F420335

General Info

Members Datasets Scaffolds Average Seq Length
355 195 710 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675903058|2676477928
Length 281
Sequence PVRPDRSREVVGVCGRYSLSRDPEDLAREFEVTQVDVREKLADYNVAPTKQVAVVVDRPPRRGDDAKPATTAKDARTGKGGEGDDAGLERHLRTVRWGLIPFWAKDPKIGNRLINARLETAAEKPAFRKAFASRRCLVPADGYYEWYGEKKGHKQPFFIHRSDGGVLAMAGLYEIWRDPDKGEDDPDRFVWTCTVLTTTAEDELGRIHDRMPLLVEPAEYSTWLDPRRDDADQLRSVLVPAAPGRLDAYPVSTEVNNVRNNGPQLLDPLPAEEAGDVADPR

Samples

Sample ID Description Type Environment
1 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
174 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
175 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
176 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
177 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
178 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
179 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
180 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
181 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
182 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
183 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
184 2891562705 Microbispora tritici MT50 Isolate Unclassified
185 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
186 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
187 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
188 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
189 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
190 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
191 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
192 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
193 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
194 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
195 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.7
Metatranscriptomes 2.82
Isolates 6.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 14.65
Rhizosphere 76.06
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007417J51691_1002924 3300003544 Bacteria 1615
2 Ga0007410J51695_1002687 3300003574 Bacteria 1819
3 Ga0007409J51694_1001950 3300003575 Bacteria 1597
4 Ga0007416J51690_1010040 3300003577 Bacteria 1659
5 Ga0007429J51699_1002484 3300003579 Bacteria 1915
6 Ga0007411J51799_101599 3300003611 Bacteria 1802
7 Ga0032354_1000689 3300003693 Bacteria 1851
8 Ga0070658_10138685 3300005327 Unclassified 2030
9 Ga0070658_10260120 3300005327 Bacteria 1474
10 Ga0070683_100020592 3300005329 Bacteria 5870
11 Ga0070683_100041957 3300005329 Bacteria 4211
12 Ga0070683_100073104 3300005329 Bacteria 3202
13 Ga0070682_100009289 3300005337 Bacteria 5565
14 Ga0070682_100033132 3300005337 Bacteria 3136
15 Ga0070682_100157602 3300005337 Bacteria 1565
16 Ga0068868_100036639 3300005338 Bacteria 3799
17 Ga0070660_100182192 3300005339 Bacteria 1700
18 Ga0070668_100148500 3300005347 Bacteria 1894
19 Ga0070659_100090581 3300005366 Bacteria 2451
20 Ga0070659_100134449 3300005366 Bacteria 2011
21 Ga0070714_100012225 3300005435 Bacteria 6847
22 Ga0070700_100112538 3300005441 Bacteria 1812
23 Ga0070700_100404177 3300005441 Bacteria 1028
24 Ga0070678_100143674 3300005456 Bacteria 1913
25 Ga0070678_100157326 3300005456 Bacteria 1837
26 Ga0070681_10101531 3300005458 Bacteria 2822
27 Ga0070681_10234796 3300005458 Bacteria 1748
28 Ga0070698_100001942 3300005471 Bacteria 22953
29 Ga0070679_100014974 3300005530 Bacteria 7451
30 Ga0070679_100028580 3300005530 Bacteria 5499
31 Ga0070684_100002700 3300005535 Bacteria 13104
32 Ga0070684_100037259 3300005535 Bacteria 4171
33 Ga0070665_100001745 3300005548 Bacteria 24881
34 Ga0068855_100014622 3300005563 Bacteria 9451
35 Ga0068855_100408006 3300005563 Bacteria 1488
36 Ga0070664_100125872 3300005564 Bacteria 2248
37 Ga0070702_100362934 3300005615 Bacteria 1024
38 Ga0068852_100040989 3300005616 Bacteria 3911
39 Ga0068858_100031637 3300005842 Bacteria 4916
40 Ga0068860_100112292 3300005843 Bacteria 2606
41 Ga0075365_10020594 3300006038 Bacteria 4093
42 Ga0075365_10043045 3300006038 Bacteria 2954
43 Ga0075365_10101655 3300006038 Bacteria 1969
44 Ga0075368_10003662 3300006042 Bacteria 5153
45 Ga0075363_100033679 3300006048 Bacteria 2670
46 Ga0075363_100039855 3300006048 Bacteria 2474
47 Ga0075364_10092171 3300006051 Bacteria 2011
48 Ga0075364_10148026 3300006051 Bacteria 1582
49 Ga0075362_10015427 3300006177 Bacteria 3108
50 Ga0075367_10010163 3300006178 Bacteria 4936
51 Ga0075370_10012211 3300006353 Bacteria 4534
52 Ga0075370_10068758 3300006353 Bacteria 2023
53 Ga0068871_100477622 3300006358 Bacteria 1121
54 Ga0075428_100019117 3300006844 Bacteria 7576
55 Ga0075428_100042793 3300006844 Bacteria 4980
56 Ga0075430_100127440 3300006846 Bacteria 2122
57 Ga0075431_100206904 3300006847 Bacteria 2006
58 Ga0111539_10096032 3300009094 Bacteria 3481
59 Ga0105245_10001875 3300009098 Bacteria 19079
60 Ga0105245_10184669 3300009098 Bacteria 1994
61 Ga0105245_10315979 3300009098 Bacteria 1537
62 Ga0114129_10133217 3300009147 Bacteria 3412
63 Ga0114129_10419741 3300009147 Bacteria 1760
64 Ga0105242_10062475 3300009176 Bacteria 3065
65 Ga0105242_10101701 3300009176 Bacteria 2436
66 Ga0105242_10305156 3300009176 Bacteria 1454
67 Ga0105248_10258527 3300009177 Bacteria 1960
68 Ga0105249_10056173 3300009553 Bacteria 3604
69 Ga0105239_10006772 3300010375 Bacteria 13230
70 Ga0105246_10000332 3300011119 Bacteria 25139
71 Ga0105246_10047047 3300011119 Bacteria 2944
72 Ga0105246_10646048 3300011119 Bacteria 920
73 Ga0157369_10320001 3300013105 Bacteria 1613
74 Ga0157374_10145907 3300013296 Bacteria 2298
75 Ga0163162_10079661 3300013306 Bacteria 3341
76 Ga0163162_10125419 3300013306 Bacteria 2673
77 Ga0157372_10004720 3300013307 Bacteria 14476
78 Ga0157372_10104391 3300013307 Bacteria 3239
79 Ga0157372_10484587 3300013307 Bacteria 1442
80 Ga0157372_10579282 3300013307 Bacteria 1308
81 Ga0157375_10003685 3300013308 Bacteria 13302
82 Ga0157375_10062296 3300013308 Bacteria 3706
83 Ga0157375_10227566 3300013308 Bacteria 2024
84 Ga0157375_10836417 3300013308 Bacteria 1068
85 Ga0163163_10038469 3300014325 Bacteria 4663
86 Ga0163163_10310302 3300014325 Bacteria 1630
87 Ga0182008_10027439 3300014497 Bacteria 2884
88 Ga0182008_10028538 3300014497 Bacteria 2822
89 Ga0182008_10166894 3300014497 Bacteria 1110
90 Ga0157377_10130088 3300014745 Bacteria 1536
91 Ga0157379_10002556 3300014968 Bacteria 15266
92 Ga0206353_10282476 3300020082 Bacteria 4615
93 Ga0207710_10215884 3300025900 Bacteria 951
94 Ga0207688_10249950 3300025901 Bacteria 1074
95 Ga0207647_10056100 3300025904 Bacteria 2418
96 Ga0207647_10197703 3300025904 Bacteria 1164
97 Ga0207657_10214649 3300025919 Bacteria 1543
98 Ga0207646_10405869 3300025922 Bacteria 1230
99 Ga0207687_10008754 3300025927 Bacteria 6614
100 Ga0207664_10033181 3300025929 Bacteria 3964
101 Ga0207690_10062344 3300025932 Bacteria 2538
102 Ga0207686_10400524 3300025934 Bacteria 1045
103 Ga0207711_10129348 3300025941 Bacteria 2263
104 Ga0207661_10039930 3300025944 Bacteria 3686
105 Ga0207661_10077106 3300025944 Bacteria 2740
106 Ga0207661_10232211 3300025944 Bacteria 1634
107 Ga0207667_10348354 3300025949 Bacteria 1511
108 Ga0207712_10649356 3300025961 Bacteria 917
109 Ga0207703_10021543 3300026035 Bacteria 5046
110 Ga0207639_10094275 3300026041 Bacteria 2403
111 Ga0207708_10061633 3300026075 Bacteria 2864
112 Ga0207708_10293800 3300026075 Bacteria 1320
113 Ga0207674_10002647 3300026116 Bacteria 22374
114 Ga0207683_10231757 3300026121 Bacteria 1684
115 Ga0209813_10002116 3300027866 Bacteria 4523
116 Ga0307405_10072033 3300031731 Bacteria 2226
117 Ga0307413_10037118 3300031824 Bacteria 2812
118 Ga0307407_10031684 3300031903 Bacteria 2866
119 Ga0307411_10219757 3300032005 Bacteria 1473
120 Ga0307411_10346777 3300032005 Bacteria 1209
121 Ga0307415_100056046 3300032126 Bacteria 2700
122 Ga0373943_0133565 3300035170 Bacteria 1330
123 Ga0395899_0304696 3300037312 Bacteria 1077
124 Ga0395900_0136197 3300037418 Bacteria 2516
125 Ga0395898_0056851 3300037466 Bacteria 3812
126 Ga0395898_0842254 3300037466 Bacteria 857
127 Ga0395901_0045325 3300038443 Bacteria 4563
128 Ga0451853_1627428 3300041512 Bacteria 1210
129 Ga0439463_068982 3300042016 Bacteria 905
130 Ga0466972_0100976 3300044658 Bacteria 1365
131 Ga0466965_0024845 3300044683 Bacteria 2899
132 Ga0466965_0029653 3300044683 Bacteria 2663
133 Ga0466966_0010156 3300044684 Bacteria 6244
134 Ga0466961_0030922 3300044693 Bacteria 3440
135 Ga0466963_0027731 3300044694 Bacteria 3629
136 Ga0466963_0031500 3300044694 Bacteria 3429
137 Ga0466963_0093307 3300044694 Bacteria 2052
138 Ga0466963_0151494 3300044694 Bacteria 1610
139 Ga0466963_0346480 3300044694 Bacteria 1046
140 Ga0466964_0067526 3300044706 Bacteria 1503
141 Ga0466971_0004200 3300044719 Bacteria 6208
142 Ga0466971_0021364 3300044719 Bacteria 2881
143 Ga0466971_0248781 3300044719 Bacteria 847
144 Ga0466968_0015866 3300044735 Bacteria 2992
145 Ga0466968_0136619 3300044735 Bacteria 1118
146 Ga0466970_0007494 3300044765 Bacteria 5474
147 Ga0466970_0011273 3300044765 Bacteria 4555
148 Ga0466970_0034169 3300044765 Bacteria 2690
149 Ga0466957_0014674 3300044842 Bacteria 4564
150 Ga0466960_0003819 3300044901 Bacteria 5839
151 Ga0466960_0004621 3300044901 Bacteria 5396
152 Ga0466960_0009098 3300044901 Bacteria 4086
153 Ga0466960_0053887 3300044901 Bacteria 1951
154 Ga0466960_0058933 3300044901 Bacteria 1877
155 Ga0466960_0085206 3300044901 Bacteria 1600
156 Ga0466960_0263227 3300044901 Bacteria 961
157 Ga0466959_0362428 3300045049 Bacteria 987
158 Ga0451576_0298926 3300045051 Bacteria 1683
159 Ga0466958_0029810 3300045836 Bacteria 3238
160 Ga0466958_0067842 3300045836 Bacteria 2179
161 Ga0466967_0007034 3300045976 Bacteria 8056
162 Ga0466967_0048434 3300045976 Bacteria 3710
163 Ga0466967_0137923 3300045976 Bacteria 2269
164 Ga0466967_0153585 3300045976 Bacteria 2154
165 Ga0466967_0169219 3300045976 Bacteria 2055
166 Ga0466967_0208198 3300045976 Bacteria 1854
167 Ga0466967_0235318 3300045976 Bacteria 1745
168 Ga0466967_0313313 3300045976 Bacteria 1512
169 Ga0466967_0365739 3300045976 Bacteria 1398
170 Ga0495641_0111481 3300046461 Bacteria 1221
171 Ga0495664_0175479 3300046477 Bacteria 1300
172 Ga0495608_0028532 3300046511 Bacteria 3793
173 Ga0495640_0238611 3300046533 Bacteria 1142
174 Ga0495586_0176594 3300046535 Bacteria 1208
175 Ga0495635_0063938 3300046663 Bacteria 2527
176 Ga0495635_0138391 3300046663 Bacteria 1659
177 Ga0495657_0150694 3300046675 Bacteria 1444
178 Ga0495657_0215279 3300046675 Bacteria 1166
179 Ga0495676_0266157 3300047321 Bacteria 1165
180 Ga0496100_0281726 3300048903 Bacteria 1239
181 Ga0496101_0056336 3300048904 Bacteria 2842
182 Ga0496101_0228585 3300048904 Bacteria 1445
183 Ga0496101_0495454 3300048904 Bacteria 965
184 Ga0496102_0034297 3300048905 Bacteria 4564
185 Ga0496102_0104205 3300048905 Bacteria 2638
186 Ga0496103_0044387 3300048906 Bacteria 2739
187 Ga0496103_0091917 3300048906 Bacteria 1915
188 Ga0496104_0089072 3300048907 Bacteria 2948
189 Ga0496104_0145386 3300048907 Bacteria 2277
190 Ga0496104_0295938 3300048907 Bacteria 1531
191 Ga0496104_0574164 3300048907 Bacteria 1038
192 Ga0496105_0011693 3300048908 Bacteria 6943
193 Ga0496105_0036915 3300048908 Bacteria 4026
194 Ga0496105_0245179 3300048908 Bacteria 1453
195 Ga0496106_0019169 3300048909 Bacteria 5072
196 Ga0496106_0059611 3300048909 Bacteria 2891
197 Ga0496107_0016965 3300048910 Bacteria 5120
198 Ga0496107_0069240 3300048910 Bacteria 2561
199 Ga0496107_0439179 3300048910 Bacteria 970
200 Ga0496108_0095945 3300048911 Bacteria 2525
201 Ga0496108_0141433 3300048911 Bacteria 2073
202 Ga0496108_0292355 3300048911 Bacteria 1419
203 Ga0496108_0483294 3300048911 Bacteria 1082
204 Ga0496109_0012302 3300048912 Bacteria 7388
205 Ga0496109_0030337 3300048912 Bacteria 4847
206 Ga0496109_0031080 3300048912 Bacteria 4789
207 Ga0496109_0072218 3300048912 Bacteria 3170
208 Ga0496109_0274716 3300048912 Bacteria 1588
209 Ga0496109_0499025 3300048912 Bacteria 1149
210 Ga0496110_0001726 3300048913 Bacteria 16096
211 Ga0496110_0031016 3300048913 Bacteria 4610
212 Ga0496110_0221927 3300048913 Bacteria 1719
213 Ga0496110_0230744 3300048913 Bacteria 1683
214 Ga0496110_0240875 3300048913 Bacteria 1646
215 Ga0496110_0572075 3300048913 Bacteria 1026
216 Ga0496111_0011123 3300048914 Bacteria 6057
217 Ga0496111_0150427 3300048914 Bacteria 1726
218 Ga0496111_0228001 3300048914 Bacteria 1384
219 Ga0496111_0233678 3300048914 Bacteria 1365
220 Ga0496111_0409530 3300048914 Bacteria 1002
221 Ga0496112_0052740 3300048915 Bacteria 3992
222 Ga0496112_0245093 3300048915 Bacteria 1744
223 Ga0496112_0422006 3300048915 Bacteria 1273
224 Ga0496113_0020090 3300048916 Bacteria 4689
225 Ga0496113_0114428 3300048916 Bacteria 2103
226 Ga0496113_0517007 3300048916 Bacteria 958
227 Ga0496113_0525620 3300048916 Bacteria 950
228 Ga0496114_0014328 3300048917 Bacteria 6361
229 Ga0496114_0015899 3300048917 Bacteria 6056
230 Ga0496114_0024236 3300048917 Bacteria 4951
231 Ga0496114_0130796 3300048917 Bacteria 2167
232 Ga0501307_002075 3300049162 Bacteria 1822
233 Ga0501311_003006 3300049527 Bacteria 1679
234 Ga0501031_0035797 3300049568 Bacteria 3239
235 Ga0501031_0042478 3300049568 Bacteria 2967
236 Ga0501031_0242247 3300049568 Bacteria 1172
237 Ga0501032_0047063 3300049569 Bacteria 2914
238 Ga0501032_0127934 3300049569 Bacteria 1677
239 Ga0501032_0176835 3300049569 Bacteria 1398
240 Ga0501034_0010542 3300049571 Bacteria 9622
241 Ga0501034_0022692 3300049571 Bacteria 6393
242 Ga0501036_0001452 3300049572 Bacteria 18223
243 Ga0501036_0014447 3300049572 Bacteria 6578
244 Ga0501036_0076456 3300049572 Bacteria 2832
245 Ga0501036_0082310 3300049572 Bacteria 2720
246 Ga0501036_0656604 3300049572 Bacteria 868
247 Ga0501037_0025031 3300049573 Bacteria 4412
248 Ga0501037_0087795 3300049573 Bacteria 2251
249 Ga0501037_0227152 3300049573 Bacteria 1311
250 Ga0501038_0011773 3300049574 Bacteria 7980
251 Ga0501038_0144268 3300049574 Bacteria 1945
252 Ga0501039_0082172 3300049575 Bacteria 2508
253 Ga0501039_0172671 3300049575 Bacteria 1700
254 Ga0501040_0022161 3300049576 Bacteria 4250
255 Ga0501040_0042266 3300049576 Bacteria 3104
256 Ga0501040_0173610 3300049576 Bacteria 1527
257 Ga0501040_0434154 3300049576 Bacteria 945
258 Ga0501041_0016609 3300049577 Bacteria 4379
259 Ga0501041_0028132 3300049577 Bacteria 3390
260 Ga0501041_0378015 3300049577 Bacteria 896
261 Ga0501042_0057734 3300049578 Bacteria 2769
262 Ga0501042_0093309 3300049578 Bacteria 2161
263 Ga0501042_0102823 3300049578 Bacteria 2055
264 Ga0501042_0448423 3300049578 Bacteria 936
265 Ga0501043_0168816 3300049579 Bacteria 1708
266 Ga0501048_0069566 3300049582 Bacteria 2486
267 Ga0501048_0088614 3300049582 Bacteria 2183
268 Ga0501048_0193981 3300049582 Bacteria 1439
269 Ga0501048_0448268 3300049582 Bacteria 924
270 Ga0501067_0000186 3300049583 Bacteria 35281
271 Ga0501067_0013651 3300049583 Bacteria 4497
272 Ga0501067_0022796 3300049583 Bacteria 3466
273 Ga0501068_0035548 3300049584 Bacteria 2974
274 Ga0501068_0065171 3300049584 Bacteria 2217
275 Ga0501068_0130138 3300049584 Bacteria 1574
276 Ga0501069_0014331 3300049585 Bacteria 4238
277 Ga0501069_0052298 3300049585 Bacteria 2274
278 Ga0501069_0070651 3300049585 Bacteria 1956
279 Ga0501069_0074279 3300049585 Bacteria 1907
280 Ga0501069_0110901 3300049585 Bacteria 1562
281 Ga0501070_0008709 3300049586 Bacteria 8580
282 Ga0501071_0012505 3300049587 Bacteria 5758
283 Ga0501071_0034498 3300049587 Bacteria 3602
284 Ga0501071_0037322 3300049587 Bacteria 3469
285 Ga0501071_0286138 3300049587 Bacteria 1248
286 Ga0501072_0093326 3300049588 Bacteria 2391
287 Ga0501072_0108922 3300049588 Bacteria 2204
288 Ga0501072_0217004 3300049588 Bacteria 1524
289 Ga0501073_0000338 3300049589 Bacteria 31568
290 Ga0501073_0011729 3300049589 Bacteria 6398
291 Ga0501074_0017280 3300049590 Bacteria 5232
292 Ga0501074_0027665 3300049590 Bacteria 4111
293 Ga0501074_0044790 3300049590 Bacteria 3202
294 Ga0501074_0385385 3300049590 Bacteria 994
295 Ga0501075_0074572 3300049591 Bacteria 2566
296 Ga0501076_0033740 3300049592 Bacteria 3997
297 Ga0501076_0223980 3300049592 Bacteria 1537
298 Ga0501077_0017295 3300049593 Bacteria 4548
299 Ga0501077_0018966 3300049593 Bacteria 4350
300 Ga0501079_0011363 3300049741 Bacteria 6795
301 Ga0501079_0046895 3300049741 Bacteria 3334
302 Ga0501079_0047723 3300049741 Bacteria 3304
303 Ga0501080_0000231 3300049742 Bacteria 42074
304 Ga0501080_0029700 3300049742 Bacteria 5088
305 Ga0501080_0055036 3300049742 Bacteria 3706
306 Ga0501080_0279357 3300049742 Bacteria 1518
307 Ga0501083_0040768 3300049744 Bacteria 3151
308 Ga0501035_0011176 3300049822 Bacteria 8314
309 Ga0501035_0515885 3300049822 Bacteria 982
310 Ga0501044_0408129 3300049823 Bacteria 1270
311 Ga0501045_0067354 3300049824 Bacteria 2629
312 nmdc:mga03683_51272_c1 3300050489 Bacteria 1722
313 nmdc:mga03n38_167186_c1 3300050490 Bacteria 1118
314 nmdc:mga00v17_10735_c1 3300050491 Bacteria 5016
315 nmdc:mga0yw44_68235_c1 3300050492 Bacteria 2199
316 nmdc:mga06z11_25708_c1 3300050494 Bacteria 2794
317 nmdc:mga07m45_19969_c1 3300050496 Bacteria 3636
318 nmdc:mga05p37_646843_c1 3300050507 Bacteria 1185
319 nmdc:mga06r32_162247_c1 3300050510 Bacteria 2217
320 Ga0495655_0088979 3300053083 Bacteria 897
321 Ga0495619_0013919 3300053085 Bacteria 5077
322 Ga0501084_0034955 3300054114 Bacteria 4202
323 Ga0501084_0208109 3300054114 Bacteria 1650
324 Ga0501084_0293294 3300054114 Bacteria 1373
325 Ga0590075_037727 3300059424 Bacteria 1232
326 Ga0501082_0021136 3300060353 Bacteria 5613
327 Ga0501082_0082864 3300060353 Bacteria 2767
328 Ga0501082_0141461 3300060353 Bacteria 2088
329 Ga0466962_0006164 3300061719 Bacteria 5761
330 Ga0466962_0006648 3300061719 Bacteria 5548
331 Ga0530510_0116593 3300061734 Bacteria 1958
332 Ga0530510_0285184 3300061734 Bacteria 1234
333 2676477928 2675903058 Bacteria 6822861
334 2515854374 2515154155 Bacteria 7985436
335 2676489134 2675903060 Bacteria 10051191
336 2816426965 2816332119 Bacteria 8120218
337 2827629252 2827628540 Bacteria 6858585
338 2855390706 2855386786 Bacteria 4752232
339 2856743160 2856741275 Bacteria 8096094
340 2873317077 2873314349 Bacteria 8512634
341 2884702781 2884693830 Bacteria 11273186
342 2891401166 2891395885 Bacteria 9251614
343 2891559835 2891554331 Bacteria 8812224
344 2891566045 2891562705 Bacteria 8039471
345 2895436472 2895427314 Bacteria 13147766
346 2895449096 2895442618 Bacteria 11027144
347 2904767047 2904765812 Bacteria 5369154
348 2904773797 2904770941 Bacteria 5580202
349 2908814690 2908811453 Bacteria 5478616
350 2919420507 2919420072 Bacteria 5390363
351 2919433735 2919432681 Bacteria 5390474
352 2984576897 2984576629 Bacteria 4248407
353 2990258645 2990256926 Bacteria 4252839
354 8055073382 8055066027 Bacteria 9479577
355 8055180196 8055172936 Bacteria 9305943
356 Ga0007417J51691_1002924
357 Ga0007410J51695_1002687
358 Ga0007409J51694_1001950
359 Ga0007416J51690_1010040
360 Ga0007429J51699_1002484
361 Ga0007411J51799_101599
362 Ga0032354_1000689
363 Ga0070658_10138685
364 Ga0070658_10260120
365 Ga0070683_100020592
366 Ga0070683_100041957
367 Ga0070683_100073104
368 Ga0070682_100009289
369 Ga0070682_100033132
370 Ga0070682_100157602
371 Ga0068868_100036639
372 Ga0070660_100182192
373 Ga0070668_100148500
374 Ga0070659_100090581
375 Ga0070659_100134449
376 Ga0070714_100012225
377 Ga0070700_100112538
378 Ga0070700_100404177
379 Ga0070678_100143674
380 Ga0070678_100157326
381 Ga0070681_10101531
382 Ga0070681_10234796
383 Ga0070698_100001942
384 Ga0070679_100014974
385 Ga0070679_100028580
386 Ga0070684_100002700
387 Ga0070684_100037259
388 Ga0070665_100001745
389 Ga0068855_100014622
390 Ga0068855_100408006
391 Ga0070664_100125872
392 Ga0070702_100362934
393 Ga0068852_100040989
394 Ga0068858_100031637
395 Ga0068860_100112292
396 Ga0075365_10020594
397 Ga0075365_10043045
398 Ga0075365_10101655
399 Ga0075368_10003662
400 Ga0075363_100033679
401 Ga0075363_100039855
402 Ga0075364_10092171
403 Ga0075364_10148026
404 Ga0075362_10015427
405 Ga0075367_10010163
406 Ga0075370_10012211
407 Ga0075370_10068758
408 Ga0068871_100477622
409 Ga0075428_100019117
410 Ga0075428_100042793
411 Ga0075430_100127440
412 Ga0075431_100206904
413 Ga0111539_10096032
414 Ga0105245_10001875
415 Ga0105245_10184669
416 Ga0105245_10315979
417 Ga0114129_10133217
418 Ga0114129_10419741
419 Ga0105242_10062475
420 Ga0105242_10101701
421 Ga0105242_10305156
422 Ga0105248_10258527
423 Ga0105249_10056173
424 Ga0105239_10006772
425 Ga0105246_10000332
426 Ga0105246_10047047
427 Ga0105246_10646048
428 Ga0157369_10320001
429 Ga0157374_10145907
430 Ga0163162_10079661
431 Ga0163162_10125419
432 Ga0157372_10004720
433 Ga0157372_10104391
434 Ga0157372_10484587
435 Ga0157372_10579282
436 Ga0157375_10003685
437 Ga0157375_10062296
438 Ga0157375_10227566
439 Ga0157375_10836417
440 Ga0163163_10038469
441 Ga0163163_10310302
442 Ga0182008_10027439
443 Ga0182008_10028538
444 Ga0182008_10166894
445 Ga0157377_10130088
446 Ga0157379_10002556
447 Ga0206353_10282476
448 Ga0207710_10215884
449 Ga0207688_10249950
450 Ga0207647_10056100
451 Ga0207647_10197703
452 Ga0207657_10214649
453 Ga0207646_10405869
454 Ga0207687_10008754
455 Ga0207664_10033181
456 Ga0207690_10062344
457 Ga0207686_10400524
458 Ga0207711_10129348
459 Ga0207661_10039930
460 Ga0207661_10077106
461 Ga0207661_10232211
462 Ga0207667_10348354
463 Ga0207712_10649356
464 Ga0207703_10021543
465 Ga0207639_10094275
466 Ga0207708_10061633
467 Ga0207708_10293800
468 Ga0207674_10002647
469 Ga0207683_10231757
470 Ga0209813_10002116
471 Ga0307405_10072033
472 Ga0307413_10037118
473 Ga0307407_10031684
474 Ga0307411_10219757
475 Ga0307411_10346777
476 Ga0307415_100056046
477 Ga0373943_0133565
478 Ga0395899_0304696
479 Ga0395900_0136197
480 Ga0395898_0056851
481 Ga0395898_0842254
482 Ga0395901_0045325
483 Ga0451853_1627428
484 Ga0439463_068982
485 Ga0466972_0100976
486 Ga0466965_0024845
487 Ga0466965_0029653
488 Ga0466966_0010156
489 Ga0466961_0030922
490 Ga0466963_0027731
491 Ga0466963_0031500
492 Ga0466963_0093307
493 Ga0466963_0151494
494 Ga0466963_0346480
495 Ga0466964_0067526
496 Ga0466971_0004200
497 Ga0466971_0021364
498 Ga0466971_0248781
499 Ga0466968_0015866
500 Ga0466968_0136619
501 Ga0466970_0007494
502 Ga0466970_0011273
503 Ga0466970_0034169
504 Ga0466957_0014674
505 Ga0466960_0003819
506 Ga0466960_0004621
507 Ga0466960_0009098
508 Ga0466960_0053887
509 Ga0466960_0058933
510 Ga0466960_0085206
511 Ga0466960_0263227
512 Ga0466959_0362428
513 Ga0451576_0298926
514 Ga0466958_0029810
515 Ga0466958_0067842
516 Ga0466967_0007034
517 Ga0466967_0048434
518 Ga0466967_0137923
519 Ga0466967_0153585
520 Ga0466967_0169219
521 Ga0466967_0208198
522 Ga0466967_0235318
523 Ga0466967_0313313
524 Ga0466967_0365739
525 Ga0495641_0111481
526 Ga0495664_0175479
527 Ga0495608_0028532
528 Ga0495640_0238611
529 Ga0495586_0176594
530 Ga0495635_0063938
531 Ga0495635_0138391
532 Ga0495657_0150694
533 Ga0495657_0215279
534 Ga0495676_0266157
535 Ga0496100_0281726
536 Ga0496101_0056336
537 Ga0496101_0228585
538 Ga0496101_0495454
539 Ga0496102_0034297
540 Ga0496102_0104205
541 Ga0496103_0044387
542 Ga0496103_0091917
543 Ga0496104_0089072
544 Ga0496104_0145386
545 Ga0496104_0295938
546 Ga0496104_0574164
547 Ga0496105_0011693
548 Ga0496105_0036915
549 Ga0496105_0245179
550 Ga0496106_0019169
551 Ga0496106_0059611
552 Ga0496107_0016965
553 Ga0496107_0069240
554 Ga0496107_0439179
555 Ga0496108_0095945
556 Ga0496108_0141433
557 Ga0496108_0292355
558 Ga0496108_0483294
559 Ga0496109_0012302
560 Ga0496109_0030337
561 Ga0496109_0031080
562 Ga0496109_0072218
563 Ga0496109_0274716
564 Ga0496109_0499025
565 Ga0496110_0001726
566 Ga0496110_0031016
567 Ga0496110_0221927
568 Ga0496110_0230744
569 Ga0496110_0240875
570 Ga0496110_0572075
571 Ga0496111_0011123
572 Ga0496111_0150427
573 Ga0496111_0228001
574 Ga0496111_0233678
575 Ga0496111_0409530
576 Ga0496112_0052740
577 Ga0496112_0245093
578 Ga0496112_0422006
579 Ga0496113_0020090
580 Ga0496113_0114428
581 Ga0496113_0517007
582 Ga0496113_0525620
583 Ga0496114_0014328
584 Ga0496114_0015899
585 Ga0496114_0024236
586 Ga0496114_0130796
587 Ga0501307_002075
588 Ga0501311_003006
589 Ga0501031_0035797
590 Ga0501031_0042478
591 Ga0501031_0242247
592 Ga0501032_0047063
593 Ga0501032_0127934
594 Ga0501032_0176835
595 Ga0501034_0010542
596 Ga0501034_0022692
597 Ga0501036_0001452
598 Ga0501036_0014447
599 Ga0501036_0076456
600 Ga0501036_0082310
601 Ga0501036_0656604
602 Ga0501037_0025031
603 Ga0501037_0087795
604 Ga0501037_0227152
605 Ga0501038_0011773
606 Ga0501038_0144268
607 Ga0501039_0082172
608 Ga0501039_0172671
609 Ga0501040_0022161
610 Ga0501040_0042266
611 Ga0501040_0173610
612 Ga0501040_0434154
613 Ga0501041_0016609
614 Ga0501041_0028132
615 Ga0501041_0378015
616 Ga0501042_0057734
617 Ga0501042_0093309
618 Ga0501042_0102823
619 Ga0501042_0448423
620 Ga0501043_0168816
621 Ga0501048_0069566
622 Ga0501048_0088614
623 Ga0501048_0193981
624 Ga0501048_0448268
625 Ga0501067_0000186
626 Ga0501067_0013651
627 Ga0501067_0022796
628 Ga0501068_0035548
629 Ga0501068_0065171
630 Ga0501068_0130138
631 Ga0501069_0014331
632 Ga0501069_0052298
633 Ga0501069_0070651
634 Ga0501069_0074279
635 Ga0501069_0110901
636 Ga0501070_0008709
637 Ga0501071_0012505
638 Ga0501071_0034498
639 Ga0501071_0037322
640 Ga0501071_0286138
641 Ga0501072_0093326
642 Ga0501072_0108922
643 Ga0501072_0217004
644 Ga0501073_0000338
645 Ga0501073_0011729
646 Ga0501074_0017280
647 Ga0501074_0027665
648 Ga0501074_0044790
649 Ga0501074_0385385
650 Ga0501075_0074572
651 Ga0501076_0033740
652 Ga0501076_0223980
653 Ga0501077_0017295
654 Ga0501077_0018966
655 Ga0501079_0011363
656 Ga0501079_0046895
657 Ga0501079_0047723
658 Ga0501080_0000231
659 Ga0501080_0029700
660 Ga0501080_0055036
661 Ga0501080_0279357
662 Ga0501083_0040768
663 Ga0501035_0011176
664 Ga0501035_0515885
665 Ga0501044_0408129
666 Ga0501045_0067354
667 nmdc:mga03683_51272_c1
668 nmdc:mga03n38_167186_c1
669 nmdc:mga00v17_10735_c1
670 nmdc:mga0yw44_68235_c1
671 nmdc:mga06z11_25708_c1
672 nmdc:mga07m45_19969_c1
673 nmdc:mga05p37_646843_c1
674 nmdc:mga06r32_162247_c1
675 Ga0495655_0088979
676 Ga0495619_0013919
677 Ga0501084_0034955
678 Ga0501084_0208109
679 Ga0501084_0293294
680 Ga0590075_037727
681 Ga0501082_0021136
682 Ga0501082_0082864
683 Ga0501082_0141461
684 Ga0466962_0006164
685 Ga0466962_0006648
686 Ga0530510_0116593
687 Ga0530510_0285184
688 2676477928
689 2515854374
690 2676489134
691 2816426965
692 2827629252
693 2855390706
694 2856743160
695 2873317077
696 2884702781
697 2891401166
698 2891559835
699 2891566045
700 2895436472
701 2895449096
702 2904767047
703 2904773797
704 2908814690
705 2919420507
706 2919433735
707 2984576897
708 2990258645
709 8055073382
710 8055180196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02586

SRAP

SOS response associated peptidase (SRAP)

13

258

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f20-assembly2.cif.gz_B x-ray crystal structure of protein bt_1218 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr8. 0.8016 4 249
2f20-assembly2.cif.gz_B x-ray crystal structure of protein bt_1218 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr8. 0.7886 4 249
6oov-assembly1.cif.gz_B-2 crystal structure of hmces srap domain in complex with palindromic 3' overhang dna 0.7819 2 249
6oea-assembly1.cif.gz_A crystal structure of hmces srap domain in complex with longer 3' overhang dna 0.7818 2 249
6kbz-assembly4.cif.gz_H crystal structure of yedk with ssdna containing a tetrahydrofuran abasic site 0.7791 2 249
ID Description Score Start End Superfamily
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8583 1 249 3.90.1680.10
af_O05872_1_242_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8549 1 249 3.90.1680.10
af_Q04471_25_258_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8483 26 252 3.90.1680.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8453 1 254 3.90.1680.10
af_I1KYZ5_1_237_3.90.1680.10 Alpha Beta;Alpha-Beta Complex;hypothetical protein yedk fold;SOS response associated peptidase-like 0.8387 1 254 3.90.1680.10
ID Description Score Start End GO Terms
AF-A0A4R2BYH6-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9614 73 253 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A0Q7QP49-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9533 1 252 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A838K6I1-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9495 110 252 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A0Q7QP49-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9495 1 252 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300
AF-A0A4R2BYH6-F1-model_v4 Abasic site processing protein (EC 3.4.-.-) 0.9461 73 253 GO:0003697
GO:0006508
GO:0008233
GO:0016829
GO:0106300

Map