10342898 Ga0307405_103428981 243
73 3300031911 Ga0307412_10000490 Ga0307412_1000049013 243
74 3300031911 Ga0307412_10195470 Ga0307412_101954701 243
75 3300032002 Ga0307416_100745278 Ga0307416_1007452782 243
76 3300032004 Ga0307414_10062052 Ga0307414_100620521 243
77 3300032004 Ga0307414_10071621 Ga0307414_100716214 243
78 3300032004 Ga0307414_10090186 Ga0307414_100901863 243
79 3300032004 Ga0307414_10124669 Ga0307414_101246692 243
80 3300032004 Ga0307414_10745341 Ga0307414_107453411 243
81 3300046512 Ga0495610_0000098 Ga0495610_0000098_99433_100170 243
82 3300049663 Ga0501223_000993 Ga0501223_000993_3936_4673 243
83 iso_pu_bacteria 2977232053 2977234436 243
84 3300001904 JGI24736J21556_1012268 JGI24736J21556_10122682 244
85 3300001990 JGI24737J22298_10013672 JGI24737J22298_100136723 244
86 3300002067 JGI24735J21928_10041089 JGI24735J21928_100410892 244
87 3300003320 rootH2_10012367 rootH2_1001236724 244
88 3300003320 rootH2_10206601 rootH2_102066012 244
89 3300003323 rootH1_10046618 rootH1_100466182 244
90 3300005288 Ga0065714_10028327 Ga0065714_100283272 244
91 3300005328 Ga0070676_10001252 Ga0070676_1000125213 244
92 3300005338 Ga0068868_100021181 Ga0068868_1000211812 244
93 3300005366 Ga0070659_100502697 Ga0070659_1005026971 244
94 3300005456 Ga0070678_100018106 Ga0070678_1000181062 244
95 3300005457 Ga0070662_100000003 Ga0070662_10000000317 244
96 3300005457 Ga0070662_100362067 Ga0070662_1003620671 244
97 3300005459 Ga0068867_100000591 Ga0068867_10000059115 244
98 3300005548 Ga0070665_100000061 Ga0070665_10000006132 244
99 3300005563 Ga0068855_100380931 Ga0068855_1003809312 244
100 3300005563 Ga0068855_100509917 Ga0068855_1005099172 244
101 3300005614 Ga0068856_100514459 Ga0068856_1005144592 244
102 3300005616 Ga0068852_100000765 Ga0068852_10000076513 244
103 3300005842 Ga0068858_100158048 Ga0068858_1001580482 244
104 3300006237 Ga0097621_100000140 Ga0097621_10000014010 244
105 3300006358 Ga0068871_100000195 Ga0068871_1000001958 244
106 3300006881 Ga0068865_100000060 Ga0068865_1000000608 244
107 3300009093 Ga0105240_10020048 Ga0105240_100200485 244
108 3300009093 Ga0105240_10159795 Ga0105240_101597953 244
109 3300009148 Ga0105243_10032441 Ga0105243_100324412 244
110 3300009174 Ga0105241_10004560 Ga0105241_100045604 244
111 3300009174 Ga0105241_10007899 Ga0105241_100078996 244
112 3300009176 Ga0105242_10132632 Ga0105242_101326321 244
113 3300009545 Ga0105237_10001149 Ga0105237_1000114918 244
114 3300009551 Ga0105238_10015647 Ga0105238_100156474 244
115 3300010375 Ga0105239_10089437 Ga0105239_100894372 244
116 3300010375 Ga0105239_10575022 Ga0105239_105750222 244
117 3300013102 Ga0157371_10032541 Ga0157371_100325413 244
118 3300013104 Ga0157370_10208670 Ga0157370_102086702 244
119 3300013105 Ga0157369_10282701 Ga0157369_102827012 244
120 3300013296 Ga0157374_10000125 Ga0157374_1000012528 244
121 3300013296 Ga0157374_10000562 Ga0157374_1000056217 244
122 3300013297 Ga0157378_10049772 Ga0157378_100497723 244
123 3300013306 Ga0163162_10000087 Ga0163162_1000008725 244
124 3300013306 Ga0163162_10000586 Ga0163162_1000058621 244
125 3300013307 Ga0157372_10018988 Ga0157372_100189885 244
126 3300013308 Ga0157375_10124812 Ga0157375_101248123 244
127 3300013308 Ga0157375_10126386 Ga0157375_101263862 244
128 3300014497 Ga0182008_10000165 Ga0182008_1000016518 244
129 3300014969 Ga0157376_10008227 Ga0157376_100082272 244
130 3300015262 Ga0182007_10009517 Ga0182007_100095173 244
131 3300025904 Ga0207647_10000691 Ga0207647_100006919 244
132 3300025907 Ga0207645_10001026 Ga0207645_100010266 244
133 3300025911 Ga0207654_10003991 Ga0207654_100039915 244
134 3300025913 Ga0207695_10007448 Ga0207695_1000744814 244
135 3300025913 Ga0207695_10020114 Ga0207695_100201147 244
136 3300025914 Ga0207671_10387528 Ga0207671_103875282 244
137 3300025924 Ga0207694_10144512 Ga0207694_101445122 244
138 3300025931 Ga0207644_10019709 Ga0207644_100197095 244
139 3300025933 Ga0207706_10000009 Ga0207706_1000000927 244
140 3300025934 Ga0207686_10015887 Ga0207686_100158874 244
141 3300025938 Ga0207704_10000028 Ga0207704_1000002830 244
142 3300025942 Ga0207689_10207246 Ga0207689_102072462 244
143 3300025949 Ga0207667_10288565 Ga0207667_102885652 244
144 3300025949 Ga0207667_10306789 Ga0207667_103067893 244
145 3300025960 Ga0207651_10001787 Ga0207651_100017873 244
146 3300026023 Ga0207677_10070896 Ga0207677_100708962 244
147 3300026041 Ga0207639_10058247 Ga0207639_100582473 244
148 3300026089 Ga0207648_10000968 Ga0207648_1000096819 244
149 3300026142 Ga0207698_10009565 Ga0207698_100095652 244
150 3300028379 Ga0268266_10000053 Ga0268266_10000053168 244
151 3300028786 Ga0307517_10000400 Ga0307517_1000040049 244
152 3300032004 Ga0307414_10233776 Ga0307414_102337762 244
153 3300033180 Ga0307510_10002335 Ga0307510_1000233518 244
154 3300037312 Ga0395899_0002919 Ga0395899_0002919_1092_1826 244
155 3300037418 Ga0395900_0000431 Ga0395900_0000431_32755_33489 244
156 3300037466 Ga0395898_0100138 Ga0395898_0100138_2004_2738 244
157 3300037471 Ga0395905_0018692 Ga0395905_0018692_429_1163 244
158 3300038443 Ga0395901_0001158 Ga0395901_0001158_27088_27822 244
159 3300039447 Ga0436361_0606257 Ga0436361_0606257_2352_3086 244
160 3300046518 Ga0495631_0018968 Ga0495631_0018968_1785_2534 244
161 3300046694 Ga0495649_0034047 Ga0495649_0034047_699_1433 244
162 3300047323 Ga0495683_0007778 Ga0495683_0007778_382_1116 244
163 3300047443 Ga0495687_001855 Ga0495687_001855_13785_14519 244
164 3300053122 Ga0500608_002973 Ga0500608_002973_2565_3299 244
165 3300059492 Ga0587073_0007499 Ga0587073_0007499_407_1141 244
166 3300003316 rootH1_10132916 rootH1_101329162 245
167 3300003323 rootH1_10110327 rootH1_101103272 245
168 3300005339 Ga0070660_100004162 Ga0070660_1000041627 245
169 3300005366 Ga0070659_100000203 Ga0070659_10000020343 245
170 3300005535 Ga0070684_100012469 Ga0070684_1000124693 245
171 3300005563 Ga0068855_100030218 Ga0068855_1000302186 245
172 3300005842 Ga0068858_100296338 Ga0068858_1002963382 245
173 3300009093 Ga0105240_10324295 Ga0105240_103242952 245
174 3300009174 Ga0105241_10183080 Ga0105241_101830802 245
175 3300009545 Ga0105237_10046026 Ga0105237_100460262 245
176 3300009545 Ga0105237_10392423 Ga0105237_103924232 245
177 3300009553 Ga0105249_10636004 Ga0105249_106360042 245
178 3300010375 Ga0105239_10019797 Ga0105239_100197976 245
179 3300013100 Ga0157373_10002350 Ga0157373_1000235010 245
180 3300013296 Ga0157374_10011215 Ga0157374_100112157 245
181 3300013306 Ga0163162_10003615 Ga0163162_100036157 245
182 3300013307 Ga0157372_10001314 Ga0157372_1000131413 245
183 3300017792 Ga0163161_10092603 Ga0163161_100926032 245
184 3300025913 Ga0207695_10262712 Ga0207695_102627122 245
185 3300025914 Ga0207671_10037773 Ga0207671_100377734 245
186 3300025914 Ga0207671_10199041 Ga0207671_101990412 245
187 3300025924 Ga0207694_10076998 Ga0207694_100769982 245
188 3300025932 Ga0207690_10000212 Ga0207690_1000021242 245
189 3300025944 Ga0207661_10025050 Ga0207661_100250504 245
190 3300025949 Ga0207667_10040858 Ga0207667_100408585 245
191 3300026142 Ga0207698_10090980 Ga0207698_100909802 245
192 3300035115 Ga0373941_0040193 Ga0373941_0040193_173_940 245
193 3300046616 Ga0495668_0000526 Ga0495668_0000526_41513_42268 245
194 3300047472 Ga0495686_0000471 Ga0495686_0000471_49782_50540 245
195 3300053104 Ga0500556_0087735 Ga0500556_0087735_149_904 245
196 3300053130 Ga0500642_0001595 Ga0500642_0001595_2381_3139 245
197 3300053153 Ga0500616_0000741 Ga0500616_0000741_21808_22560 245
198 3300001904 JGI24736J21556_1023431 JGI24736J21556_10234311 246
199 3300001990 JGI24737J22298_10005184 JGI24737J22298_100051846 246
200 3300002067 JGI24735J21928_10000009 JGI24735J21928_10000009139 246
201 3300002737 JGI25162J39368_1000117 JGI25162J39368_10001177 246
202 3300002737 JGI25162J39368_1001967 JGI25162J39368_10019679 246
203 3300003214 JGI25165J46597_1003041 JGI25165J46597_10030412 246
204 3300003320 rootH2_10042766 rootH2_1004276612 246
205 3300003320 rootH2_10121714 rootH2_101217143 246
206 3300003322 rootL2_10065137 rootL2_100651373 246
207 3300003323 rootH1_10061979 rootH1_100619793 246
208 3300003763 Ga0055529_1007047 Ga0055529_10070471 246
209 3300005288 Ga0065714_10073164 Ga0065714_100731641 246
210 3300005288 Ga0065714_10152919 Ga0065714_101529191 246
211 3300005327 Ga0070658_10017496 Ga0070658_100174962 246
212 3300005327 Ga0070658_10359948 Ga0070658_103599482 246
213 3300005336 Ga0070680_100035133 Ga0070680_1000351334 246
214 3300005458 Ga0070681_10027027 Ga0070681_100270271 246
215 3300005530 Ga0070679_100006460 Ga0070679_1000064606 246
216 3300005539 Ga0068853_100343028 Ga0068853_1003430281 246
217 3300005548 Ga0070665_100007570 Ga0070665_10000757010 246
218 3300005563 Ga0068855_100001223 Ga0068855_1000012235 246
219 3300005563 Ga0068855_100489665 Ga0068855_1004896652 246
220 3300005563 Ga0068855_100989620 Ga0068855_1009896202 246
221 3300005614 Ga0068856_100000118 Ga0068856_10000011824 246
222 3300005614 Ga0068856_100012488 Ga0068856_1000124883 246
223 3300005614 Ga0068856_100730774 Ga0068856_1007307741 246
224 3300006195 Ga0075366_10000951 Ga0075366_100009512 246
225 3300009093 Ga0105240_10000083 Ga0105240_1000008354 246
226 3300009093 Ga0105240_10070935 Ga0105240_100709352 246
227 3300009093 Ga0105240_10841020 Ga0105240_108410201 246
228 3300009174 Ga0105241_10005676 Ga0105241_100056762 246
229 3300009174 Ga0105241_10015739 Ga0105241_100157392 246
230 3300009174 Ga0105241_10234489 Ga0105241_102344891 246
231 3300009545 Ga0105237_10000138 Ga0105237_1000013867 246
232 3300009545 Ga0105237_10002006 Ga0105237_100020068 246
233 3300009545 Ga0105237_10002486 Ga0105237_100024863 246
234 3300009545 Ga0105237_10012221 Ga0105237_100122212 246
235 3300009545 Ga0105237_10021012 Ga0105237_100210126 246
236 3300009551 Ga0105238_10228503 Ga0105238_102285032 246
237 3300009551 Ga0105238_10355672 Ga0105238_103556721 246
238 3300010375 Ga0105239_10000045 Ga0105239_10000045113 246
239 3300010375 Ga0105239_10000708 Ga0105239_100007088 246
240 3300010375 Ga0105239_10002462 Ga0105239_1000246220 246
241 3300010375 Ga0105239_10006980 Ga0105239_1000698010 246
242 3300010375 Ga0105239_10768940 Ga0105239_107689402 246
243 3300010375 Ga0105239_10779598 Ga0105239_107795982 246
244 3300013102 Ga0157371_10018021 Ga0157371_100180213 246
245 3300013105 Ga0157369_10271825 Ga0157369_102718252 246
246 3300013105 Ga0157369_10650218 Ga0157369_106502181 246
247 3300013296 Ga0157374_10285955 Ga0157374_102859551 246
248 3300013297 Ga0157378_10184056 Ga0157378_101840563 246
249 3300013306 Ga0163162_10114843 Ga0163162_101148432 246
250 3300013306 Ga0163162_10187215 Ga0163162_101872152 246
251 3300013306 Ga0163162_10441247 Ga0163162_104412472 246
252 3300013307 Ga0157372_10001459 Ga0157372_100014592 246
253 3300025231 Ga0207427_100109 Ga0207427_10010956 246
254 3300025233 Ga0209437_100030 Ga0209437_100030419 246
255 3300025233 Ga0209437_100096 Ga0209437_100096163 246
256 3300025250 Ga0209026_1022674 Ga0209026_10226742 246
257 3300025261 Ga0209233_1000029 Ga0209233_1000029539 246
258 3300025261 Ga0209233_1010492 Ga0209233_10104924 246
259 3300025272 Ga0209455_1002386 Ga0209455_10023863 246
260 3300025904 Ga0207647_10016305 Ga0207647_100163052 246
261 3300025904 Ga0207647_10249085 Ga0207647_102490852 246
262 3300025909 Ga0207705_10597961 Ga0207705_105979611 246
263 3300025911 Ga0207654_10002431 Ga0207654_100024311 246
264 3300025912 Ga0207707_10047811 Ga0207707_100478111 246
265 3300025913 Ga0207695_10000127 Ga0207695_1000012753 246
266 3300025913 Ga0207695_10031350 Ga0207695_100313502 246
267 3300025913 Ga0207695_10037805 Ga0207695_100378054 246
268 3300025913 Ga0207695_10616530 Ga0207695_106165301 246
269 3300025914 Ga0207671_10000382 Ga0207671_1000038269 246
270 3300025914 Ga0207671_10000635 Ga0207671_1000063539 246
271 3300025914 Ga0207671_10002004 Ga0207671_100020042 246
272 3300025914 Ga0207671_10003851 Ga0207671_100038515 246
273 3300025921 Ga0207652_10422951 Ga0207652_104229512 246
274 3300025924 Ga0207694_10142776 Ga0207694_101427762 246
275 3300025949 Ga0207667_10006254 Ga0207667_1000625414 246
276 3300025949 Ga0207667_10529059 Ga0207667_105290592 246
277 3300026078 Ga0207702_10000590 Ga0207702_1000059023 246
278 3300026078 Ga0207702_10009460 Ga0207702_100094608 246
279 3300026116 Ga0207674_10509122 Ga0207674_105091222 246
280 3300028379 Ga0268266_10129276 Ga0268266_101292762 246
281 3300028794 Ga0307515_10000077 Ga0307515_1000007724 246
282 3300028800 Ga0265338_10076188 Ga0265338_100761883 246
283 3300031507 Ga0307509_10137868 Ga0307509_101378682 246
284 3300033179 Ga0307507_10000097 Ga0307507_1000009733 246
285 3300037312 Ga0395899_0000011 Ga0395899_0000011_41048_41803 246
286 3300037418 Ga0395900_0002406 Ga0395900_0002406_16358_17098 246
287 3300037471 Ga0395905_0001183 Ga0395905_0001183_18406_19146 246
288 3300038443 Ga0395901_0006292 Ga0395901_0006292_9298_10038 246
289 3300046460 Ga0495638_0193231 Ga0495638_0193231_151_891 246
290 3300046471 Ga0495650_0000023 Ga0495650_0000023_396860_397600 246
291 3300046492 Ga0495585_0000235 Ga0495585_0000235_41173_41913 246
292 3300046492 Ga0495585_0001898 Ga0495585_0001898_14818_15558 246
293 3300046492 Ga0495585_0129701 Ga0495585_0129701_322_1062 246
294 3300046507 Ga0495606_0000448 Ga0495606_0000448_2427_3167 246
295 3300046507 Ga0495606_0011179 Ga0495606_0011179_4779_5519 246
296 3300046512 Ga0495610_0005456 Ga0495610_0005456_7001_7741 246
297 3300046513 Ga0495616_0002589 Ga0495616_0002589_1038_1778 246
298 3300046513 Ga0495616_0016166 Ga0495616_0016166_1132_1872 246
299 3300046523 Ga0495644_0003068 Ga0495644_0003068_5862_6602 246
300 3300046524 Ga0495648_0008550 Ga0495648_0008550_4776_5516 246
301 3300046530 Ga0495654_0039760 Ga0495654_0039760_1360_2100 246
302 3300046538 Ga0495609_0007589 Ga0495609_0007589_440_1180 246
303 3300046538 Ga0495609_0110558 Ga0495609_0110558_179_919 246
304 3300046557 Ga0495622_0037380 Ga0495622_0037380_1424_2164 246
305 3300046558 Ga0495633_0000004 Ga0495633_0000004_5547_6287 246
306 3300046558 Ga0495633_0003981 Ga0495633_0003981_2423_3163 246
307 3300046616 Ga0495668_0000058 Ga0495668_0000058_75811_76551 246
308 3300046616 Ga0495668_0035546 Ga0495668_0035546_774_1514 246
309 3300046660 Ga0495625_0000018 Ga0495625_0000018_146772_147512 246
310 3300046660 Ga0495625_0000641 Ga0495625_0000641_34562_35302 246
311 3300046660 Ga0495625_0178025 Ga0495625_0178025_80_820 246
312 3300046665 Ga0495661_0002106 Ga0495661_0002106_5294_6034 246
313 3300046665 Ga0495661_0006725 Ga0495661_0006725_6652_7392 246
314 3300046665 Ga0495661_0069993 Ga0495661_0069993_1294_2034 246
315 3300046694 Ga0495649_0000015 Ga0495649_0000015_75274_76014 246
316 3300047443 Ga0495687_023006 Ga0495687_023006_1215_1955 246
317 3300047469 Ga0495673_0055881 Ga0495673_0055881_508_1248 246
318 3300047472 Ga0495686_0011518 Ga0495686_0011518_4978_5718 246
319 3300047472 Ga0495686_0149506 Ga0495686_0149506_421_1161 246
320 3300049459 Ga0495678_008458 Ga0495678_008458_1409_2149 246
321 3300050493 nmdc:mga0k408_1713_c1 nmdc:mga0k408_1713_c1_846_1586 246
322 3300053125 Ga0500618_000105 Ga0500618_000105_8216_8956 246
323 3300053125 Ga0500618_008762 Ga0500618_008762_722_1462 246
324 3300053130 Ga0500642_0087344 Ga0500642_0087344_374_1117 246
325 3300053157 Ga0500624_000714 Ga0500624_000714_1428_2168 246
326 3300005563 Ga0068855_100000522 Ga0068855_10000052221 247
327 3300013102 Ga0157371_10012900 Ga0157371_100129005 247
328 3300013105 Ga0157369_10000507 Ga0157369_1000050747 247
329 3300013307 Ga0157372_10000048 Ga0157372_1000004818 247
330 3300020077 Ga0206351_10910495 Ga0206351_109104952 247
331 3300025250 Ga0209026_1006685 Ga0209026_10066852 247
332 3300025949 Ga0207667_10000197 Ga0207667_1000019758 247
333 3300026067 Ga0207678_10041518 Ga0207678_100415183 247
334 3300031911 Ga0307412_10375456 Ga0307412_103754562 247
335 3300037312 Ga0395899_0000453 Ga0395899_0000453_15887_16633 247
336 3300038443 Ga0395901_0246394 Ga0395901_0246394_26_772 247
337 3300045049 Ga0466959_0027021 Ga0466959_0027021_2680_3426 247
338 3300046660 Ga0495625_0089000 Ga0495625_0089000_841_1584 247
339 3300047472 Ga0495686_0000303 Ga0495686_0000303_26298_27041 247
340 3300003323 rootH1_10002777 rootH1_1000277733 248
341 3300003323 rootH1_10075254 rootH1_100752542 248
342 3300001904 JGI24736J21556_1007511 JGI24736J21556_10075112 249
343 3300001990 JGI24737J22298_10002167 JGI24737J22298_100021676 249
344 3300002067 JGI24735J21928_10006817 JGI24735J21928_100068173 249
345 3300005339 Ga0070660_100145545 Ga0070660_1001455452 249
346 3300005577 Ga0068857_100018430 Ga0068857_1000184303 249
347 3300013100 Ga0157373_10003916 Ga0157373_1000391613 249
348 3300013102 Ga0157371_10000107 Ga0157371_10000107111 249
349 3300013104 Ga0157370_10028893 Ga0157370_100288936 249
350 3300013307 Ga0157372_10001370 Ga0157372_1000137017 249
351 3300025261 Ga0209233_1002409 Ga0209233_10024094 249
352 3300025904 Ga0207647_10000529 Ga0207647_100005293 249
353 3300025909 Ga0207705_10407342 Ga0207705_104073422 249
354 3300025949 Ga0207667_10218129 Ga0207667_102181292 249
355 3300037471 Ga0395905_0150761 Ga0395905_0150761_1332_2081 249
356 3300038443 Ga0395901_0104117 Ga0395901_0104117_674_1423 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19567

CpsB_CapC

Capsular polysaccharide synthesis, CpsB/CapC

42

264

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qy7-assembly1.cif.gz_A crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases 0.885 26 246
2wjd-assembly1.cif.gz_A crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. 0.8543 25 249
3qy7-assembly1.cif.gz_A crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases 0.7915 26 246
2wjd-assembly1.cif.gz_A crystal structure of the tyrosine phosphatase cps4b from steptococcus pneumoniae tigr4. 0.7898 25 249
4gem-assembly1.cif.gz_A crystal structure of zucchini (k171a) 0.6138 110 184
ID Description Score Start End Superfamily
af_Q2G1K6_1_254_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9058 26 246 3.20.20.140
3qy7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.885 26 246 3.20.20.140
3qy8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8482 26 247 3.20.20.140
af_Q2G1K6_1_254_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8067 26 246 3.20.20.140
3qy7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7915 26 246 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A4P5TCD1-F1-model_v4 deleted 0.9792 26 249
AF-A0A7C3KQQ6-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.978 28 248 GO:0004726
GO:0030145
GO:0030946
GO:0140793
AF-A0A2M8FV22-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9772 19 245 GO:0004726
GO:0030145
GO:0030946
GO:0140793
AF-A0A1V6HIY5-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9734 28 248 GO:0004726
GO:0030145
GO:0030946
GO:0140793
AF-A0A7C6ALI7-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9728 23 245 GO:0004726
GO:0030145
GO:0030946
GO:0140793

Feature Viewer

pLDDT pTM Quality
92.91 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map